RPSBLAST alignment for GI: 254780544 and conserved domain: PRK14316

>gnl|CDD|184616 PRK14316, glmM, phosphoglucosamine mutase; Provisional. Length = 448
 Score =  519 bits (1339), Expect = e-148
 Identities = 201/445 (45%), Positives = 288/445 (64%), Gaps = 10/445 (2%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGY-LFRGKKKHRRVVIGKDTRLSGYMLENSL 62
           ++FGTDG+RG +N   +TP    ++G A GY L + + +  +V++G+DTR+SG MLE++L
Sbjct: 2   KYFGTDGVRGVANK-ELTPELAFKLGRAGGYVLTKHETERPKVLVGRDTRISGDMLESAL 60

Query: 63  VAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVS 122
           +AG  + G +   LG IP+P VA LTR+L AD GVMISASHNP +DNGIK FG DG+K+S
Sbjct: 61  IAGLLSVGAEVMRLGVIPTPGVAYLTRALGADAGVMISASHNPVEDNGIKFFGSDGFKLS 120

Query: 123 TDIEDRIETLL---EDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRI 179
            + ED IE LL   ED L       + +G          +Y++ +K T+  D  L GL++
Sbjct: 121 DEQEDEIEALLDAEEDTLPRPSG--EGLGTVSDYPEGLRKYLQFLKSTIDED--LSGLKV 176

Query: 180 VVDCANGASYKVAPEVFWELGADVVVIGDKPNGININLDCGSTNVLSLQRKVHEVRADIG 239
            +DCANGA+  +AP +F +LGADV VIG  P+G+NIN   GST+  +LQ  V E  AD+G
Sbjct: 177 ALDCANGATSSLAPRLFADLGADVTVIGTSPDGLNINDGVGSTHPEALQELVVEKGADLG 236

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DR+I VDE G IV+GD+IM +  +       L+ N IVTTVMSN+G  + +  
Sbjct: 237 LAFDGDADRLIAVDENGNIVDGDKIMFICGKYLKEKGRLKKNTIVTTVMSNLGFYKALEE 296

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
            G++  +T+VGDRY++E M+  G+N+GGEQSGHII  DY +TGDGL+ ALQ+ + +K+  
Sbjct: 297 EGINSVKTKVGDRYVVEEMRKGGYNLGGEQSGHIIFLDYNTTGDGLLTALQLAKVMKETG 356

Query: 360 KPVSTICHCFEEYPQFLRSVSVKD-TSILNSSSIVQAIADAESELRGIDRLIVRASGTES 418
           K +S +    ++YPQ L +V V D    + +  I + I   E E+ G  R++VR SGTE 
Sbjct: 357 KKLSELAAEMKKYPQKLVNVRVTDKKKAMENPEIKEIIEKVEEEMAGNGRVLVRPSGTEP 416

Query: 419 LIRIMAEGDDLSRIKRIVDDLAKVI 443
           L+R+MAE      + + VD +A V+
Sbjct: 417 LVRVMAEAPTQEEVDKYVDRIADVV 441