HHsearch results for GI: 254780549 and protein with PDBid: 1lr0_A

>1lr0_A TOLA protein; domain-swapping, TONB, protein transport; 1.91A {Pseudomonas aeruginosa} SCOP: d.212.1.1
Probab=99.92  E-value=1.4e-24  Score=158.10  Aligned_cols=94  Identities=16%  Similarity=0.262  Sum_probs=83.6

Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             00000789999999999622546565553752999999987998185335640588860589999999999999718898
Q gi|254780549|r  171 KRIPSQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLRENARKAVIKSQAFR  250 (271)
Q Consensus       171 ~~~~~~~~~~~ir~~I~~~w~~p~~~~~~~~~~v~v~i~l~~~G~v~~~~~~~~~~~~~~~~~~~~~~a~rAi~~~~p~~  250 (271)
                      +..++.+|.++|+++|++||++|.+++  .++.|+|+|+|++||+|.+..++.+||+     +.||++|+|||.+|+||+
T Consensus        23 ~~~~~~~y~~~i~~~I~~~W~~P~~~~--~~~~v~v~i~l~~dG~v~~~~i~~sSG~-----~~~d~aa~~Av~ra~p~p   95 (129)
T 1lr0_A           23 GSEVTGSLDDLIVNLVSQQWRRPPSAR--NGMSVEVLIEMLPDGTITNASVSRSSGD-----KPFDSSAVAAVRNVGRIP   95 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCCCCTTCC--TTCCEEEEEEECTTSBEEEEEEEECCSC-----HHHHHHHHHHHHHHCBCG
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCC--CCCEEEEEEEECCCCCEEEEEECCCCCC-----HHHHHHHHHHHHHHCCCC
T ss_conf             588999999999999998468998778--8978999999989998987551027787-----589999999999852699


Q ss_pred             C----CHHHHHH-CCEEEEEECHHHC
Q ss_conf             8----8467761-2228997444009
Q gi|254780549|r  251 L----SPSTYKS-WRNITLFFVPSKM  271 (271)
Q Consensus       251 ~----p~~~y~~-~~~~~~~F~p~~m  271 (271)
                      .    |++.|+. ||+|+|+|+|++|
T Consensus        96 ~p~~~p~~~y~~~~r~i~l~F~Ped~  121 (129)
T 1lr0_A           96 EMQQLPRATFDSLYRQRRIIFKPEDL  121 (129)
T ss_dssp             GGGGSCHHHHHHHTSEEEEEECHHHH
T ss_pred             CCCCCCHHHHHHHEEEEEEEECHHHC
T ss_conf             99877977874400677899882133