BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780551|ref|YP_003064964.1| tolQ protein [Candidatus
Liberibacter asiaticus str. psy62]
         (230 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|154252566|ref|YP_001413390.1| Tol-Pal system TolQ [Parvibaculum lavamentivorans DS-1]
 gi|154156516|gb|ABS63733.1| Tol-Pal system TolQ [Parvibaculum lavamentivorans DS-1]
          Length = 241

 Score =  192 bits (488), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 83/222 (37%), Positives = 138/222 (62%), Gaps = 1/222 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            +D S++ LF++  L VK ++  L   S+ SW++I  K   F  + R+  +FE++FWSG+
Sbjct: 19  PLDFSMWGLFLRADLVVKLVMLGLLFASVWSWAIIFDKWWRFARVERRADQFERIFWSGR 78

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SL+ + + + +     L+A+F++AM EW++S D  A S +G+++R+D++M V I+RE+  
Sbjct: 79  SLDELYQEMGHRPQHPLSALFIAAMREWRRSQDVVASSFVGLKERVDKVMQVTISREMMN 138

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L FL ++ S    +G+ G V G+M  FQSIA     N+  +   I E+L +  LGL
Sbjct: 139 LESRLLFLATVGSVAPFIGLFGTVWGIMNSFQSIAISRDTNLAVVAPGIAEALFATALGL 198

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+F   S +   +ME FA+EFSAILSRQ +  
Sbjct: 199 VAAIPAVVAYNRFSNQSSRIGQRMESFADEFSAILSRQLDER 240


>gi|86359057|ref|YP_470949.1| protein transporter protein [Rhizobium etli CFN 42]
 gi|218672504|ref|ZP_03522173.1| protein transporter protein [Rhizobium etli GR56]
 gi|86283159|gb|ABC92222.1| protein transporter protein [Rhizobium etli CFN 42]
 gi|327193470|gb|EGE60366.1| protein transporter protein [Rhizobium etli CNPAF512]
          Length = 239

 Score =  190 bits (483), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 113/232 (48%), Positives = 162/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S+++LFMQ G+ VK ++  L   S+ +W+++I K + +   RRQF +
Sbjct: 1   MEQVGLAAATTDVSLWSLFMQAGIVVKLVMLGLIAASVWTWAIVIDKYLAYGRARRQFDK 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + +SL   +N GLA+IF++AM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRSLSERNNTGLASIFVAAMREWKKSFERGARSPIGLQMRIDRAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V +ARE E +  +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTLARETEYLGARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFSADAGKLSARMEGFADEFSAILSRQIDEKL 232


>gi|222149660|ref|YP_002550617.1| protein TolQ [Agrobacterium vitis S4]
 gi|221736642|gb|ACM37605.1| protein TolQ [Agrobacterium vitis S4]
          Length = 239

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 116/232 (50%), Positives = 161/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S++ALFMQ G  VK ++  L   S+ +W+++I K V+F   RRQF +
Sbjct: 1   MEQVGLAAASHDVSLWALFMQAGWVVKIVMIGLLGASVWTWAIVIDKYVSFAKARRQFDQ 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + ++L   +N GLAAIF+SAM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRTLAERNNTGLAAIFVSAMREWKKSFERGARSPIGLQMRIDRSMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V +ARE E    +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTMAREAEHFEARLGSLATIGSAGPFIGLFGTVIGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  ++ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFSGEAGKLSSRMEGFADEFSAILSRQIDEKL 232


>gi|116253712|ref|YP_769550.1| TolQ protein uptake system component [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115258360|emb|CAK09463.1| putative TolQ protein uptake system component [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 239

 Score =  190 bits (482), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 114/232 (49%), Positives = 162/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S+++LFMQ G+ VK ++  L   S+ +W+++I K + +   RRQF +
Sbjct: 1   MEQVGLAAATTDVSLWSLFMQAGIVVKLVMLGLIAASVWTWAIVIDKYLAYGRARRQFDK 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + +SL   +N GLAAIF++AM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRSLSERNNTGLAAIFVAAMREWKKSFERGARSPIGLQMRIDRAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V +ARE E +  +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTLARETEFLGARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFSADAGKLSGRMEGFADEFSAILSRQIDEKL 232


>gi|190893279|ref|YP_001979821.1| biopolymer transporter protein [Rhizobium etli CIAT 652]
 gi|209550780|ref|YP_002282697.1| protein TolQ [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|190698558|gb|ACE92643.1| biopolymer transporter protein [Rhizobium etli CIAT 652]
 gi|209536536|gb|ACI56471.1| protein TolQ [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 239

 Score =  190 bits (482), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 113/232 (48%), Positives = 162/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S+++LFMQ G+ VK ++  L   S+ +W+++I K + +   RRQF +
Sbjct: 1   MEQVGLAAATTDVSLWSLFMQAGIVVKLVMLGLIAASVWTWAIVIDKYLAYGRARRQFDK 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + +SL   +N GLAAIF++AM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRSLSERNNTGLAAIFVAAMREWKKSFERGARSPIGLQMRIDRAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V ++RE E +  +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTLSRESEFLGARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFSADAGKLSGRMEGFADEFSAILSRQIDEKL 232


>gi|241206188|ref|YP_002977284.1| protein TolQ [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240860078|gb|ACS57745.1| protein TolQ [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 239

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 114/232 (49%), Positives = 161/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S+++LFMQ G+ VK ++  L   S+ +W+++I K + +   RRQF +
Sbjct: 1   MEQVGLAAATTDVSLWSLFMQAGIVVKLVMLGLIAASVWTWAIVIDKYLAYGRARRQFDK 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + +SL    N GLAAIF++AM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRSLSERSNTGLAAIFVAAMREWKKSFERGARSPIGLQMRIDRAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V +ARE E +  +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTLARETEFLGARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFSADAGKLSGRMEGFADEFSAILSRQIDEKL 232


>gi|159185874|ref|NP_356903.2| tolQ protein [Agrobacterium tumefaciens str. C58]
 gi|159141008|gb|AAK89688.2| tolQ Protein [Agrobacterium tumefaciens str. C58]
          Length = 239

