RPSBLAST alignment of GI: 254780544 and protein with PDBid: 2z0f

>2z0f_A Putative phosphoglucomutase; isomerase, magnesium, metal-binding, structural genomics, NPPSFA; 2.52A {Thermus thermophilus HB8} Length = 524
 Score =  200 bits (508), Expect = 6e-52
 Identities = 101/496 (20%), Positives = 179/496 (36%), Gaps = 60/496 (12%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVGYLFRGKKKHRRVVIGKDTRLSGYMLENSLVAG 65
           FGT G RG S     T   ++ I  A+  L         + + KDT         + ++ 
Sbjct: 26  FGTSGHRGSSLKATFTEAHVLAIAQAIAELRPSFGATGPLFLAKDTHALSEPAWATALSV 85

Query: 66  FTAAGMDAFIL---GPIPSPAVAMLTRSLRADV-----GVMISASHNPYQDNGIKLFGPD 117
           F A G++  +       P+P V++      A       GV+++ SHNP +D G K   P 
Sbjct: 86  FAAHGIEVRVEADGDYTPTPLVSLAILEHNAHHEAKADGVLLTPSHNPPEDGGFKYNPPT 145

Query: 118 GYKVSTDIED----RIETLLEDDLTS--YLSCYDSIGHAKRVDGVHDRYIEHVKRTLPRD 171
           G   +  I      R   LL++ L     L   +++  AK  D       +  +      
Sbjct: 146 GGPANARITRAIEERANALLQEGLKGVKRLPLREALARAKPFDYAGLYVEKVAEAVDLEA 205

Query: 172 VTLQGLRIVVDCANGASYKVAPEVFWELGADVVVIGDKPNG----------ININLDCGS 221
           +   GLRI VD   GAS +V   +    G  + V+    +             I +DC S
Sbjct: 206 IRASGLRIGVDPLGGASLRVWERLAESHGLPLEVVNPTLDPTFRFMPKDHDGKIRMDCSS 265

Query: 222 TNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIAREWMSHSLLRGN 281
                      + R D+ I  D D DR  IV  +G +     + A +   + + S   G 
Sbjct: 266 PYA-MAGLLALKDRFDLAIGNDPDADRHGIVTPRGLMNPNHYLAAALHHLYTTRS-WPGA 323

Query: 282 GIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGEQSGHII-----LS 336
            +  T +++  L+R    LG  +  T VG ++ +  +        GE+S           
Sbjct: 324 KVGKTAVTSALLDRVAQALGREVYETPVGFKHFVAGLLEGWLGFAGEESAGASFLRFDGR 383

Query: 337 DYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEE------YPQFLRSVSVKD------- 383
            + +  DG++  L     + +  +    +     E      Y +    VS +        
Sbjct: 384 PFSTDKDGILMGLLAAELMAKRGQAPDALYEALAEKLGRPYYARKDLPVSPEAKARLARL 443

Query: 384 ------TSILNSSSIVQAIADAESELRGID---------RLIVRASGTESLIRIMAEG-D 427
                  S L    ++Q +  A      +             VR SGTE + ++ AE   
Sbjct: 444 SAKEVHPSTLAGEPVLQVLDRATGNGEPLGGIKVVAANAWFAVRPSGTEDVAKVYAESFL 503

Query: 428 DLSRIKRIVDDLAKVI 443
             + ++R++++   ++
Sbjct: 504 GEAHLERVLEEATALL 519