HHsearch alignment of GI: 254780549 and MMDB domain: 1tol_A_

>1tol_A (A:) G3P - TOLA, protein (fusion protein consisting of minor coat protein, glycine rich linker, TOLA,...; bacteriophage M13, phage infection; 1.85A {Enterobacteria phage M13}
Probab=99.76  E-value=2.6e-18  Score=123.23  Aligned_cols=98  Identities=13%  Similarity=0.201  Sum_probs=82.5

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHH
Q ss_conf             11110000000078999999999962254656555375299999998799818533564058886058999999999999
Q gi|254780549|r  164 KVEKSSRKRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAV  243 (271)
Q Consensus       164 ~~~~~~~~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi  243 (271)
                      ..............|.+.++..+++||.||.+++   ++.|+|+|.|+.||+|++..+  +||+     ++||++|+|||
T Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~a~---~G~v~V~~~i~~~G~v~~v~~--sSG~-----~~lD~aA~~av  187 (222)
T 1tol_A          118 NTKNNGASGADINNYAGQIKSAIESKFYDASSYA---GKTCTLRIKLAPDGMLLDIKP--EGGD-----PALCQAALAAA  187 (222)
T ss_dssp             -------CCHHHHHHHHHHHHHHHTTCTTGGGGT---TCCEEEEEEECTTSCEEEEEE--EEEC-----HHHHHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCC---CCEEEEEEEECCCCEEEEEEE--CCCC-----HHHHHHHHHHH
T ss_conf             8888887535688999999999997268984458---988999999868964986341--6899-----99999999999


Q ss_pred             HHHCCCCCC-HHHHHHCCEEEEEECHHHC
Q ss_conf             971889888-4677612228997444009
Q gi|254780549|r  244 IKSQAFRLS-PSTYKSWRNITLFFVPSKM  271 (271)
Q Consensus       244 ~~~~p~~~p-~~~y~~~~~~~~~F~p~~m  271 (271)
                      .+|.+|+.+ .+.|..|.+|.++|++++|
T Consensus       188 ~~~~~~~~~p~~~~~~~~~i~i~F~l~~~  216 (222)
T 1tol_A          188 KLAKIPKPPSQAVYEVFKNAPLDFKPAAA  216 (222)
T ss_dssp             HHCCCCCCSCHHHHHHHTTCEEEEECCC-
T ss_pred             HHCCCCCCCCHHHHHHHEEEEEEECCCCC
T ss_conf             85889989865676663660499888876