RPSBLAST alignment of GI: 254780544 and SCOP domain: d1p5dx4

Alignment
>d1p5dx4 d.129.2.1 (X:368-463) Phosphomannomutase/phosphoglucomutase {Pseudomonas aeruginosa [TaxId: 287]} Length = 96
 Score = 39.2 bits (91), Expect = 7e-04
 Identities = 11/41 (26%), Positives = 19/41 (46%)

Query: 408 RLIVRASGTESLIRIMAEGDDLSRIKRIVDDLAKVIPMIDS 448
             +VRAS T  ++ +  E D    ++RI       +  +DS
Sbjct: 50  WGLVRASNTTPVLVLRFEADTEEELERIKTVFRNQLKAVDS 90

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Phosphoglucomutase, C-terminal domain
family: Phosphoglucomutase, C-terminal domain
domain: Phosphomannomutase/phosphoglucomutase
species: Pseudomonas aeruginosa [TaxId: 287]