RPSBLAST alignment of GI: 254780544 and protein with PDBid: 3pmg

>3pmg_A Alpha-D-glucose-1,6-bisphosphate; phosphoglucomutase; HET: SEP; 2.40A {Oryctolagus cuniculus} SCOP: c.84.1.1 c.84.1.1 c.84.1.1 d.129.2.1 PDB: 1c4g_A* 1jdy_A* 1lxt_A 1vkl_A* 1c47_A* Length = 561
 Score =  215 bits (548), Expect = 1e-56
 Identities = 98/532 (18%), Positives = 181/532 (34%), Gaps = 92/532 (17%)

Query: 6   FGTDGIRGKSNTFPITPNFMMRIGIAVG-YLFRGKKKHRRVVIGKDTRLSGYMLENSLVA 64
            GT G+R +   F  + N+      ++   +   +++   +V+G D R         +V 
Sbjct: 16  PGTSGLRKRVKVFQSSTNYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIVR 75

Query: 65  GFTAAGMDAFIL---GPIPSPAVAMLTRSLRADVGVMISASHNPYQDN---GIKLFGPDG 118
              A G+   ++   G + +PAV+ + R ++A  G++++ASHNP   N   GIK    +G
Sbjct: 76  IAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNG 135

Query: 119 YKVSTDIEDRIETLLEDDLTSYLSCYDSI-----------------GHAKRVDGVHDRYI 161
                 I D+I  + +      +     +                      +    + Y 
Sbjct: 136 GPAPEAITDKIFQISKTIEEYAICPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYA 195

Query: 162 EHVKRTLPRDV------TLQGLRIVVDCANGASYKVAPEVFWELGA----DVVVIGDKPN 211
             ++     +           L+I +D  +G       ++  E         V      +
Sbjct: 196 TMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLED 255

Query: 212 GININLDCGSTNVLSLQRKVHEVRADIGIALDGDGDRVIIVDEKGAIVNGDQIMALIARE 271
               + D   T    L   +     D G A DGDGDR +I+ + G  VN    +A+IA  
Sbjct: 256 FGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAAN 315

Query: 272 WMSHSLLRGNG---IVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKNNGFNVGGE 328
             S    +  G      ++ ++  L+R      ++L  T  G ++    M  +  ++ GE
Sbjct: 316 IFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGE 375

Query: 329 QSGHIILSDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCFEEYPQFLRSVSVKDTSILN 388
           +S     SD+    DGL A L  L  +    + V  I    + + +F R+   +      
Sbjct: 376 ESFGTG-SDHIREKDGLWAVLAWLSILATRKQSVEDILK--DHWHKFGRNFFTRYDYEEV 432

Query: 389 SSSIVQAIADAESELR---------------------------------------GI--- 406
            +     +      L                                        G+   
Sbjct: 433 EAEGATKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYHDPVDGSVSKNQGLRLI 492

Query: 407 ----DRLIVRASGTES---LIRIMAE--GDDLSRIKRIVDD-LAKVIPMIDS 448
                R+I R SGT S    IR+  +    D ++I +     LA +I +   
Sbjct: 493 FADGSRIIFRLSGTGSAGATIRLYIDSYEKDNAKINQDPQVMLAPLISIALK 544