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 116/232 (50%), Positives = 161/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S++ALFMQ G  VK ++  L   S+ +W+++  K V+F   +RQF +
Sbjct: 1   MEQAGLAAATHDVSLWALFMQAGFIVKFVMIGLIAASVWTWAIVFDKYVSFGKAKRQFDQ 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + ++L    N+GLAAIF+SAM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRTLAERQNVGLAAIFVSAMREWKKSFERGARSPIGLQMRIDRAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V IARE E+   +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTIAREGEQYEARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFTADAHKLSARMEGFADEFSAILSRQIDEKL 232


>gi|119383435|ref|YP_914491.1| MotA/TolQ/ExbB proton channel [Paracoccus denitrificans PD1222]
 gi|119373202|gb|ABL68795.1| Cell division and transport-associated protein TolQ [Paracoccus
           denitrificans PD1222]
          Length = 231

 Score =  190 bits (481), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 76/220 (34%), Positives = 123/220 (55%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            +D S+ ALF +  L V+ ++ +L + S  +W++IIQK ++F   RR+   F++ FWSGQ
Sbjct: 10  PVDFSLIALFARASLTVQIVMVILILASFWAWAIIIQKFISFNAARREADRFDRAFWSGQ 69

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+ +   +    +     IF + M+EW++S         G+  RIDR M+V I RE + 
Sbjct: 70  PLDDLYDRIGETPSGPAERIFSAGMAEWRRSHRDDGNLIAGVTARIDRAMNVTINRENDR 129

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +T  L FL ++ S    +G+ G V G+   F+ IA   + ++  +   I E+L++  LGL
Sbjct: 130 LTRGLPFLATVGSTAPFIGLFGTVWGIKTAFEEIAISQNTSLAVVAPGIAEALVATALGL 189

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ I YNK   D+ +     E FA+EFS ILSRQ +
Sbjct: 190 LAAIPAVIFYNKLSSDADRITGGYETFADEFSTILSRQLD 229


>gi|110635503|ref|YP_675711.1| MotA/TolQ/ExbB proton channel [Mesorhizobium sp. BNC1]
 gi|110286487|gb|ABG64546.1| Cell division and transport-associated protein TolQ [Chelativorans
           sp. BNC1]
          Length = 243

 Score =  189 bits (480), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 108/233 (46%), Positives = 156/233 (66%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAIM--DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M +  LA    D+SI+ALF Q G  VK ++  L   SI SW++II K ++F  +R     
Sbjct: 1   MESIELAAPGGDLSIWALFWQAGWVVKLVMIGLLGASIWSWAIIIDKWLSFARMRVALNR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + +SL +    G+ +IF++AM EWKKS +KGARSP+G+Q RID+ MD
Sbjct: 61  FEQVFWSGQSLEELYRSLSDRKTSGMGSIFVAAMREWKKSFEKGARSPLGLQTRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           +A+ RE+E +  KL FL S+ ++   +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 LALTREMERLESKLGFLASVGASAPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+   A +MEGFA+EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLTADAGNIASRMEGFADEFSAILSRQIDEKVA 233


>gi|332716446|ref|YP_004443912.1| biopolymer transport protein tolQ [Agrobacterium sp. H13-3]
 gi|325063131|gb|ADY66821.1| biopolymer transport protein tolQ [Agrobacterium sp. H13-3]
          Length = 239

 Score =  189 bits (479), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 117/232 (50%), Positives = 162/232 (69%), Gaps = 3/232 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M   GLA    D+S++ALFMQ GL VK ++  L   S+ +W+++  K V+F   +RQF +
Sbjct: 1   MEQAGLAAATHDVSLWALFMQAGLIVKFVMIGLIAASVWTWAIVFDKYVSFGKAKRQFDQ 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + ++L    N+GLAAIF+SAM EWKKS ++GARSPIG+Q RIDR MD
Sbjct: 61  FEQVFWSGQSLEELYRTLAERQNVGLAAIFVSAMREWKKSFERGARSPIGLQMRIDRAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           V IARE E+   +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I E
Sbjct: 121 VTIAREGEQYEARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 ALLATAIGLVAAIPAVIAYNKFTADAHKLSARMEGFADEFSAILSRQIDEKL 232


>gi|222086977|ref|YP_002545511.1| protein TolQ [Agrobacterium radiobacter K84]
 gi|221724425|gb|ACM27581.1| protein TolQ [Agrobacterium radiobacter K84]
          Length = 240

 Score =  188 bits (476), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 113/233 (48%), Positives = 160/233 (68%), Gaps = 4/233 (1%)

Query: 1   MNNYGLAIM---DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFR 57
           M    LA     DI++++LFMQ GL VK ++  L   S+ +W+++I K ++F   RRQF 
Sbjct: 1   MEQVALAAATTPDITLWSLFMQAGLVVKLVMLGLLAASVWTWAIVIDKYLSFARARRQFD 60

Query: 58  EFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMM 117
            FEQ+FWSGQSLE + ++L    N GL+AIF++AM EWKKS ++GARSPIG+Q RIDR M
Sbjct: 61  HFEQVFWSGQSLEELYRTLSERTNTGLSAIFVAAMREWKKSFERGARSPIGLQMRIDRAM 120

Query: 118 DVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-II 176
           DV +ARE E +  +L  L ++ SAG  +G+ G V+G+M  FQ+IAG  S N+  +   I 
Sbjct: 121 DVTLARESEHLGARLGSLATIGSAGPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIA 180

Query: 177 ESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           E+L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFSAILSRQ +  +
Sbjct: 181 EALLATAIGLVAAIPAVIAYNKFSADAGKLSARMEGFADEFSAILSRQIDEKL 233


>gi|298292997|ref|YP_003694936.1| protein TolQ [Starkeya novella DSM 506]
 gi|296929508|gb|ADH90317.1| protein TolQ [Starkeya novella DSM 506]
          Length = 280

 Score =  187 bits (475), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 97/223 (43%), Positives = 145/223 (65%), Gaps = 1/223 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
              D+S+  LF+Q  L VK ++  L + SI  W++II K++ F  ++RQ   FE  FWSG
Sbjct: 57  GSSDLSLIGLFLQAHLVVKIVMLGLVLASIWVWAIIIDKTILFQRMKRQMDRFESTFWSG 116

