RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780546|ref|YP_003064959.1| hypothetical protein CLIBASIA_02165 [Candidatus Liberibacter asiaticus str. psy62] (423 letters) >gnl|CDD|30179 cd01992, PP-ATPase, N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This domain has a strongly conserved motif SGGXD at the N terminus.. Length = 185 Score = 175 bits (446), Expect = 1e-44 Identities = 76/189 (40%), Positives = 104/189 (55%), Gaps = 7/189 (3%) Query: 21 HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRL 80 ILVAVSGG DSM LL L + + ++ A+ VDH LR + +E +V+D+C++L Sbjct: 1 KILVAVSGGPDSMALLHLLSEL---KPRLGLRLVAVHVDHGLRPESDEEAAFVADLCAKL 57 Query: 81 RIAHSV-VSWKNSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRS 139 I + V KP L AAAREARY +E AK A +++TAH DDQ ETV MR Sbjct: 58 GIPLYILVVALAPKPGGNLEAAAREARYDFFAEIAKEHGADVLLTAHHADDQAETVLMRL 117 Query: 140 QRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRF 199 R GL+GM I + + RP L R +I ++L + + W EDPSN D R+ Sbjct: 118 LR--GSGLRGLAGMPARIPFG-GGRLIRPLLGITRAEIEAYLRENGLPWWEDPSNEDPRY 174 Query: 200 ERVRVRRFV 208 R R+R + Sbjct: 175 TRNRIRHEL 183 >gnl|CDD|144677 pfam01171, ATP_bind_3, PP-loop family. This family of proteins belongs to the PP-loop superfamily. Length = 182 Score = 167 bits (424), Expect = 7e-42 Identities = 72/187 (38%), Positives = 94/187 (50%), Gaps = 7/187 (3%) Query: 21 HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRL 80 ILVAVSGG DSM LL L + + I +A VDH LRE + E ++V ++C +L Sbjct: 1 KILVAVSGGPDSMALLYLLKKL---KPKFGIDLTAAHVDHGLREESDREAQFVKELCRQL 57 Query: 81 RIAHSVVSWK-NSKPQTGLMAAAREARYALISEHAKTINATLIMTAHTFDDQLETVYMRS 139 I V+ K L AAREARY E AK A +++TAH DDQ ET MR Sbjct: 58 NIPLEVLRVDVAKKSGLNLEEAAREARYDFFEEIAKKNGAEVLLTAHHADDQAETFLMRL 117 Query: 140 QRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNISWCEDPSNTDDRF 199 R GL+G+ I RP L+ + +I +L + I W ED SN D R+ Sbjct: 118 LRG--SGLAGLAGIAPVRPLA-GGRIVRPLLKVTKSEIEEYLKEHGIPWVEDESNADLRY 174 Query: 200 ERVRVRR 206 R R+R Sbjct: 175 TRNRIRH 181 >gnl|CDD|30386 COG0037, MesJ, Predicted ATPase of the PP-loop superfamily implicated in cell cycle control [Cell division and chromosome partitioning]. Length = 298 Score = 144 bits (363), Expect = 5e-35 Identities = 66/219 (30%), Positives = 95/219 (43%), Gaps = 14/219 (6%) Query: 1 MFLSPIES--VRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISV 58 +E R + ILVAVSGG DS+ LL L +I+ A+ V Sbjct: 1 CLREKLERKVKRAIREFNLIEYKILVAVSGGKDSLALLHLLK-----ELGRRIEVEAVHV 55 Query: 59 DHCLRETAKDEVRYVSDVCSRLRIAHSVVSW-----KNSKPQTGLMAAAREARYALISEH 113 DH LR + E V +C +L I V + + + AA R R L+ + Sbjct: 56 DHGLRGYSDQEAELVEKLCEKLGIPLIVERVTDDLGRETLDGKSICAACRRLRRGLLYKI 115 Query: 114 AKTINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCR 173 AK + A I T H DDQ ET M R GL GM ++ L I RP L R Sbjct: 116 AKELGADKIATGHHLDDQAETFLMNLLRG--SGLRGLRGMPPKRPFEGGLLIIRPLLYVR 173 Query: 174 REDIRSFLLQRNISWCEDPSNTDDRFERVRVRRFVRDID 212 ++I + ++ + + ED SN D R+ R R+R + ++ Sbjct: 174 EKEIELYAKEKGLPYIEDESNYDLRYTRNRIREELLPLE 212 >gnl|CDD|30180 cd01993, Alpha_ANH_like_II, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domainhas a strongly conserved motif SGGKD at the N terminus.. Length = 185 