RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) >3cse_A Dihydrofolate reductase; protein-ligand complex, oxidoreductase; HET: NAP N22; 1.60A {Candida glabrata} PDB: 3eej_A* 3eek_A* 3eel_A* 3eem_A* (A:) Length = 227 Score = 27.4 bits (60), Expect = 1.8 Identities = 7/46 (15%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGFVLGK 219 A++ I W + + K F+++ + Q ++G+ Sbjct: 11 AALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTNDNSKQNVVIMGR 56 >3dau_A Dihydrofolate reductase; oxidoreductase, pseudo-rossmann fold, adenine nucleotide binding domain, antibiotic resistance; HET: MTX NAP; 1.50A {Escherichia coli K12} PDB: 1ddr_A* 1dds_A* 1ra9_A* 1dre_A* 1drh_A* 1dyi_A* 1dyh_A* 1jol_A* 1jom_A* 1ra1_A* 1dyj_A* 1ra3_A* 1ra8_A* 1ra2_A* 1rb2_A* 1rb3_A* 1rc4_A* 1rd7_A* 1re7_A* 1rf7_A* ... (A:) Length = 159 Score = 27.2 bits (60), Expect = 2.1 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 A+ +RVI WN+P+D FK+ Sbjct: 6 AALAVDRVIGMENAMPWNLPADLAWFKRN 34 >2w9h_A DHFR, dihydrofolate reductase; NADP, trimethoprim, oxidoreductase, one-carbon metabolism; HET: TOP; 1.48A {Staphylococcus aureus} PDB: 2w9g_A* 3fyw_X* 3fyv_X* 3fy8_X* 3fy9_X* 3fq0_A* 3f0b_X* 3fqc_A* 3fqz_A* 3f0u_X* 3fqf_A* 3fqo_A* 3fqv_A* 2w9s_A* 2w9t_A (A:) Length = 159 Score = 27.2 bits (60), Expect = 2.4 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 +A RVI W++P+D K KKL Sbjct: 7 VAHDLQRVIGFENQLPWHLPNDLKHVKKL 35 >2cs8_A KIAA0535 protein; ST18, zinc-finger, C2HC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} (A:) Length = 108 Score = 27.1 bits (59), Expect = 2.7 Identities = 9/62 (14%), Positives = 14/62 (22%) Query: 79 QENGDRFSDQTKTHATENETKRSSSSKGEQALKESALLRMPVSPYDKQKISKATNKEQDL 138 NG S + + + G + P + Q I K Sbjct: 47 PLNGASLSWKLNKQELPHCPLPGCNGLGHVNNVFVTHRSLSGCPLNAQVIKKGKVSSGPS 106 Query: 139 QG 140 G Sbjct: 107 SG 108 >3ia4_A Dihydrofolate reductase; NADPH, methotrexate, oxidoreductase; HET: NDP MTX; 1.70A {Moritella profunda} PDB: 3ia5_A (A:) Length = 162 Score = 26.8 bits (59), Expect = 3.1 Identities = 9/29 (31%), Positives = 16/29 (55%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 A+ NRVI W++P++ + FK+ Sbjct: 7 AALANNRVIGLDNKMPWHLPAELQLFKRA 35 >1zdr_A Dihydrofolate reductase; DHFR, NADP, oxidoreductase; 2.00A {Geobacillus stearothermophilus} (A:) Length = 164 Score = 26.9 bits (59), Expect = 3.4 Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 +A+ NRVI W++P+D FK++ Sbjct: 6 VAMDENRVIGKDNRLPWHLPADLAYFKRV 34 >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, structurual genomics; 2.20A {Pseudomonas aeruginosa PAO1} (A:1-131,A:320-340) Length = 152 Score = 26.1 bits (57), Expect = 5.1 Identities = 11/55 (20%), Positives = 17/55 (30%), Gaps = 5/55 (9%) Query: 219 KINVDVVG-----GTELVRRMLRENARKAVIKSQAFRLSPSTYKSWRNITLFFVP 268 +NV VVG G LV + + + A S + +L Sbjct: 6 PLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRXGFAESSLRVGD 60 >2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotide, structural genomics, NPPSFA; 2.80A {Thermus thermophilus HB8} (A:1-114,A:184-417) Length = 348 Score = 25.8 bits (56), Expect = 5.6 Identities = 6/32 (18%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Query: 127 KISKATNKEQDLQGI-SFAEKKSIDTVVVRPD 157 +++ D++ + +A + ID +V P+ Sbjct: 39 ALAELVPWNGDVEALADWALAEGIDLTLVGPE 70 >3e0b_A Dihydrofolate reductase; oxidoreductase; HET: NAP N22; 2.25A {Bacillus anthracis} PDB: 3dat_A* 2qk8_A* 3fl8_A* 3fl9_A* 2kgk_A* (A:) Length = 166 Score = 25.8 bits (56), Expect = 7.3 Identities = 10/29 (34%), Positives = 15/29 (51%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 +A+ NRVI W +PS+ + KK Sbjct: 11 VAMDENRVIGKDNNLPWRLPSELQYVKKT 39 >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* (A:79-341,A:433-498) Length = 329 Score = 25.3 bits (54), Expect = 7.8 Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 1 MRLENGLAISMILHVMFLLLLYFNF 25 +RL A++ I +FL+L++ + Sbjct: 261 LRLGRSYAVNSIKQFVFLVLVHLDL 285 >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} (C:1-91) Length = 91 Score = 25.2 bits (55), Expect = 9.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Query: 197 KRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVR 232 K FK+ R+K+ F G +GK+ + T + R Sbjct: 14 KTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISR 49 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.131 0.359 Gapped Lambda K H 0.267 0.0576 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,867,783 Number of extensions: 78745 Number of successful extensions: 178 Number of sequences better than 10.0: 1 Number of HSP's gapped: 178 Number of HSP's successfully gapped: 13 Length of query: 271 Length of database: 4,956,049 Length adjustment: 87 Effective length of query: 184 Effective length of database: 2,015,014 Effective search space: 370762576 Effective search space used: 370762576 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (24.9 bits)