BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] (160 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 330 bits (845), Expect = 9e-93, Method: Compositional matrix adjust. Identities = 160/160 (100%), Positives = 160/160 (100%) Query: 1 MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYS 60 MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYS Sbjct: 1 MQYSTIFIILSAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVFFDTSSYS 60 Query: 61 IRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISA 120 IRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISA Sbjct: 61 IRPADIQVLSNLGSWLEKHDCDFLIEGHADELGSRNSSIALGLRRAYAVFNYFVARGISA 120 Query: 121 SRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT 160 SRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT Sbjct: 121 SRMKVTSYGKEMPSVYGHDEDAYAKNRRAIVFLKGCRANT 160 >gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 34.3 bits (77), Expect = 0.001, Method: Compositional matrix adjust. Identities = 25/78 (32%), Positives = 36/78 (46%), Gaps = 5/78 (6%) Query: 50 DSVFFDTSSYSIRPADIQVLSNLGSWLEKHDCDFL-IEGHADELGSRN---SSIALGLRR 105 ++ FD SS P I VL +G L H + + I GH D RN + L L R Sbjct: 233 NTPMFDKSSSIPLPETIVVLQKIGEVLA-HSTEVISIRGHTDASPFRNIARDNWRLSLDR 291 Query: 106 AYAVFNYFVARGISASRM 123 AY+ + + G+S R+ Sbjct: 292 AYSAYQVLMKSGVSEDRI 309 >gi|254780953|ref|YP_003065366.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 190 Score = 31.6 bits (70), Expect = 0.007, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 24/38 (63%) Query: 85 IEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASR 122 I+ H D +G+ +++ + RA + +Y + RG+S++R Sbjct: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150 >gi|254780483|ref|YP_003064896.1| putative inner membrane protein translocase component YidC [Candidatus Liberibacter asiaticus str. psy62] Length = 581 Score = 29.6 bits (65), Expect = 0.028, Method: Composition-based stats. Identities = 25/118 (21%), Positives = 46/118 (38%), Gaps = 7/118 (5%) Query: 31 PDTVLNESSLQEQFSSSVGDSVFFDTSSYSIRPADIQVLSNLGSWL---EKHDCDFLIEG 87 P T N +QE F + +GD + I + I SWL +K+ I Sbjct: 207 PQTATNTFGVQEGFIAVLGDKSLVEQKYSDIEKSSISNFHESNSWLGISDKYWASVFIPS 266 Query: 88 HADELGSRNSSIALGLRRAYAVFNYFVARGISASRMKVTSY----GKEMPSVYGHDED 141 S+ ++ G R A F+ + + T++ KE P+++ +++D Sbjct: 267 KETSFHSQFKYLSDGHARYQAKFSANEITILPGKSITTTNFLFAGAKEFPTIHHYEKD 324 >gi|254780392|ref|YP_003064805.1| leucyl aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 494 Score = 25.4 bits (54), Expect = 0.48, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 41 QEQFSSSVGDSVFFDTSSYSIRPA 64 +EQ + +G V FDT SI+P+ Sbjct: 251 EEQPLAFIGKGVVFDTGGISIKPS 274 >gi|254780846|ref|YP_003065259.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Score = 24.6 bits (52), Expect = 0.88, Method: Compositional matrix adjust. Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 9/73 (12%) Query: 11 SAITMMSISGIDNLDTKISSPDTVLNESSLQEQFSSSVGDSVF------FDTSSYSIRPA 64 S IT++S + + SSP L+ S+QE+ +G S +T++YS A Sbjct: 48 SPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYS---A 104 Query: 65 DIQVLSNLGSWLE 77 + + L WLE Sbjct: 105 EQFIQKVLVEWLE 117 >gi|254780325|ref|YP_003064738.1| mutator MutT protein [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 21.6 bits (44), Expect = 8.3, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 55 DTSSYSIRPADIQVLSNL 72 D +YS+ PAD+ ++S L Sbjct: 117 DLQNYSMLPADLSLISFL 134 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.132 0.372 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,339 Number of Sequences: 1233 Number of extensions: 3410 Number of successful extensions: 12 Number of sequences better than 100.0: 9 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 9 length of query: 160 length of database: 328,796 effective HSP length: 67 effective length of query: 93 effective length of database: 246,185 effective search space: 22895205 effective search space used: 22895205 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 35 (18.1 bits)