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           QSLE + +SL +  N  +AAIF++AM EWK+S + GARS  G+  R+D++MDV IARE+E
Sbjct: 117 QSLEELYRSLSSRPNHAMAAIFVAAMREWKRSYEGGARSLAGLTQRLDKVMDVTIAREVE 176

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +  +L  L ++ SAG  +G+ G V G+M  FQSIA   + ++  +   I E+L +  +G
Sbjct: 177 RLESRLLVLATVGSAGPFIGLFGTVWGIMTSFQSIAASKNTSLAVVAPGIAEALFATAIG 236

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP++I YNKF+    + A ++EGFA+EFSAILSRQ +  
Sbjct: 237 LIAAIPATIFYNKFVSQVNRQAARLEGFADEFSAILSRQIDER 279


>gi|227823311|ref|YP_002827283.1| putative TolQ protein uptake system component [Sinorhizobium fredii
           NGR234]
 gi|227342312|gb|ACP26530.1| putative TolQ protein uptake system component [Sinorhizobium fredii
           NGR234]
          Length = 239

 Score =  187 bits (474), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 108/231 (46%), Positives = 159/231 (68%), Gaps = 2/231 (0%)

Query: 1   MNNYGLAIM-DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M   GLA   D+++++LFMQ GL VK ++  L   S+ +W++++ KS+N+  +RRQ   F
Sbjct: 1   MEQVGLAATSDVTLWSLFMQAGLVVKLVMLGLIAASVWTWAIVVDKSLNYGRVRRQLDNF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           EQ+FWSGQSLE + ++L +    G+ AIF+SAM EWKKS ++GARSPIG+Q RIDR MDV
Sbjct: 61  EQVFWSGQSLEELYRTLSDRQTTGMGAIFVSAMREWKKSFERGARSPIGLQMRIDRAMDV 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
            +ARE E +  +L  L ++ S+   +G+ G V+G+M  FQ+IAG  S N+  +   I E+
Sbjct: 121 TLARESESLEARLGSLATIGSSAPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           L++  +GL  +IP+ IAYNKF  D+ K + +ME FA+EFSAILSRQ +  +
Sbjct: 181 LLATAIGLLAAIPAVIAYNKFTADAGKLSARMEAFADEFSAILSRQIDEKL 231


>gi|153008546|ref|YP_001369761.1| Tol-Pal system TolQ [Ochrobactrum anthropi ATCC 49188]
 gi|151560434|gb|ABS13932.1| Tol-Pal system TolQ [Ochrobactrum anthropi ATCC 49188]
          Length = 236

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 104/233 (44%), Positives = 154/233 (66%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA    D++++ LFMQ    VK ++  L   SI +W++I+ K++ +   RR    
Sbjct: 1   MENVALAAPAADVTLWGLFMQANWVVKLVMLGLLFASIWTWAIIVDKTIAYGRARRAIDR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ FWSGQSLE + ++L      G+A+IFM+AM EWKKS +KGARSPIG+Q RID+ MD
Sbjct: 61  FEQTFWSGQSLEELYRNLGERRTTGMASIFMAAMREWKKSFEKGARSPIGLQMRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           VA+ARE E++  +L FL ++ SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 VALARESEKLDSRLGFLATIGSAAPFIGLFGTVVGIMTSFQAIAASKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K   ++EGFA+EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSADAGKIGGRLEGFADEFSAILSRQIDEKLT 233


>gi|114765734|ref|ZP_01444832.1| proton transporter TolQ [Pelagibaca bermudensis HTCC2601]
 gi|114541951|gb|EAU44986.1| proton transporter TolQ [Roseovarius sp. HTCC2601]
          Length = 231

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 75/220 (34%), Positives = 121/220 (55%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  L VK ++ +L + S+  W++I++K V++   RR+  +F++ FWSG+ 
Sbjct: 12  IDFSMWGLFARATLTVKLVMLMLVLASVWGWAIIVEKIVSYRAARREAAKFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +          +F + M+EW++S         G   RIDR MDVAI +E E++
Sbjct: 72  LDELYDQIGPEPKGRAQRVFAAGMTEWRRSHRDDGGLIAGAHARIDRSMDVAIQKESEDL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    VG+ G V G+M  F  IA     ++V +   I E+L +  LGL 
Sbjct: 132 QRGLPVLATVGSTAPFVGLFGTVWGIMHAFIEIAAQQDTSLVVVAPGIAEALFATALGLV 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ I YNK   D+ +     E FA+EFS ILSRQ + 
Sbjct: 192 AAIPAVIFYNKLSADADRIISGYEAFADEFSTILSRQLDA 231


>gi|15966495|ref|NP_386848.1| putative transport transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|307300468|ref|ZP_07580248.1| protein TolQ [Sinorhizobium meliloti BL225C]
 gi|307318333|ref|ZP_07597768.1| protein TolQ [Sinorhizobium meliloti AK83]
 gi|15075766|emb|CAC47321.1| Putative transport transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|306896015|gb|EFN26766.1| protein TolQ [Sinorhizobium meliloti AK83]
 gi|306904634|gb|EFN35218.1| protein TolQ [Sinorhizobium meliloti BL225C]
          Length = 239

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 108/231 (46%), Positives = 158/231 (68%), Gaps = 2/231 (0%)

Query: 1   MNNYGLAIM-DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M   GLA   D+++++LFMQ GL VK ++  L   S+ +W++++ KS+N+  +RRQ   F
Sbjct: 1   MEQVGLAATSDVTLWSLFMQAGLVVKLVMLGLIAASVWTWAIVVDKSLNYGRVRRQLDNF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           EQ+FWSGQSLE + ++L +    G+ AIF+SAM EWKKS ++GAR+PIG+Q RIDR MDV
Sbjct: 61  EQVFWSGQSLEELYRTLSDRQTSGMGAIFVSAMREWKKSFERGARAPIGLQMRIDRAMDV 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
            +ARE E +  +L  L ++ SA   +G+ G V+G+M  FQ+IAG  S N+  +   I E+
Sbjct: 121 TLARESEALEARLGSLATIGSAAPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           L++  +GL  +IP+ IAYNKF  D+ K   +ME FA+EFSAILSRQ +  +
Sbjct: 181 LLATAIGLLAAIPAVIAYNKFTADAGKLTARMEAFADEFSAILSRQIDEKL 231


