RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780549|ref|YP_003064962.1| signal peptide protein [Candidatus Liberibacter asiaticus str. psy62] (271 letters) >d1lr0a_ d.212.1.1 (A:) TolA {Pseudomonas aeruginosa [TaxId: 287]} Length = 126 Score = 43.9 bits (103), Expect = 1e-05 Identities = 15/102 (14%), Positives = 33/102 (32%), Gaps = 12/102 (11%) Query: 175 SQDAIAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRM 234 + ++ N V W P + + V++ ++ G + G + Sbjct: 25 TGSLDDLIVNLVSQQWRRPPSARN--GMSVEVLIEMLPDGTITNASVSRSSG-----DKP 77 Query: 235 LRENARKAVIKSQAF----RLSPSTY-KSWRNITLFFVPSKM 271 +A AV +L +T+ +R + F P + Sbjct: 78 FDSSAVAAVRNVGRIPEMQQLPRATFDSLYRQRRIIFKPEDL 119 >d1tola2 d.212.1.1 (A:125-216) TolA {Escherichia coli [TaxId: 562]} Length = 92 Score = 41.1 bits (96), Expect = 1e-04 Identities = 14/91 (15%), Positives = 35/91 (38%), Gaps = 9/91 (9%) Query: 179 IAIVRNRVIANWNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRRMLREN 238 +++ + + + S + + +L G + +++ GG + + Sbjct: 9 AGQIKSAIESKFYDASSYAG---KTCTLRIKLAPDGML---LDIKPEGGDPALCQAALAA 62 Query: 239 ARKAVIKSQAFRLSPSTYKSWRNITLFFVPS 269 A+ A I S + Y+ ++N L F P+ Sbjct: 63 AKLAKIPKP---PSQAVYEVFKNAPLDFKPA 90 >d3dfra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]} Length = 162 Score = 32.8 bits (74), Expect = 0.032 Identities = 8/28 (28%), Positives = 12/28 (42%), Gaps = 5/28 (17%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKL 202 A RN +I W++P D F+ Sbjct: 6 AQNRNGLIGKDGHLPWHLPDDLHYFRAQ 33 >d1aoea_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} Length = 192 Score = 32.1 bits (72), Expect = 0.054 Identities = 6/47 (12%), Positives = 16/47 (34%), Gaps = 5/47 (10%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGFVLGKIN 221 A+ I W + + + FK + + + ++G+ Sbjct: 12 ALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTTKPNTRNAVIMGRKT 58 >d1seja1 c.71.1.1 (A:3-180) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Cryptosporidium hominis [TaxId: 237895]} Length = 178 Score = 31.3 bits (70), Expect = 0.084 Identities = 14/59 (23%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKLRVKMHFQLNQKGFVLGKINVDVVGGTELVRR 233 A V + I W+I D K F K+ + ++G+ D +G L R Sbjct: 10 ASVLSSGIGINGQLPWSISEDLKFFSKITNNKCDSNKKNALIMGRKTWDSIGRRPLKNR 68 >d2fzia1 c.71.1.1 (A:1-206) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]} Length = 206 Score = 31.4 bits (70), Expect = 0.094 Identities = 5/29 (17%), Positives = 12/29 (41%), Gaps = 5/29 (17%) Query: 179 IAIVRNRVIAN-----WNIPSDFKRFKKL 202 +A+ + I W + + FK++ Sbjct: 11 VALTTSYGIGRSNSLPWKLKKEISYFKRV 39 >d1d1ga_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Thermotoga maritima [TaxId: 2336]} Length = 164 Score = 31.0 bits (69), Expect = 0.11 Identities = 8/33 (24%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 179 IAIVRNRVIAN----WNIPSDFKRFKKLRVKMH 207 +A+ + IA+ W+ D K F+K+ ++ Sbjct: 7 LAMDVSGKIASSVESWSSFEDRKNFRKITTEIG 39 >d1df7a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]} Length = 159 Score = 30.8 bits (69), Expect = 0.12 Identities = 7/27 (25%), Positives = 11/27 (40%), Gaps = 5/27 (18%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKK 201 A + VI W +P D F++ Sbjct: 7 AQATSGVIGRGGDIPWRLPEDQAHFRE 33 >d1ra9a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]} Length = 159 Score = 29.3 bits (65), Expect = 0.32 Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 5/28 (17%) Query: 180 AIVRNRVIAN-----WNIPSDFKRFKKL 202 A+ +RVI WN+P+D FK+ Sbjct: 7 ALAVDRVIGMENAMPWNLPADLAWFKRN 34 >d1vdra_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Haloferax volcanii [TaxId: 2246]} Length = 157 Score = 27.3 bits (60), Expect = 1.2 Identities = 8/33 (24%), Positives = 16/33 (48%), Gaps = 9/33 (27%) Query: 179 IAIV---RNRVIAN------WNIPSDFKRFKKL 202 +++ NRVI +IP+D K+++ Sbjct: 3 VSVAALAENRVIGRDGELPWPSIPADKKQYRSR 35 >d1kmva_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Score = 26.7 bits (58), Expect = 1.9 Identities = 9/48 (18%), Positives = 21/48 (43%), Gaps = 6/48 (12%) Query: 180 AIVRNRVIAN-----W-NIPSDFKRFKKLRVKMHFQLNQKGFVLGKIN 221 A+ +N I W + ++F+ F+++ + Q ++GK Sbjct: 9 AVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKT 56 >d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 221 Score = 26.5 bits (57), Expect = 2.7 Identities = 8/31 (25%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Query: 140 GISFAEKKSI---DTVVVRPDKKELLSKVEK 167 GI + + DTV++ + + L+K E+ Sbjct: 191 GIYIPKLGGVRIEDTVLITENGAKRLTKTER 221 >d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Score = 26.0 bits (56), Expect = 3.3 Identities = 6/15 (40%), Positives = 12/15 (80%) Query: 150 DTVVVRPDKKELLSK 164 T+++RP KE++S+ Sbjct: 277 HTILLRPTCKEVVSR 291 >d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} Length = 249 Score = 25.9 bits (55), Expect = 3.4 Identities = 6/16 (37%), Positives = 9/16 (56%) Query: 150 DTVVVRPDKKELLSKV 165 TV+V D L +K+ Sbjct: 234 HTVIVTKDGPILTTKI 249 >d1e6ya1 a.89.1.1 (A:1284-1569) Alpha chain {Archaeon Methanosarcina barkeri [TaxId: 2208]} Length = 286 Score = 26.2 bits (58), Expect = 3.5 Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 6/40 (15%) Query: 42 DNI------YNEDYHSSKYKKIEEPVVQFKGSSQENLVRD 75 D+I Y+ DY + KY K + +V+D Sbjct: 70 DDILDNNTYYDVDYINDKYNGAATVGKDNKVKASLEVVKD 109 >d1juva_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Bacteriophage T4 [TaxId: 10665]} Length = 193 Score = 25.5 bits (55), Expect = 5.4 Identities = 4/30 (13%), Positives = 7/30 (23%), Gaps = 6/30 (20%) Query: 179 IAIVRNRVIAN-----WN-IPSDFKRFKKL 202 + W + D + FK Sbjct: 14 VDGFNELAFGLGDGLPWGRVKKDLQNFKAR 43 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.317 0.131 0.359 Gapped Lambda K H 0.267 0.0509 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 935,133 Number of extensions: 42187 Number of successful extensions: 103 Number of sequences better than 10.0: 1 Number of HSP's gapped: 102 Number of HSP's successfully gapped: 24 Length of query: 271 Length of database: 2,407,596 Length adjustment: 84 Effective length of query: 187 Effective length of database: 1,254,276 Effective search space: 234549612 Effective search space used: 234549612 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.3 bits)