RPSBLAST alignment of GI: 254780544 and SCOP domain: d1p5dx3

Alignment
>d1p5dx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 109
 Score = 87.8 bits (217), Expect = 2e-18
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 3/110 (2%)

Query: 261 GDQIMALIAREWMSHSLLRGNGIVTTVMSNIGLERFIAGLGLSLKRTEVGDRYIMEYMKN 320
            D+++ L A++ +S     G  I+  V     L   I+G G      + G   I + MK 
Sbjct: 2   PDRLLMLFAKDVVSR--NPGADIIFDVKCTRRLIALISGYGGRPVMWKTGHSLIKKKMKE 59

Query: 321 NGFNVGGEQSGHIIL-SDYGSTGDGLVAALQVLRYIKQYDKPVSTICHCF 369
            G  + GE SGH+     +    DG+ +A ++L  + Q  +    +   F
Sbjct: 60  TGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAF 109

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: Phosphoglucomutase, first 3 domains
superfamily: Phosphoglucomutase, first 3 domains
family: Phosphoglucomutase, first 3 domains
domain: Phosphomannomutase/phosphoglucomutase
species: Pseudomonas aeruginosa [TaxId: 287]