>gi|239832786|ref|ZP_04681115.1| protein TolQ [Ochrobactrum intermedium LMG 3301]
 gi|239825053|gb|EEQ96621.1| protein TolQ [Ochrobactrum intermedium LMG 3301]
          Length = 236

 Score =  186 bits (472), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 104/233 (44%), Positives = 154/233 (66%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA    D++++ LFMQ    VK ++  L   SI +W++I+ K++ +   RR    
Sbjct: 1   MENVALAAPAADVTLWGLFMQANWVVKLVMLGLLFASIWTWAIIVDKTIAYGRARRAIDR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ FWSGQSLE + ++L      G+A+IFM+AM EWKKS +KGARSPIG+Q RID+ MD
Sbjct: 61  FEQTFWSGQSLEELYRNLGERRTTGMASIFMAAMREWKKSFEKGARSPIGLQMRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           VA+ARE E++  +L FL ++ SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 VALAREGEKLESRLGFLATIGSAAPFIGLFGTVVGIMTSFQAIAASKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K   ++EGFA+EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSADAGKIGGRLEGFADEFSAILSRQIDEKLT 233


>gi|13473333|ref|NP_104900.1| TolQ protein, inner membrane protein, tolerance to group A colicins
           [Mesorhizobium loti MAFF303099]
 gi|14024082|dbj|BAB50686.1| inner membrane protein; TolQ [Mesorhizobium loti MAFF303099]
          Length = 236

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 102/233 (43%), Positives = 156/233 (66%), Gaps = 3/233 (1%)

Query: 1   MNNYGLA--IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA     +SI+ALFMQ    VK ++  L   S+ +W++II K V +  +R     
Sbjct: 1   MENIALADPGAQLSIWALFMQASWVVKLVMIGLLCASVWTWAIIIDKLVAYGRMRLALNR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + ++L +    G+ AIF++AM EWKKS +KGA++P+G+Q RID+ MD
Sbjct: 61  FEQVFWSGQSLEELYRTLADRKTSGMGAIFVAAMREWKKSFEKGAKTPLGLQTRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           +A+ RE+E++  +L FL +  SA   +G+ G V+G+M  FQ+IAG  + ++  +   I E
Sbjct: 121 LALTREMEKLEGRLGFLATTGSAAPFIGLFGTVIGIMTSFQAIAGSKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K A++MEGF++EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSSDASKLAVRMEGFSDEFSAILSRQIDEKVA 233


>gi|148560345|ref|YP_001259552.1| protein TolQ [Brucella ovis ATCC 25840]
 gi|148371602|gb|ABQ61581.1| protein TolQ [Brucella ovis ATCC 25840]
          Length = 236

 Score =  186 bits (471), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 102/233 (43%), Positives = 152/233 (65%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA    D++++ LFMQ    VK ++  L   SI +W++I+ K++ +   RR    
Sbjct: 1   MENVALAAPAADVTLWGLFMQANWVVKLVMLGLLFASIWTWAIIVDKTIAYGRARRAIDR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ FWSGQSLE + ++L      G+A+IFM+AM EWKKS +KGARSPIG+Q RID+ MD
Sbjct: 61  FEQSFWSGQSLEELYRNLSERRTSGMASIFMAAMREWKKSFEKGARSPIGLQMRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           VA+ARE  ++  +L FL ++ SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 VALARESGKLESRLGFLATIGSAAPFIGLFGTVVGIMTSFQAIAASKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K   ++EGFA+EFS ILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSADAGKIGGRLEGFADEFSTILSRQIDEKLT 233


>gi|254719703|ref|ZP_05181514.1| protein TolQ [Brucella sp. 83/13]
 gi|265984717|ref|ZP_06097452.1| TolQ protein [Brucella sp. 83/13]
 gi|306837838|ref|ZP_07470700.1| protein TolQ [Brucella sp. NF 2653]
 gi|306841419|ref|ZP_07474121.1| protein TolQ [Brucella sp. BO2]
 gi|306844692|ref|ZP_07477277.1| protein TolQ [Brucella sp. BO1]
 gi|264663309|gb|EEZ33570.1| TolQ protein [Brucella sp. 83/13]
 gi|306274864|gb|EFM56634.1| protein TolQ [Brucella sp. BO1]
 gi|306288525|gb|EFM59877.1| protein TolQ [Brucella sp. BO2]
 gi|306407077|gb|EFM63294.1| protein TolQ [Brucella sp. NF 2653]
          Length = 236

 Score =  185 bits (470), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 103/233 (44%), Positives = 153/233 (65%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA    D++++ LFMQ    VK ++  L   SI +W++I+ K++ +   RR    
Sbjct: 1   MENVALAAPAADVTLWGLFMQANWVVKLVMLGLLFASIWTWAIIVDKTIAYGRARRAIDR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ FWSGQSLE + ++L      G+A+IFM+AM EWKKS +KGARSPIG+Q RID+ MD
Sbjct: 61  FEQTFWSGQSLEELYRNLSERRTSGMASIFMAAMREWKKSFEKGARSPIGLQMRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           VA+ARE  ++  +L FL ++ SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 VALARESGKLESRLGFLATIGSAAPFIGLFGTVVGIMTSFQAIAASKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K   ++EGFA+EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSADAGKIGGRLEGFADEFSAILSRQIDEKLT 233


>gi|150397828|ref|YP_001328295.1| Tol-Pal system TolQ [Sinorhizobium medicae WSM419]
 gi|150029343|gb|ABR61460.1| Tol-Pal system TolQ [Sinorhizobium medicae WSM419]
          Length = 239

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 108/231 (46%), Positives = 159/231 (68%), Gaps = 2/231 (0%)

