RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) >gnl|CDD|143949 pfam00186, DHFR_1, Dihydrofolate reductase. Length = 159 Score = 34.4 bits (80), Expect = 0.034 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKL 202 A+ +N VI W++P D K FK L Sbjct: 7 AVDKNGVIGKDNDLPWHLPEDLKHFKAL 34 >gnl|CDD|29264 cd00209, DHFR, Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5,10-methylenetetrahydrofolate which is then utilized by thymidylate synthase. Inhibition of DHFR interrupts thymidilate synthesis and DNA replication, inhibitors of DHFR (such as Methotrexate) are used in cancer chemotherapy. 5,6,7,8-tetrahydrofolate also is involved in glycine, serine, and threonine metabolism and aminoacyl-tRNA biosynthesis.. Length = 158 Score = 32.5 bits (74), Expect = 0.14 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 +A+ N VI W++P D K FKK Sbjct: 5 VAVDENGVIGKDNKLPWHLPEDLKHFKKT 33 >gnl|CDD|36042 KOG0824, KOG0824, KOG0824, Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]. Length = 324 Score = 28.1 bits (62), Expect = 2.4 Identities = 17/91 (18%), Positives = 34/91 (37%), Gaps = 1/91 (1%) Query: 86 SDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKI-SKATNKEQDLQGISFA 144 S+ TK+ T +KRS+ KG + S+ P D++ + K + Sbjct: 211 SEPTKSKPTLRRSKRSTREKGYWIYESSSDGYYRYDPKDEKYLEECYCAKMETCVMRICG 270 Query: 145 EKKSIDTVVVRPDKKELLSKVEKSSRKRIPS 175 ++ V ++ E + + RI + Sbjct: 271 TAMLLNFVDGVQEQVENEDRCTRRKILRIKA 301 >gnl|CDD|35817 KOG0597, KOG0597, KOG0597, Serine-threonine protein kinase FUSED [General function prediction only]. Length = 808 Score = 28.1 bits (62), Expect = 2.5 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 5/98 (5%) Query: 82 GDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKIS-KATNKEQDLQG 140 G R SD++ +H+ ET KG+Q L+ + V +S K Sbjct: 507 GSRHSDESASHSLSFETPLDFLKKGKQELEPLNNRIITVLSGSSSGVSEKQNLIRYLETL 566 Query: 141 ISFAEKKSIDTVVVRPD---KKELLSKVEKSSRKRIPS 175 + A+ +I T + K LLSK + R +I S Sbjct: 567 KTNAQAANILTNLPIMLLLVKVLLLSKTP-AFRVQIAS 603 >gnl|CDD|133087 cd06229, M14_Endopeptidase_I, Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3.4.19.11). ENP1 is a member of the M14 family of metallocarboxypeptidases (MCPs). However it has an exceptional type of activity of hydrolyzing the gamma-D-Glu-(L)meso-diaminopimelic acid (gamma-D-Glu-Dap) bond of L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid and L-Ala-gamma-D-Glu-(L)meso-diaminopimelic acid(L)-D-Ala peptides. ENP1has a different substrate specificity and cellular role than MpaA (MpaA does not belong to this group). ENP1 hydrolyzes the gamma-D-Glu-Dap bond of MurNAc-tripeptide and MurNAc-tetrapeptide, as well as the amide bond of free tripeptide and tetrapeptide . ENP1 is active on spore cortex peptidoglycan, and is produced at stage IV of sporulation in forespore and spore integuments. Length = 255 Score = 26.9 bits (60), Expect = 7.0 Identities = 10/42 (23%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Query: 227 GTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVP 268 T L+ + + E AR + N+T+ FVP Sbjct: 32 TTLLLMKFIEEYARAYENNEKLGGYDLREL--LENVTICFVP 71 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.317 0.131 0.359 Gapped Lambda K H 0.267 0.0719 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,046,052 Number of extensions: 151434 Number of successful extensions: 395 Number of sequences better than 10.0: 1 Number of HSP's gapped: 395 Number of HSP's successfully gapped: 12 Length of query: 271 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 179 Effective length of database: 4,275,709 Effective search space: 765351911 Effective search space used: 765351911 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 57 (25.8 bits)