RPSBLAST alignment for GI: 254780544 and conserved domain: KOG1220

>gnl|CDD|36434 KOG1220, KOG1220, KOG1220, Phosphoglucomutase/phosphomannomutase [Carbohydrate transport and metabolism]. Length = 607
 Score =  123 bits (309), Expect = 1e-28
 Identities = 95/385 (24%), Positives = 167/385 (43%), Gaps = 36/385 (9%)

Query: 3   RRFFGTDGIRGKSNTFPITPNFMMRIGIAVG---YLFRG-KKKHRRVVIGKDTRLSGYML 58
           R  FGT G+RG+        N +  I    G   YL      K+  +VIG D R +    
Sbjct: 59  RIKFGTAGLRGEMRAGFSRMNELTAIQFGQGLAAYLKNQFPSKNLGIVIGHDGRYNSKRF 118

Query: 59  ENSLVAGFTAAGMDAFILGP-IPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPD 117
              + A F   G   ++    +P+P V     +L AD G+MI+ASHNP +DNG K++  +
Sbjct: 119 AELVAAVFLLNGFKVYLFSELVPTPFVPFAVLTLGADAGIMITASHNPKEDNGYKVYWSN 178

Query: 118 GYKVSTDIEDRIETLLEDDLTSYLSCYDS---IGHAKRVD---GVHDRYIEHVKRTLPR- 170
           G ++ +  +++I   +E +L   LS +D      H    D    +   Y E  K  LP  
Sbjct: 179 GAQIISPHDEKISDSIEANLEPRLSSWDDSLVKSHPLLHDILAVIIPPYFEVYKELLPCF 238

Query: 171 ---DVTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDK---PNGININL---DCGS 221
                 L GL+ V    +G       +   +LG D ++   +   P+ +   +   +   
Sbjct: 239 HREANPLSGLKFVYTAGHGVGGFFVKKALEKLGLDTMISVPEQLEPDPMFPTVPFPNPEE 298

Query: 222 TNVLSLQRK-VHEVRADIGIALDGDGDRVIIVDE---KGAIVNGDQIMALIA----REWM 273
              L L  K   +  AD+ +A D D DR  + ++   +  + NG+++ AL++     E  
Sbjct: 299 KGALDLSIKAALKNSADLVLANDPDADRFAVAEKVSGEWRVFNGNELGALLSWWVLEEHK 358

Query: 274 SHSLLRGNGIVTTVMSNIGLERFIAG-LGLSLKRTEVGDRYI----MEYMKNNGFNV-GG 327
             + ++   ++ + +S+ GL RFIA   G   + T  G +++    +E  K+        
Sbjct: 359 GSTPVQDVSMLNSTVSS-GLTRFIAEIEGFHHEETLTGFKWVGNRAIELEKDGKEVHFAF 417

Query: 328 EQSGHIILSDYGSTGDGLVAALQVL 352
           E+S   +  +     DG+ AA++  
Sbjct: 418 EESIGYMFGENHLDKDGVSAAVKFA 442