>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=93.23 E-value=0.16 Score=30.05 Aligned_cols=104 Identities=20% Similarity=0.310 Sum_probs=0.0 Q ss_pred EEECCCCCHHHHHHHHHHHCCCCCCEECCCHHHHHH---------HHHHCCHHHHHHHHHHHHHHCCHHEEHHHHHHHHC Q ss_conf 100378742588899997424699702058578864---------44203324599999999873780120632356414 Q gi|254780545|r 184 VLLVGPPGTGKTLLARAVAGEANVPFFTISGSDFVE---------LFVGVGASRVRDMFEQAKNNSPCIVFVDEIDAVGR 254 (647) Q Consensus 184 ~ll~GppGtGKTlla~a~a~e~~~~f~~~~~s~~~~---------~~~g~g~~~vr~lf~~a~~~~p~iifiDeida~~~ 254 (647) T Consensus 3 ililG~~~sGKTsll~~l~~~~~~~~~pT~g~~~~~~~~~~~~l~iwD~~G~~~~r~l~~~Y~~~a~~iI~V--vD---- 76 (159) T cd04150 3 ILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFV--VD---- 76 (159) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCEEEEEEECCCCCCCCHHHHHHCCCCCEEEEE--EE---- T ss_conf 999999999989999999729967758968701799998989999997899721465678647687389999--97---- Q ss_pred CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCC Q ss_conf 4557898862688988998998530323577829999629810088 Q gi|254780545|r 255 HRGIGLGGGNDEREQTLNQLLVEMDGFESSEGVILIAATNRPDVLD 300 (647) Q Consensus 255 ~r~~~~~~~~~e~~~~ln~ll~~mdg~~~~~~v~vi~aTn~~~~lD 300 (647) T Consensus 77 -------~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~ 115 (159) T cd04150 77 -------SNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPN 115 (159) T ss_pred -------CCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCC T ss_conf -------777789999999999996235336982999997566778

HHsearch alignment for GI: 254780545 and conserved domain: cd04150