Query: 1   MNNYGLAIM-DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M   GLA   D+++++LFMQ GL VK ++  L   S+ +W++++ KS+N+  +RRQ   F
Sbjct: 1   MEQVGLAATSDVTLWSLFMQAGLVVKLVMLGLIAASVWTWAIVVDKSLNYGRVRRQLDSF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           EQ+FWSGQSLE + ++L +    G+ AIF+SAM EWKKS ++GAR+PIG+Q RIDR MDV
Sbjct: 61  EQVFWSGQSLEELYRTLSDRQTSGMGAIFVSAMREWKKSFERGARAPIGLQMRIDRAMDV 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
            +ARE E +  +L  L ++ SA   +G+ G V+G+M  FQ+IAG  S N+  +   I E+
Sbjct: 121 TLARESEALEARLGSLATIGSAAPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           L++  +GL  +IP+ IAYNKF  D+ K + +ME FA+EFSAILSRQ +  +
Sbjct: 181 LLATAIGLLAAIPAVIAYNKFTADAGKLSARMEAFADEFSAILSRQIDEKL 231


>gi|260467062|ref|ZP_05813242.1| protein TolQ [Mesorhizobium opportunistum WSM2075]
 gi|259029171|gb|EEW30467.1| protein TolQ [Mesorhizobium opportunistum WSM2075]
          Length = 236

 Score =  185 bits (470), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 101/233 (43%), Positives = 155/233 (66%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA     +SI+ALFMQ    VK ++  L   S+ +W++II K V +  +R     
Sbjct: 1   MENIALAEPGAQLSIWALFMQASWVVKLVMIGLLCASVWTWAIIIDKLVAYGRMRLALNR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + ++L +    G+ AIF++AM EWKKS +KGA++P+G+Q RID+ MD
Sbjct: 61  FEQVFWSGQSLEELYRTLADRKTSGMGAIFVAAMREWKKSFEKGAKTPLGLQTRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           +A+ RE+E++  +L FL +  SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 LALTREMEKLEGRLGFLATTGSAAPFIGLFGTVIGIMTSFQAIADSKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K A++MEGF++EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSSDASKIAVRMEGFSDEFSAILSRQIDEKVA 233


