RPSBLAST alignment of GI: 254780544 and protein with PDBid: 2f7l

>2f7l_A 455AA long hypothetical phospho-sugar mutase; phosphomannomutase, phosphoglucomutase, isomerase; 2.80A {Sulfolobus tokodaii} Length = 455
 Score =  222 bits (564), Expect = 2e-58
 Identities = 112/454 (24%), Positives = 206/454 (45%), Gaps = 18/454 (3%)

Query: 4   RFFGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLV 63
           + FGTDG+RG  N   +TP  ++++  A+G  F    K+ ++++G+D R  G ML   + 
Sbjct: 3   KLFGTDGVRGIVNK-ELTPELVLKLSKAIGTFF---GKNSKILVGRDVRAGGDMLVKIVE 58

Query: 64  AGFTAAGMDAFILGPIPSPAVAMLTRSLRADVGVMISASHNPYQDNGIKLFGPDGYKVST 123
            G  + G++ +  G  P+PA+    ++L  D GV+I+ASHNP   NGIK+   DG ++  
Sbjct: 59  GGLLSVGVEVYDGGMAPTPALQYAVKTLGYDGGVVITASHNPAPYNGIKVVDKDGIEIRR 118

Query: 124 DIEDRIETLLEDDLTSYLSCYDSIGHAKRVDGVHDRYIEHVKRTLP-RDVTLQGLRIVVD 182
           + E+ IE L   +  + +         KR D V   Y+  +   +    +  +  ++++D
Sbjct: 119 EKENEIEDLFFTERFNTIEWSSLTTEVKREDRVISTYVNGILSHVDIEKIKKKNYKVLID 178

Query: 183 CANGASYKVAPEVFWELGADVVVIGDKPN--GININLDCGSTNVLSLQRKVHEVRADIGI 240
            AN       P V   LG  +  I    +        +    ++      V  ++ D+G+
Sbjct: 179 PANSVGALSTPLVARALGCKIYTINGNLDPLFSARQPEPTFDSLKETAEVVKTLKVDLGV 238

Query: 241 ALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGL 300
           A DGD DR I +D +G +  GD+   L++      +      IVT V S+  +E +++  
Sbjct: 239 AHDGDADRAIFIDSEGRVQWGDRSGTLLSYWASVKNPKAIKKIVTAVSSSSLVEEYLSKY 298

Query: 301 GLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHIILSDYGSTGDGLVAALQVLRYIKQYDK 360
            + +  T+VG   I   + +     G E++G  +   +    DG ++   +L  +   + 
Sbjct: 299 NIQVDWTKVGSVDIAHKVADENALAGFEENGGFMYPPHQYVRDGAMSFALMLELLANENV 358

Query: 361 PVSTICHCFEEYPQFLRSVSVKD-----------TSILNSSSIVQAIADAESELRGIDRL 409
             + +     +Y      V +K              + ++SS+     D    +      
Sbjct: 359 SSAELFDRLPKYYLVKTKVDLKPGLMVEEIYKKILEVYSTSSVKAITIDGVKIIGKDFWF 418

Query: 410 IVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVI 443
           +VR SGTE +IRIMAE  D +    +V++L K++
Sbjct: 419 LVRKSGTEPIIRIMAEAKDENVANNLVNELKKIV 452