RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) >gnl|CDD|165319 PHA03020, PHA03020, hypothetical protein; Provisional. Length = 352 Score = 28.0 bits (62), Expect = 2.4 Identities = 15/56 (26%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Query: 21 LYFNFNVQLLVPISRREMLSVDNIYNEDYHSSKYKKIEEPVVQFKGSSQENLVRDF 76 LYFNF++ V +S + L + N + I + + QFK ++ N + F Sbjct: 194 LYFNFDINTFVILSCKTKLYTADGINS---IIESIYICDALAQFKEKTEYNFIEYF 246 >gnl|CDD|129856 TIGR00774, NhaB, Na+/H+ antiporter NhaB. These proteins are members of the NhaB Na+:H+ Antiporter (NhaB) Family (TC 2.A.34). The only characterised member of this family is the Escherichia coli NhaB protein, which has 12 GES predicted transmembrane regions, and catalyses sodium/proton exchange. Unlike NhaA this activity is not pH dependent. Length = 515 Score = 27.5 bits (61), Expect = 3.7 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Query: 156 PDK-KELLSKVEKSSRKRIPSQDAIAIVRNRVIANWNI 192 PD +++L ++ RK +QD I + +IA W I Sbjct: 275 PDNVRQILVDFDREERKTRTNQDKIKLWVQALIAVWLI 312 >gnl|CDD|177389 PHA02555, 14, neck protein; Provisional. Length = 216 Score = 27.3 bits (61), Expect = 3.8 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Query: 35 RREMLSVDNIYNEDYHSSKYKK---IEEPVVQFKG-SSQENLVRDFSVQEN 81 RE ++ D I+ ED SK+ K I + F+G Q + F +Q N Sbjct: 38 PREYVNPDLIFGED-VQSKFTKAWKIAAYLNSFEGYEGQGDFFSKFGMQIN 87 >gnl|CDD|183115 PRK11394, PRK11394, 23S rRNA pseudouridine synthase E; Provisional. Length = 217 Score = 26.6 bits (58), Expect = 6.6 Identities = 30/132 (22%), Positives = 55/132 (41%), Gaps = 15/132 (11%) Query: 73 VRDFSVQENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMP--VSPYDKQKISK 130 +R F + EN + + ++RS+ K E L P V P + + Sbjct: 1 MRQFIISENTMQKTSFRNHQVKRFSSQRSTRRKPENQPTRVILFNKPYDVLPQFTDEAGR 60 Query: 131 ATNKE-QDLQGISFAEKKSIDT--VVVRPDKKELLSKVEKSSRKR----------IPSQD 177 T KE +QG+ A + D+ ++V + L +++ + ++ IP+QD Sbjct: 61 KTLKEFIPVQGVYAAGRLDRDSEGLLVLTNNGALQARLTQPGKRTGKIYYVQVEGIPTQD 120 Query: 178 AIAIVRNRVIAN 189 A+ +RN V N Sbjct: 121 ALEALRNGVTLN 132 >gnl|CDD|179068 PRK00566, PRK00566, DNA-directed RNA polymerase subunit beta'; Provisional. Length = 1156 Score = 26.2 bits (59), Expect = 9.6 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Query: 140 GISFAEKKSIDTVVVRPDKKELLSKVEK 167 GIS ID +V+ P+KKE++ + EK Sbjct: 614 GISI----GIDDIVIPPEKKEIIEEAEK 637 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.131 0.359 Gapped Lambda K H 0.267 0.0623 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,231,830 Number of extensions: 259503 Number of successful extensions: 521 Number of sequences better than 10.0: 1 Number of HSP's gapped: 521 Number of HSP's successfully gapped: 17 Length of query: 271 Length of database: 5,994,473 Length adjustment: 92 Effective length of query: 179 Effective length of database: 4,006,537 Effective search space: 717170123 Effective search space used: 717170123 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 56 (25.6 bits)