RPSBLAST alignment of GI: 254780544 and protein with PDBid: 1tuo

>1tuo_A Putative phosphomannomutase; thermus thermophilus HB8, biosynthesis of alginate, structural genomics; 1.70A {Thermus thermophilus} Length = 464
 Score =  194 bits (492), Expect = 4e-50
 Identities = 97/459 (21%), Positives = 181/459 (39%), Gaps = 31/459 (6%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           FGT+G RG       T   + R+  A G     ++    VV+G DTR        +L   
Sbjct: 14  FGTEGFRGVIARE-FTFATLHRLAEAYGRHLL-ERGGGLVVVGHDTRFLADAFARALSGH 71

Query: 66  FTAAGMDAFIL-GPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVSTD 124
               G+   +L GP+P+P ++   R L+A  G M++ASHNP Q  G+K     G  ++ +
Sbjct: 72  LAGMGLKVVLLKGPVPTPLLSFAVRHLKAAGGAMLTASHNPPQYLGVKFKDATGGPIAQE 131

Query: 125 IEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRDVTLQGLRIVVDCA 184
               IE L+ ++  +        G  + +D     +         + ++     +  D  
Sbjct: 132 EAKAIEALVPEEARAL------EGAYETLDLREAYFEALKAHLDLKALSGFSGVLYHDSM 185

Query: 185 NGASYKVAPEVFWELGADV--VVIGDKPNGININLDCG---STNVLSLQRKVHEVRADIG 239
            GA           +G ++    I ++P+ +   ++         ++L     E      
Sbjct: 186 GGAGAGFLKGFLRHVGLEIPVRPIREEPHPLFHGVNPEPIPKNLGVTLAVLGPETPPSFA 245

Query: 240 IALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAG 299
           +A DGD DRV +V   G   N  Q++  +A              V        L+R    
Sbjct: 246 VATDGDADRVGVVLPGGVFFNPHQVLTTLALYRFRKG--HRGRAVKNFAVTWLLDRLGER 303

Query: 300 LGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYD 359
           LG  +  T VG ++I E        +GGE+SG +   ++    DG++ +L +L  +    
Sbjct: 304 LGFGVTTTPVGFKWIKEEFLKGDCFIGGEESGGVGYPEHLPERDGILTSLLLLESVAATG 363

Query: 360 KPVSTICHCFEEYPQFLRS---VSVKDTSILNSSSIVQAIADAESELRGID--------- 407
           K ++      E       +   + +   + L+ +   +    A    +G+D         
Sbjct: 364 KDLAEQFKEVEALTGLTHAYDRLDLPLKAPLDLTPFREPRPLAGLTPKGVDTLDGVKWLY 423

Query: 408 ---RLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
               ++ RASGTE ++RI  E      ++ ++++  K++
Sbjct: 424 EEAWVLFRASGTEPVVRIYVEAQSPELVRALLEEARKLV 462