RPSBLAST alignment for GI: 254780544 and conserved domain: PTZ00150

>gnl|CDD|185482 PTZ00150, PTZ00150, phosphoglucomutase-2-like protein; Provisional. Length = 584
 Score = 71.3 bits (175), Expect = 5e-13
 Identities = 76/345 (22%), Positives = 124/345 (35%), Gaps = 75/345 (21%)

Query: 1   MKRRF-----FGTDGIRGKSNTFPITPNFMMRIGIA-----------------VGYLFRG 38
           +KRRF     FGT G+RGK           M  G                   V   F  
Sbjct: 37  LKRRFLKRMEFGTAGLRGK-----------MGAGFNCMNDLTVQQTAQGLCAYVIETFGQ 85

Query: 39  KKKHRRVVIGKDTRLSGYMLENSLVAGFTAAGMDAFILGPI-PSPAVAMLTRSLRADVGV 97
             K R VVIG D R           + F + G   ++ G   P+P V    R L+   GV
Sbjct: 86  ALKSRGVVIGYDGRYHSRRFAEITASVFLSKGFKVYLFGQTVPTPFVPYAVRKLKCLAGV 145

Query: 98  MISASHNPYQDNGIKLFGPDGYKVSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVD--- 154
           M++ASHNP +DNG K++  +G ++    +  I   +  +L  + S ++ +      D   
Sbjct: 146 MVTASHNPKEDNGYKVYWSNGAQIIPPHDKNISAKILSNLEPWSSSWEYLTETLVEDPLA 205

Query: 155 GVHDRYIEHVKRTL-PRDVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNGI 213
            V D Y   +K    P       ++IV    +G   +   +    +G         PN +
Sbjct: 206 EVSDAYFATLKSEYNPACCDRSKVKIVYTAMHGVGTRFVQKALHTVGL--------PNLL 257

Query: 214 NINLDC------------------GSTNVLSLQRKVHEVRADIGIALDGDGDRVIIV--- 252
           ++                      G+   LS++       + + +A D D DR+ +    
Sbjct: 258 SVAQQAEPDPEFPTVTFPNPEEGKGALK-LSME-TAEAHGSTVVLANDPDADRLAVAEKL 315

Query: 253 DEKGAIVNGDQIMALIA------REWMSHSLLRGNGIVTTVMSNI 291
           +    I  G+++ AL+A               +   I T V S +
Sbjct: 316 NNGWKIFTGNELGALLAWWAMKRYRRQGIDKSKCFFICTVVSSRM 360