RPSBLAST alignment for GI: 254780544 and conserved domain: COG1109

>gnl|CDD|31306 COG1109, {ManB}, Phosphomannomutase [Carbohydrate transport and metabolism]. Length = 464
 Score =  404 bits (1039), Expect = e-113
 Identities = 203/457 (44%), Positives = 285/457 (62%), Gaps = 18/457 (3%)

Query: 1   MKRRFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLEN 60
           MK+  FGTDGIRG +    +TP F +++G A+G + R K    +VV+G+DTRLS  ML  
Sbjct: 5   MKKLLFGTDGIRGVAG-EELTPEFALKLGRALGSVLRKKGA-PKVVVGRDTRLSSEMLAA 62

Query: 61  SLVAGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYK 120
           +L AG T+AG+D + LG +P+PAVA  TR L AD GVMI+ASHNP + NGIK FG DG K
Sbjct: 63  ALAAGLTSAGIDVYDLGLVPTPAVAFATRKLGADAGVMITASHNPPEYNGIKFFGSDGGK 122

Query: 121 VSTDIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIV 180
           +S DIE+ IE +L +++      +  +G  KR+    DRYIE +K  +  D+ L+GL++V
Sbjct: 123 ISDDIEEEIEAILAEEVDLPRPSWGELGRLKRIPDALDRYIEFIKSLVDVDLKLRGLKVV 182

Query: 181 VDCANGASYKVAPEVFWELGADVVVIGDKPNGI--NINLDCGSTNVLSLQRKVHEVRADI 238
           VDCANGA+  VAP +  ELGA+VV I   P+G+  NIN + G T +L L + V E  AD+
Sbjct: 183 VDCANGAAGLVAPRLLKELGAEVVSINCDPDGLFPNINPNPGETELLDLAKAVKEHGADL 242

Query: 239 GIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIA 298
           GIA DGD DR+I+VDE+G  V+GDQI+AL+A+  +     +   +VTTVMS++ LE+   
Sbjct: 243 GIAFDGDADRLIVVDERGNFVDGDQILALLAKYLLEK--GKLPTVVTTVMSSLALEKIAK 300

Query: 299 GLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQY 358
            LG  + RT+VGD+YI E M+ NG   GGE+SGHII  D+  TGDGL+AAL VL  + + 
Sbjct: 301 KLGGKVVRTKVGDKYIAEKMRENGAVFGGEESGHIIFPDHVRTGDGLLAALLVLELLAES 360

Query: 359 DKPVSTIC-HCFEEYPQF-LRSVSVKDTS-------ILNSSS---IVQAIADAESELRGI 406
            K +S +      +YPQ    +V V D         +L        V  I   + EL   
Sbjct: 361 GKSLSELLAELLPKYPQSVEINVRVTDEGKAEVLEKLLEELREAKKVDTIDGVKVELEDG 420

Query: 407 DRLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
            R++VR SGTE LIR+  E  D    + + +++A+++
Sbjct: 421 GRVLVRPSGTEPLIRVYVEAKDEELAEELAEEIAELV 457