HHsearch alignment for GI: 254780549 and conserved domain: pfam06519

>pfam06519 TolA TolA C-terminal. This family consists of several bacterial TolA proteins as well as two eukaryotic proteins of unknown function. Tol proteins are involved in the translocation of group A colicins. Colicins are bacterial protein toxins, which are active against Escherichia coli and other related species (See pfam01024). TolA is anchored to the cytoplasmic membrane by a single membrane spanning segment near the N-terminus, leaving most of the protein exposed to the periplasm.
Probab=99.48  E-value=2.1e-13  Score=95.68  Aligned_cols=86  Identities=17%  Similarity=0.274  Sum_probs=73.7

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             00000789999999999622546565553752999999987998185335640588860589999999999999718898
Q gi|254780549|r  171 KRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFR  250 (271)
Q Consensus       171 ~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi~~~~p~~  250 (271)
T Consensus         9 ~~sev~~Y~a~I~~~Iq~~~~~~~~~~G---K~C~v~I~LapdG~v~~v~~~--sGD-----~~lC~Aa~~Av~k~~~lP   78 (96)
T pfam06519         9 SGAEVDRYAGQIKQAIQSRFLDDDSFAG---KTCRVRIKLAPDGTLISVKVE--GGD-----PALCQAAKAAVAKTAKIP   78 (96)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCC---CEEEEEEEECCCCEEEEEEEC--CCC-----HHHHHHHHHHHHHCCCCC
T ss_conf             4768999999999999984488613499---978999998699569874406--799-----999999999998615799


Q ss_pred             CCH--HHHHHCCEEEEEE
Q ss_conf             884--6776122289974
Q gi|254780549|r  251 LSP--STYKSWRNITLFF  266 (271)
Q Consensus       251 ~p~--~~y~~~~~~~~~F  266 (271)
T Consensus        79 ~pp~~~Vy~~~k~~~L~F   96 (96)
T pfam06519        79 KPPSQDVYEKFKNINLDF   96 (96)
T ss_pred             CCCCHHHHHHHHCCCCCC
T ss_conf             896989999984476779