>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain. They export degradative enzymes by using a type I protein secretion system and lack an N-terminal signal peptide, but contain a C-terminal secretion signal. The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP). For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli. The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior. HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels. The spectrum of transport substra

Probab=97.08 E-value=0.0029 Score=42.66 Aligned_cols=123 Identities=28% Similarity=0.481 Sum_probs=70.1 Q ss_pred HHHHHCCCCCC--EEECCCCCHHHHHHHHHHHCCCC----------CCEECCCHHHHHH----------HHHH------- Q ss_conf 66420123331--10037874258889999742469----------9702058578864----------4420------- Q gi|254780545|r 173 FKRLGGRIPHG--VLLVGPPGTGKTLLARAVAGEAN----------VPFFTISGSDFVE----------LFVG------- 223 (647) Q Consensus 173 ~~~~g~~~p~g--~ll~GppGtGKTlla~a~a~e~~----------~~f~~~~~s~~~~----------~~~g------- 223 (647) T Consensus 18 L~~i~l~i~~G~~vaIvG~sGsGKSTLl~ll~gl~~p~~G~i~i~g~~~~~~~~~~~~~~i~~v~Q~~~lf~~ti~eNiL 97 (173) T cd03246 18 LRNVSFSIEPGESLAIIGPSGSGKSTLARLILGLLRPTSGRVRLDGADISQWDPNELGDHVGYLPQDDELFSGSIAENIL 97 (173) T ss_pred EECEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCCCHHHHHCCEEEEECCCEECCCCHHHHCC T ss_conf 54769998599999999999980999999996666679998999999933289989842089990888367775899767 Q ss_pred CCHHHHHHHHHHHHHHCCHHEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCHHH Q ss_conf 33245999999998737801206323564144557898862688988998998530323577829999629810088333 Q gi|254780545|r 224 VGASRVRDMFEQAKNNSPCIVFVDEIDAVGRHRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLDAAL 303 (647) Q Consensus 224 ~g~~~vr~lf~~a~~~~p~iifiDeida~~~~r~~~~~~~~~e~~~~ln~ll~~mdg~~~~~~v~vi~aTn~~~~lD~al 303 (647) T Consensus 98 SGGQkQRvalARal~~~p~ililDEpts-------~L---D~~~e~~i~~~l~~l~----~~~~Tvi~vtH~~~~~~--- 160 (173) T cd03246 98 SGGQRQRLGLARALYGNPRILVLDEPNS-------HL---DVEGERALNQAIAALK----AAGATRIVIAHRPETLA--- 160 (173) T ss_pred CHHHHHHHHHHHHHHCCCCEEEEECCCC-------CC---CHHHHHHHHHHHHHHH----HCCCEEEEECCCHHHHH--- T ss_conf 6999999999999827999999968766-------89---9899999999999786----48989999847999998--- Q ss_pred CCCCCCCCEEEEC Q ss_conf 1656423141000 Q gi|254780545|r 304 LRPGRFDRQITVP 316 (647) Q Consensus 304 ~RpgRfd~~i~~~ 316 (647) T Consensus 161 ----~aD~Iivl~ 169 (173) T cd03246 161 ----SADRILVLE 169 (173) T ss_pred ----HCCEEEEEE T ss_conf ----499999993

HHsearch alignment for GI: 254780545 and conserved domain: cd03246