Score = 75.3 bits (185), Expect = 3e-14 Identities = 42/174 (24%), Positives = 69/174 (39%), Gaps = 12/174 (6%) Query: 22 ILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLR 81 ILVA+SGG DS+ LL L L R + A++VD + + + V + L Sbjct: 2 ILVALSGGKDSLVLLHVLKK-LQRRYPYGFELEALTVDEGIPGYRDESLEVVERLAEELG 60 Query: 82 IAHSVVSWKNSKPQTGLMAAARE---------ARYALISEHAKTINATLIMTAHTFDDQL 132 I +VS+K + R L+++ AK + A + T H DD+ Sbjct: 61 IELEIVSFKEEYTDDIEVKKRGGKSPCSLCGVLRRGLLNKIAKELGADKLATGHNLDDEA 120 Query: 133 ETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNI 186 ET+ M R + M + D + RP + R ++I + + Sbjct: 121 ETLLMNLLRGGILRLMRPGPILYLDEGD--VTRIRPLVYVREKEIVLYAELNGL 172 >gnl|CDD|31794 COG1606, COG1606, ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]. Length = 269 Score = 34.5 bits (79), Expect = 0.058 Identities = 52/310 (16%), Positives = 102/310 (32%), Gaps = 58/310 (18%) Query: 1 MFLSPIESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDH 60 M LS +E ++ ++ ++VA SGG DS L L D ++V Sbjct: 2 MLLSKLERLKKAIKEK---KKVVVAFSGGVDSSLLAKLAKEALGDN--------VVAVTV 50 Query: 61 CLRETAKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAR-----EARYALISEHAK 115 + E+ ++ + I H + P+ R A Y+ + E A+ Sbjct: 51 DSPYIPRREIEEAKNIAKEIGIRHEFIKMNRMDPEFKENPENRCYLCKRAVYSTLVEEAE 110 Query: 116 TINATLIMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCR-- 173 ++ D + R GL L +L + P Sbjct: 111 KRGYDVVADGTNASD------LFDYRP------GLR-----ALKELGIR--SPLAEFGIT 151 Query: 174 REDIRSFLLQRNISWCEDPSNT--DDRF---ERVRVRRFVRDIDLHALYLKMKKFQDLRV 228 +++IR + + PS R E + V + ++ +L+ + +RV Sbjct: 152 KKEIREIAKSLGLPTWDKPSMACLASRIPYGEEITVEDLKK-VEEAEEFLRELGVRQIRV 210 Query: 229 K--VNNAVAMLIPKYLTVHMRSIIAISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRS 286 + N AV + P+ + + I + + +V+ + L GYRS Sbjct: 211 RSEDNLAVIEVGPEEPEKLLNEVEEIDDKLKKVGF------RKVT-------LDLEGYRS 257 Query: 287 MERVMLFLKS 296 + ++ Sbjct: 258 GKLNKTIKEA 267 >gnl|CDD|30865 COG0519, GuaA, GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism]. Length = 315 Score = 32.4 bits (74), Expect = 0.22 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 7/60 (11%) Query: 13 VRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDH-CLRETAKDEVR 71 +R V +++A+SGG DS + H + D+ + + VDH LR+ ++V Sbjct: 15 IREQVGDGKVILALSGGVDSSVAAVLAHRAIGDQ------LTCVFVDHGLLRKGEAEQVV 68 >gnl|CDD|30185 cd01998, tRNA_Me_trans, tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)- methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.. Length = 349 Score = 31.7 bits (72), Expect = 0.38 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 9/75 (12%) Query: 21 HILVAVSGGSDS---MGLLIAL-HSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDV 76 ++VA+SGG DS LL + V+ F K C ++++++ V Sbjct: 1 KVVVAMSGGVDSSVAAALLKEQGYEVIG--VFMKNWDEDDGKGGC---CSEEDLKDARRV 55 Query: 77 CSRLRIAHSVVSWKN 91 +L I H VV+++ Sbjct: 56 ADQLGIPHYVVNFEK 70 >gnl|CDD|30177 cd01990, Alpha_ANH_like_I, This is a subfamily of Adenine nucleotide alpha hydrolases superfamily. Adenine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.. Length = 202 Score = 31.7 bits (72), Expect = 0.39 Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 8/67 (11%) Query: 22 ILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRLR 81 + VA SGG DS LL A L DR A++ L + E+ + + Sbjct: 1 VAVAFSGGVDSTLLLKAAVDALGDRVL------AVTATSPL--FPRRELEEAKRLAKEIG 52 Query: 82 IAHSVVS 88 I H V+ Sbjct: 53 IRHEVIE 59 >gnl|CDD|30184 cd01997, GMP_synthase_C, The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes.. Length = 295 Score = 30.9 bits (70), Expect = 0.62 Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 8/60 (13%) Query: 21 HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYVSDVCSRL 80 +++A+SGG DS + LH + DR + + VD+ L K+E V ++ S+L Sbjct: 1 KVILALSGGVDSTVAAVLLHKAIGDR------LTCVFVDNGLLR--KNEAERVEELFSKL 52 >gnl|CDD|35262 KOG0039, KOG0039, KOG0039, Ferric reductase, NADH/NADPH oxidase and related proteins [Inorganic ion transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]. Length = 646 Score = 30.7 bits (69), Expect = 0.75 Identities = 23/136 (16%), Positives = 48/136 (35%), Gaps = 17/136 (12%) Query: 251 AISQDILNIDSTLLFYLLRVSAAICGGQISLPGYRSMERVMLFLKSGKRGCVS--IGRVV 308 A SQD+ + +L + GG P ++ ++ + G+ + + Sbjct: 458 APSQDVFKYEVLVL---------VGGGIGVTPFASILKDLLNKISLGRTKAPTSDYSDSL 508 Query: 309 IDRRANFLWITRAVRNLPTLILYPEETTVWDGRYQFQNLSDSLIQIGPQSYRKADVPSGI 368 ++ F W+TR R+ E +D + L SY + D S + Sbjct: 509 KLKKVYFYWVTREQRSFEWFKGLLTEVEEYD-----SSGVIELHNYVTSSYEEGDARSAL 563 Query: 369 PPIIAQRALSSMPSKE 384 ++ Q+ L + + Sbjct: 564 IQMV-QKLLHAKNGVD 578 >gnl|CDD|48196 cd03321, mandelate_racemase, Mandelate racemase (MR) catalyzes the Mg2+-dependent 1,1-proton transfer reaction that interconverts the enantiomers of mandelic acid. MR is the first enzyme in the bacterial pathway that converts mandelic acid to benzoic acid and allows this pathway to utilize either enantiomer of mandelate. MR belongs to the enolase superfamily of enzymes, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion.. Length = 355 Score = 29.6 bits (66), Expect = 1.6 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 13/83 (15%) Query: 127 TFDDQLETVYMRSQRDYAEKGMGLSGMCDTILYDLNLWISRPFLRCRREDIRSFLLQRNI 186 T D+ L V RS R G+GL M D Y+ +L + R + D Q + Sbjct: 168 TADEDLAVV--RSIRQAVGDGVGL--MVD---YNQSLTVPEAIERGQALD------QEGL 214 Query: 187 SWCEDPSNTDDRFERVRVRRFVR 209 +W E+P+ D R+ +R Sbjct: 215 TWIEEPTLQHDYEGHARIASALR 237 >gnl|CDD|146126 pfam03331, LpxC, UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyse the second step in the biosynthetic pathway for lipid A. Length = 276 Score = 29.2 bits (66), Expect = 2.2 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 7/62 (11%) Query: 122 IMTAHTFDDQLETVYMRSQRDYAEKGMGLSGMCD-TILYDLNLWISRPFLRCRREDIRSF 180 I A TF E Y+RS KG+ G + I++D + ++ P LR E +R Sbjct: 183 IAPARTFGFMREIEYLRS------KGLIKGGSLENAIVFDDDKVLNPPGLRFEDEPVRHK 236 Query: 181 LL 182 +L Sbjct: 237 IL 238 >gnl|CDD|30830 COG0482, TrmU, Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]. Length = 356 Score = 28.7 bits (64), Expect = 3.4 Identities = 19/80 (23%), Positives = 29/80 (36%), Gaps = 22/80 (27%) Query: 22 ILVAVSGGSDS---MGLL-------IALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVR 71 +LV +SGG DS LL I L D G +++++R Sbjct: 6 VLVGMSGGVDSSVAAYLLKEQGYEVIGLFMKNWDEDGGG------------GCCSEEDLR 53 Query: 72 YVSDVCSRLRIAHSVVSWKN 