>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids. RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family. Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft. RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%. The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.

Probab=95.70 E-value=0.012 Score=38.03 Aligned_cols=68 Identities=26% Similarity=0.367 Sum_probs=42.8 Q ss_pred CCCCC--EEECCCCCHHHHHHHHHHHCCCCC-----CEE--CCC-HHHHHHHHHHCCHHHHHHHHHHHHHHCCHHEEHHH Q ss_conf 23331--100378742588899997424699-----702--058-57886444203324599999999873780120632 Q gi|254780545|r 179 RIPHG--VLLVGPPGTGKTLLARAVAGEANV-----PFF--TIS-GSDFVELFVGVGASRVRDMFEQAKNNSPCIVFVDE 248 (647) Q Consensus 179 ~~p~g--~ll~GppGtGKTlla~a~a~e~~~-----~f~--~~~-~s~~~~~~~g~g~~~vr~lf~~a~~~~p~iifiDe 248 (647) T Consensus 21 ~v~~GEiv~ilGpNGaGKSTllk~i~G~l~p~~G~i~~~g~~~~~~pq~~~LS---GGqrQRv~iAral~~~p~lllLDE 97 (177) T cd03222 21 VVKEGEVIGIVGPNGTGKTTAVKILAGQLIPNGDNDEWDGITPVYKPQYIDLS---GGELQRVAIAAALLRNATFYLFDE 97 (177) T ss_pred CCCCCCEEEEECCCCCCHHHHHHHHHCCCCCCCCCEEECCCCEECCCCCCCCC---HHHHHHHHHHHHHHCCCCEEEECC T ss_conf 55899899998999999999999996886788994666686122155515079---899999999999823999999748 Q ss_pred H Q ss_conf 3 Q gi|254780545|r 249 I 249 (647) Q Consensus 249 i 249 (647) T Consensus 98 P 98 (177) T cd03222 98 P 98 (177) T ss_pred C T ss_conf 8

HHsearch alignment for GI: 254780545 and conserved domain: cd03222