>gi|17986619|ref|NP_539253.1| TOLQ protein [Brucella melitensis bv. 1 str. 16M]
 gi|23502558|ref|NP_698685.1| tolQ protein [Brucella suis 1330]
 gi|62290572|ref|YP_222365.1| TolQ protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700488|ref|YP_415062.1| MotA/TolQ/ExbB proton channel [Brucella melitensis biovar Abortus
           2308]
 gi|161619629|ref|YP_001593516.1| protein TolQ [Brucella canis ATCC 23365]
 gi|163845279|ref|YP_001622934.1| protein TolQ [Brucella suis ATCC 23445]
 gi|189024790|ref|YP_001935558.1| MotA/TolQ/ExbB proton channel [Brucella abortus S19]
 gi|225628268|ref|ZP_03786302.1| protein TolQ [Brucella ceti str. Cudo]
 gi|225853155|ref|YP_002733388.1| protein TolQ [Brucella melitensis ATCC 23457]
 gi|237816077|ref|ZP_04595073.1| protein TolQ [Brucella abortus str. 2308 A]
 gi|254689868|ref|ZP_05153122.1| protein TolQ [Brucella abortus bv. 6 str. 870]
 gi|254694361|ref|ZP_05156189.1| protein TolQ [Brucella abortus bv. 3 str. Tulya]
 gi|254698019|ref|ZP_05159847.1| protein TolQ [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700361|ref|ZP_05162189.1| protein TolQ [Brucella suis bv. 5 str. 513]
 gi|254703478|ref|ZP_05165306.1| protein TolQ [Brucella suis bv. 3 str. 686]
 gi|254708432|ref|ZP_05170260.1| protein TolQ [Brucella pinnipedialis M163/99/10]
 gi|254708714|ref|ZP_05170525.1| protein TolQ [Brucella pinnipedialis B2/94]
 gi|254714561|ref|ZP_05176372.1| protein TolQ [Brucella ceti M644/93/1]
 gi|254717458|ref|ZP_05179269.1| protein TolQ [Brucella ceti M13/05/1]
 gi|254730903|ref|ZP_05189481.1| protein TolQ [Brucella abortus bv. 4 str. 292]
 gi|256030240|ref|ZP_05443854.1| protein TolQ [Brucella pinnipedialis M292/94/1]
 gi|256045310|ref|ZP_05448204.1| protein TolQ [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061737|ref|ZP_05451874.1| protein TolQ [Brucella neotomae 5K33]
 gi|256114268|ref|ZP_05455013.1| protein TolQ [Brucella melitensis bv. 3 str. Ether]
 gi|256160415|ref|ZP_05458104.1| protein TolQ [Brucella ceti M490/95/1]
 gi|256255621|ref|ZP_05461157.1| protein TolQ [Brucella ceti B1/94]
 gi|256258122|ref|ZP_05463658.1| protein TolQ [Brucella abortus bv. 9 str. C68]
 gi|256263353|ref|ZP_05465885.1| TolQ protein [Brucella melitensis bv. 2 str. 63/9]
 gi|256370109|ref|YP_003107620.1| biopolymer transport protein TolQ [Brucella microti CCM 4915]
 gi|260167915|ref|ZP_05754726.1| biopolymer transport protein TolQ [Brucella sp. F5/99]
 gi|260565799|ref|ZP_05836282.1| TolQ protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568785|ref|ZP_05839253.1| TolQ protein [Brucella suis bv. 4 str. 40]
 gi|260755399|ref|ZP_05867747.1| TolQ protein [Brucella abortus bv. 6 str. 870]
 gi|260758621|ref|ZP_05870969.1| TolQ protein [Brucella abortus bv. 4 str. 292]
 gi|260762453|ref|ZP_05874790.1| TolQ protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884415|ref|ZP_05896029.1| TolQ protein [Brucella abortus bv. 9 str. C68]
 gi|261214670|ref|ZP_05928951.1| TolQ protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219289|ref|ZP_05933570.1| TolQ protein [Brucella ceti M13/05/1]
 gi|261222824|ref|ZP_05937105.1| TolQ protein [Brucella ceti B1/94]
 gi|261315932|ref|ZP_05955129.1| biopolymer transporter TolQ [Brucella pinnipedialis M163/99/10]
 gi|261316205|ref|ZP_05955402.1| TolQ protein [Brucella pinnipedialis B2/94]
 gi|261322350|ref|ZP_05961547.1| TolQ protein [Brucella ceti M644/93/1]
 gi|261325741|ref|ZP_05964938.1| TolQ protein [Brucella neotomae 5K33]
 gi|261750855|ref|ZP_05994564.1| TolQ protein [Brucella suis bv. 5 str. 513]
 gi|261754108|ref|ZP_05997817.1| TolQ protein [Brucella suis bv. 3 str. 686]
 gi|261757353|ref|ZP_06001062.1| TolQ protein [Brucella sp. F5/99]
 gi|265987268|ref|ZP_06099825.1| TolQ protein [Brucella pinnipedialis M292/94/1]
 gi|265991735|ref|ZP_06104292.1| TolQ protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995572|ref|ZP_06108129.1| TolQ protein [Brucella melitensis bv. 3 str. Ether]
 gi|265998783|ref|ZP_06111340.1| TolQ protein [Brucella ceti M490/95/1]
 gi|294850951|ref|ZP_06791627.1| TolQ [Brucella sp. NVSL 07-0026]
 gi|297248971|ref|ZP_06932679.1| TolQ protein [Brucella abortus bv. 5 str. B3196]
 gi|13898973|gb|AAK48915.1|AF358662_2 TolQ protein [Brucella melitensis]
 gi|17982232|gb|AAL51517.1| tolq protein [Brucella melitensis bv. 1 str. 16M]
 gi|23348558|gb|AAN30600.1| tolQ protein [Brucella suis 1330]
 gi|62196704|gb|AAX75004.1| TolQ, tolQ protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616589|emb|CAJ11668.1| MotA/TolQ/ExbB proton channel [Brucella melitensis biovar Abortus
           2308]
 gi|161336440|gb|ABX62745.1| protein TolQ [Brucella canis ATCC 23365]
 gi|163676002|gb|ABY40112.1| protein TolQ [Brucella suis ATCC 23445]
 gi|189020362|gb|ACD73084.1| MotA/TolQ/ExbB proton channel [Brucella abortus S19]
 gi|225616114|gb|EEH13162.1| protein TolQ [Brucella ceti str. Cudo]
 gi|225641520|gb|ACO01434.1| protein TolQ [Brucella melitensis ATCC 23457]
 gi|237788740|gb|EEP62952.1| protein TolQ [Brucella abortus str. 2308 A]
 gi|256000272|gb|ACU48671.1| biopolymer transport protein TolQ [Brucella microti CCM 4915]
 gi|260151172|gb|EEW86267.1| TolQ protein [Brucella melitensis bv. 1 str. 16M]
 gi|260154169|gb|EEW89251.1| TolQ protein [Brucella suis bv. 4 str. 40]
 gi|260668939|gb|EEX55879.1| TolQ protein [Brucella abortus bv. 4 str. 292]
 gi|260672879|gb|EEX59700.1| TolQ protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675507|gb|EEX62328.1| TolQ protein [Brucella abortus bv. 6 str. 870]
 gi|260873943|gb|EEX81012.1| TolQ protein [Brucella abortus bv. 9 str. C68]
 gi|260916277|gb|EEX83138.1| TolQ protein [Brucella abortus bv. 3 str. Tulya]
 gi|260921408|gb|EEX88061.1| TolQ protein [Brucella ceti B1/94]
 gi|260924378|gb|EEX90946.1| TolQ protein [Brucella ceti M13/05/1]
 gi|261295040|gb|EEX98536.1| TolQ protein [Brucella ceti M644/93/1]
 gi|261295428|gb|EEX98924.1| TolQ protein [Brucella pinnipedialis B2/94]
 gi|261301721|gb|EEY05218.1| TolQ protein [Brucella neotomae 5K33]
 gi|261304958|gb|EEY08455.1| biopolymer transporter TolQ [Brucella pinnipedialis M163/99/10]
 gi|261737337|gb|EEY25333.1| TolQ protein [Brucella sp. F5/99]
 gi|261740608|gb|EEY28534.1| TolQ protein [Brucella suis bv. 5 str. 513]
 gi|261743861|gb|EEY31787.1| TolQ protein [Brucella suis bv. 3 str. 686]
 gi|262553472|gb|EEZ09241.1| TolQ protein [Brucella ceti M490/95/1]
 gi|262766856|gb|EEZ12474.1| TolQ protein [Brucella melitensis bv. 3 str. Ether]
 gi|263002691|gb|EEZ15094.1| TolQ protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093352|gb|EEZ17421.1| TolQ protein [Brucella melitensis bv. 2 str. 63/9]
 gi|264659465|gb|EEZ29726.1| TolQ protein [Brucella pinnipedialis M292/94/1]
 gi|294821594|gb|EFG38590.1| TolQ [Brucella sp. NVSL 07-0026]
 gi|297174104|gb|EFH33461.1| TolQ protein [Brucella abortus bv. 5 str. B3196]
 gi|326409713|gb|ADZ66778.1| MotA/TolQ/ExbB proton channel [Brucella melitensis M28]
 gi|326539420|gb|ADZ87635.1| protein TolQ [Brucella melitensis M5-90]
          Length = 236

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 103/233 (44%), Positives = 153/233 (65%), Gaps = 3/233 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA    D++++ LFMQ    VK ++  L   SI +W++I+ K++ +   RR    
Sbjct: 1   MENVALAAPAADVTLWGLFMQANWVVKLVMLGLLFASIWTWAIIVDKTIAYGRARRAIDR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ FWSGQSLE + ++L      G+A+IFM+AM EWKKS +KGARSPIG+Q RID+ MD
Sbjct: 61  FEQSFWSGQSLEELYRNLSERRTSGMASIFMAAMREWKKSFEKGARSPIGLQMRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           VA+ARE  ++  +L FL ++ SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 VALARESGKLESRLGFLATIGSAAPFIGLFGTVVGIMTSFQAIAASKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K   ++EGFA+EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSADAGKIGGRLEGFADEFSAILSRQIDEKLT 233