91 V +L I VV ++ Sbjct: 54 DAERVADQLGIPLYVVDFEK 73 >gnl|CDD|38051 KOG2840, KOG2840, KOG2840, Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only]. Length = 347 Score = 28.0 bits (62), Expect = 4.7 Identities = 28/147 (19%), Positives = 52/147 (35%), Gaps = 15/147 (10%) Query: 14 RSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRETAKDEVRYV 73 + + + SGG DS +L + L++R ++ +S+D +R D + V Sbjct: 46 KLFARGERVAIGASGGKDST-VLAYVLDALNERHDYGLRLFLLSIDEGIRGYRDDSLEAV 104 Query: 74 SDVCSRLRIAHSVVSWK--------NSKPQTGLMAAAREA------RYALISEHAKTINA 119 + + +VS+K + R + A + A Sbjct: 105 KRNGVQYGLPLCIVSYKDLYGEWTMDEIVSEIGQEIRNNCTFCGVFRRQALDRGADVLGA 164 Query: 120 TLIMTAHTFDDQLETVYMRSQRDYAEK 146 ++T H DD ETV M R + + Sbjct: 165 AELVTGHNADDWAETVLMNLLRGDSAR 191 >gnl|CDD|144363 pfam00733, Asn_synthase, Asparagine synthase. This family is always found associated with pfam00310. Members of this family catalyse the conversion of aspartate to asparagine. Length = 195 Score = 28.0 bits (63), Expect = 5.1 Identities = 27/105 (25%), Positives = 41/105 (39%), Gaps = 15/105 (14%) Query: 6 IESVRFFVRSLVYPAHILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVDHCLRET 65 ++V+ R L + V +SGG DS LIA ++ + +S +K SV + Sbjct: 7 RDAVK---RRLRADVPVGVLLSGGLDSS--LIA--ALAARQSSPPLK--TFSVG--FEGS 55 Query: 66 AKDEVRYVSDVCSRLRIAHSVVSWKNSKPQTGLMAAAREARYALI 110 DE Y V L H + + L+ A E Y L Sbjct: 56 DYDEAPYAELVADHLGTDHHEI---IVTEEE-LLDALPEVIYHLE 96 >gnl|CDD|30168 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly modified version of the P loop, the fingerprint peptide of mononucleotide-binding proteins, is present in the active site of the protein, which appears to be a positively charged cleft containing a number of conserved arginine and lysine residues. Although PAPS reductase has no ATPase activity, it shows a striking similarity to the structure of the ATP pyrophosphatase (ATP PPase) domain of GMP synthetase, indicating that both enzyme families have evolved from a common ancestral nucleotide-binding fold. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) . It is also found in NodP nodulation protein P from Rhizobium meliloti which has ATP sulphurylase activity (sulphate adenylate transferase) .. Length = 173 Score = 27.7 bits (61), Expect = 6.3 Identities = 19/74 (25%), Positives = 28/74 (37%), Gaps = 10/74 (13%) Query: 21 HILVAVSGGSDSMGLLIALHSVLSDRSFGKIKFSAISVD--HCLRETAKDEVRYVSDVCS 78 +++V+ SGG DS LL L I +D + ET +V V Sbjct: 1 NVVVSFSGGKDSTVLLHLALKAL----PELKPVPVIFLDTGYEFPET----YEFVDRVAE 52 Query: 79 RLRIAHSVVSWKNS 92 R + VV +S Sbjct: 53 RYGLPLVVVRPPDS 66 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.139 0.415 Gapped Lambda K H 0.267 0.0726 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 5,192,152 Number of extensions: 278054 Number of successful extensions: 745 Number of sequences better than 10.0: 1 Number of HSP's gapped: 734 Number of HSP's successfully gapped: 17 Length of query: 423 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 327 Effective length of database: 4,189,273 Effective search space: 1369892271 Effective search space used: 1369892271 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 59 (26.5 bits)