HHsearch alignment for GI: 254780551 and conserved domain: PRK09109

>PRK09109 motC flagellar motor protein; Reviewed.
Probab=99.28  E-value=1.5e-08  Score=69.75  Aligned_cols=110  Identities=18%  Similarity=0.238  Sum_probs=83.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999999998287125678643049999999999999999641135301677777999999999999999
Q gi|254780551|r  110 QDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILLGLCVS  189 (230)
Q Consensus       110 ~e~i~~~le~~~~~e~~~l~~~l~~L~ti~s~AP~lGLlGTV~Gmi~aF~~ia~~g~~~~~~a~GIseALitTa~GL~VA  189 (230)
T Consensus       121 ~~~i~~~L~~ei~~~~~r~~~~~~~~~~~g~~aPafGmiGtviGLI~mL~~l~---d-p~~lG~~mA~ALvtT~yGv~lA  196 (246)
T PRK09109        121 PESIRSVLEVEIDTQEHRDLQAAKVFESMGGYAPTIGIIGAVMGLIHVMENLA---D-PSQLGSGIAVAFVATIYGVASA  196 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC---C-HHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999998277899999987267649999999999988069---9-9999988799999999999999


Q ss_pred             H-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9-999999999999999999999999999999999
Q gi|254780551|r  190 I-PSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR  223 (230)
Q Consensus       190 I-Pa~~~yn~l~~rv~~~~~~le~~a~~~~~~l~r  223 (230)
T Consensus       197 n~v~~PiA~kl~~~~~~e~~~~~~i~egil~i~~g  231 (246)
T PRK09109        197 NLLFLPVANKLKSVIARQSRYREMLVEGLVAIAEG  231 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             99998899999999999999989999999998689