>gi|312115994|ref|YP_004013590.1| protein TolQ [Rhodomicrobium vannielii ATCC 17100]
 gi|311221123|gb|ADP72491.1| protein TolQ [Rhodomicrobium vannielii ATCC 17100]
          Length = 226

 Score =  185 bits (469), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 84/218 (38%), Positives = 136/218 (62%), Gaps = 1/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D S   LF+Q    VK ++  L + S+  WS++I+K++ F   ++Q  EFE++FWSGQSL
Sbjct: 6   DFSFLGLFLQAHPVVKFVMIGLILASVWCWSIVIEKTIAFRRAKKQTEEFERVFWSGQSL 65

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +  ++       +AA+F +AM EW++S D  A+   G+Q RI+R+M+V I RE+E + 
Sbjct: 66  DELYLAMPQKPTSAMAALFQAAMREWRRSIDGTAKPLPGVQMRIERVMEVTITREMERLE 125

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
            +L FL ++ +    +G+ G V G+M  FQ IA   + N+  +   I E+L +  LGL  
Sbjct: 126 ARLLFLATVGAVAPFIGLFGTVWGIMTAFQGIAASKNTNLAVVAPGIAEALFATALGLLA 185

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ I YN F + + + A ++EGFA+EFSAI+SRQ +
Sbjct: 186 AIPAVIFYNAFQQSASRLAQRLEGFADEFSAIVSRQLD 223


>gi|319781024|ref|YP_004140500.1| protein TolQ [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166912|gb|ADV10450.1| protein TolQ [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 236

 Score =  185 bits (468), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 98/233 (42%), Positives = 156/233 (66%), Gaps = 3/233 (1%)

Query: 1   MNNYGLA--IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA     +S+++LF+     VK ++  L   S+ +W++I+ K V++  +R     
Sbjct: 1   MENIALADPGAQLSVWSLFVSASWVVKLVMIGLLCASVWTWAIIVDKLVSYARMRLALNR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ+FWSGQSLE + ++L +    G+ AIF++AM EWKKS +KGA+SP+G+Q RID+ MD
Sbjct: 61  FEQVFWSGQSLEELYRTLADRKTTGMGAIFVAAMREWKKSFEKGAKSPLGLQTRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           +A+ RE+E++  +L FL +  SA   +G+ G V+G+M  FQ+IAG  + ++  +   I E
Sbjct: 121 LALTREMEKLEGRLGFLATTGSAAPFIGLFGTVIGIMTSFQAIAGSKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +L++  +GL  +IP+ IAYNK   D+ K A++MEGF++EFSAILSRQ +  ++
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSSDASKIAVRMEGFSDEFSAILSRQIDEKVA 233


>gi|163758793|ref|ZP_02165880.1| putative transport transmembrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162284083|gb|EDQ34367.1| putative transport transmembrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 238

 Score =  184 bits (467), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 106/232 (45%), Positives = 157/232 (67%), Gaps = 2/232 (0%)

Query: 1   MNNYGLAIM-DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M   GLA   ++++++LFMQ G  VK ++  L   SI +W+++  K V++   R Q  +F
Sbjct: 1   MEQVGLAATSEVTLWSLFMQAGFVVKLVMLGLVGASIWTWAIVADKWVSYRKFRGQLDQF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           EQ+FWSGQSLE + ++L +    G++AIF++AM EWKKS ++GA+SPIG+Q RID+ MDV
Sbjct: 61  EQIFWSGQSLEELYRTLSDRKTSGMSAIFVAAMREWKKSFERGAKSPIGLQMRIDKAMDV 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
            +ARE E +  KL  L S+ SA   +G+ G V+G+M  FQ+IAG  S N+  +   I E+
Sbjct: 121 TLAREAEHLESKLGSLASIGSAAPFIGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L++  +GL  +IP+ IAYNKF  D+ K + +MEGFA+EFS ILSRQ +  +S
Sbjct: 181 LLATAIGLLAAIPAVIAYNKFSSDAGKLSGRMEGFADEFSGILSRQIDERMS 232


>gi|158422145|ref|YP_001523437.1| TolQ protein precursor [Azorhizobium caulinodans ORS 571]
 gi|158329034|dbj|BAF86519.1| TolQ protein precursor [Azorhizobium caulinodans ORS 571]
          Length = 281

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 94/220 (42%), Positives = 144/220 (65%), Gaps = 1/220 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS+  LF+Q    VK ++  L   SI  W++II K++ F   R++   FEQ+FWSGQSL
Sbjct: 61  NISLIGLFLQAHFVVKLVMLGLVAASIWVWAIIIDKTLLFTRTRKEMDRFEQVFWSGQSL 120

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           E + +SL    N  +AAIF++AM EWK++ + GA+S  G+  RI+++MDV I+RE+E + 
Sbjct: 121 EELYRSLAGRPNQAMAAIFVAAMREWKRTYEGGAKSLTGLNQRIEKVMDVTISREVEALE 180

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
            KL  L ++ SAG  +G+ G V G+M  FQ+IA   + N+  +   I E+L +  +GL  
Sbjct: 181 SKLLVLATVGSAGPFIGLFGTVWGIMTSFQAIAASKNTNLAVVAPGIAEALFATAMGLIA 240

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP++I YNKF+  + + A ++EGFA+EFSAILSRQ +  
Sbjct: 241 AIPATIFYNKFVHQASRQAQRLEGFADEFSAILSRQIDER 280


>gi|260429238|ref|ZP_05783215.1| protein TolQ [Citreicella sp. SE45]
 gi|260419861|gb|EEX13114.1| protein TolQ [Citreicella sp. SE45]
          Length = 231

 Score =  183 bits (465), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 80/230 (34%), Positives = 126/230 (54%), Gaps = 4/230 (1%)

Query: 1   MNNYGLAI---MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFR 57
           M+   LA+   +D S++ LF +  L VK ++ +L + S+  W++I +K V++   RR+  
Sbjct: 1   MDPQTLAVAQEIDFSMWGLFARATLTVKLVMLMLVLSSVWGWAIIFEKIVSYRHARREAA 60

Query: 58  EFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMM 117
            F++ FWSG+ L+ +   +          +F + M+EW++S         G   RIDR M
Sbjct: 61  RFDRAFWSGEPLDELYDQIGADPKGRAQRVFAAGMTEWRRSHRDDGGLIAGAHARIDRSM 120

