HHsearch alignment of GI: 254780549 and MMDB domain: 2grx_C_

>2grx_C (C:) Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli}
Probab=99.64  E-value=9e-18  Score=120.14  Aligned_cols=93  Identities=13%  Similarity=0.066  Sum_probs=74.0

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCC-CEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             000007899999999996225465655537-5299999998799818533564058886058999999999999971889
Q gi|254780549|r  171 KRIPSQDAIAIVRNRVIANWNIPSDFKRFK-KLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAF  249 (271)
Q Consensus       171 ~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~-~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi~~~~p~  249 (271)
                      .......+...++..+..+|.||..+...+ .+.|.|+|.+++||+|.+..++.+||+.     .||++|+|||.+|.+|
T Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~g~v~v~~~i~~~G~v~~~~i~~sSg~~-----~lD~aal~av~~~~~~  206 (229)
T 2grx_C          132 TSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPAN-----MFEREVKNAMRRWRYE  206 (229)
T ss_dssp             ----------------CCCCCCCHHHHHHTCCEEECEEEECCTTSCCEEEEECCCSSST-----TSHHHHHHHTTSCCCC
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCEEEEEEEECCCCH-----HHHHHHHHHHHHCCCC
T ss_conf             42222321246254321021103899970896489999998599989268999767956-----8999999999966798


Q ss_pred             CCCHHH---HHHCCEEEEEECH
Q ss_conf             888467---7612228997444
Q gi|254780549|r  250 RLSPST---YKSWRNITLFFVP  268 (271)
Q Consensus       250 ~~p~~~---y~~~~~~~~~F~p  268 (271)
                      +-+++.   ...|-.|.|+|+.
T Consensus       207 p~~~~g~~~~~~~~~i~~~f~l  228 (229)
T 2grx_C          207 PGKPGSGIVVNILFKINGTTEI  228 (229)
T ss_dssp             TTCCCSCEECCEEECCCCC---
T ss_pred             CCCCCCCEEEEEEEEECCEEEC
T ss_conf             9986876699899998985210