Query: 118 DVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-II 176
           DVAI +E EE+   L  L +++SA   VG+ G V G+M  F  IA     ++V +   I 
Sbjct: 121 DVAIQKESEELQRGLPVLATVASAAPFVGLFGTVWGIMHAFIEIANQQDTSLVVVAPGIA 180

Query: 177 ESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           E+L +  LGL  +IP+ I YNK   D+ +     E FA+EFS ILSRQ +
Sbjct: 181 EALFATALGLVAAIPAVIFYNKLSADANRVIAGYEAFADEFSTILSRQLD 230


>gi|294085863|ref|YP_003552623.1| Biopolymer transport protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665438|gb|ADE40539.1| Biopolymer transport protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 241

 Score =  183 bits (464), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 11/238 (4%)

Query: 1   MNNYGLAIM----DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQF 56
           MN+  L +     D+S + LF+     VK ++ LL + SI  W++II+K  +    RR  
Sbjct: 1   MNSADLTVTSSASDLSTWGLFLAADPLVKFVMLLLVLASIWCWAIIIEKISSVRRERRFA 60

Query: 57  REFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSP------IGIQ 110
           ++FE  FW+G SL+ +           ++ +F++AM EW+++  +G  S         + 
Sbjct: 61  QQFEDAFWAGGSLDQLYDDTGPDAEGSMSKVFVAAMREWRRASARGLASSTRSDLRASLV 120

Query: 111 DRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV 170
            RI+R M+  I RE+E +   ++FL S+ S    VG+ G V G+M  FQSIA   + ++ 
Sbjct: 121 SRIERSMNFTITREMERLERGMNFLASIGSVSPFVGLFGTVWGIMSSFQSIAESKNTSLA 180

Query: 171 SIPG-IIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +   I E+L +  LGL  +IP+  AYNKF  D ++ + ++E FA EFS +L RQ + 
Sbjct: 181 VVAPGIAEALFATALGLAAAIPAVTAYNKFAGDLERHSARLETFAQEFSTLLGRQLDE 238


>gi|296535989|ref|ZP_06898133.1| TolQ colicin import protein [Roseomonas cervicalis ATCC 49957]
 gi|296263675|gb|EFH10156.1| TolQ colicin import protein [Roseomonas cervicalis ATCC 49957]
          Length = 238

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 85/229 (37%), Positives = 129/229 (56%), Gaps = 3/229 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           N G    D+S++ LF+Q    VK ++  L + S+  W+V+ +K  +   + R    FE  
Sbjct: 9   NLGQVAHDLSLWGLFLQADWVVKSVMLGLLLASVWVWAVVFEKVTSLRRVNRAADAFEDR 68

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSP--IGIQDRIDRMMDVA 120
           FWSG SLET+           +AA+F +AM EW++S  + A      G+Q R +R M+VA
Sbjct: 69  FWSGGSLETLYSQEGERPTHPIAAVFGAAMREWERSSARPAEGAALAGMQQRAERAMNVA 128

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
           I RE++ +   + FL S+ S    +G+ G V G+M  F +IAG  + N+  +   I E+L
Sbjct: 129 ITREMDRLERWMVFLASVGSVAPFIGLFGTVWGIMNSFSAIAGMNNTNLAVVAPGIAEAL 188

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +  +GL  +IP+ +AYNK   D  +FA ++EGFA EF AILSRQ E  
Sbjct: 189 FATAIGLVAAIPAVLAYNKINTDLARFAARLEGFAAEFGAILSRQAEER 237


>gi|170741559|ref|YP_001770214.1| protein TolQ [Methylobacterium sp. 4-46]
 gi|168195833|gb|ACA17780.1| protein TolQ [Methylobacterium sp. 4-46]
          Length = 238

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 89/235 (37%), Positives = 140/235 (59%), Gaps = 5/235 (2%)

Query: 1   MNNY----GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQF 56
           MN       L + +I++F LF Q  + VK ++  L   S+  W++I+ K++ F   + + 
Sbjct: 1   MNPADAVQALPVHEITLFGLFWQAHVVVKVVMLGLLGASVWCWAIIVDKTLLFRRAKAEM 60

Query: 57  REFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRM 116
             FE+ FWSG+SLE + +S  +    GLAA+F++AM EWK+S +   RS   +  RID++
Sbjct: 61  DAFEESFWSGRSLEELYRSFHDKAPTGLAAVFVAAMREWKRSFEGSGRSIQSLSQRIDKV 120

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           +DV I RE+E    +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I
Sbjct: 121 LDVTIQREVERFESRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGI 180

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            E+L +  +GL  +IP+ +AYNK      K   ++EGFA+EFSAILSRQ +  ++
Sbjct: 181 AEALFATAIGLFAAIPAVLAYNKLQASVGKLQGRLEGFADEFSAILSRQIDERLA 235


>gi|197106550|ref|YP_002131927.1| MotA/TolQ/ExbB proton channel family protein [Phenylobacterium
           zucineum HLK1]
 gi|196479970|gb|ACG79498.1| MotA/TolQ/ExbB proton channel family protein [Phenylobacterium
           zucineum HLK1]
          Length = 404

 Score =  183 bits (463), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/233 (30%), Positives = 115/233 (49%), Gaps = 4/233 (1%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M+   +     +I  LF Q    VK ++  L + S+ SW++I+ K   F  L R+   FE
Sbjct: 172 MDPAAVTPESFNIVNLFFQADWVVKLVMIGLALASLWSWTIILDKLFRFAALNREATRFE 231

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIG---IQDRIDRMM 117
               SG+SLE V           L  +   A+ EW+ +  KG  +      +  RIDR +
Sbjct: 232 DQVASGRSLEDVAAEAGERPAHALPRMLQGALKEWRDARQKGPPTEAQVAFLIQRIDRHL 291

Query: 118 DVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-II 176
           D  IARE   +   L  L  +++A   +G+ G V G+M  FQ+IA   + ++  +   I 
Sbjct: 292 DAVIARESARVENGLGALAIVATASPFIGLFGTVWGIMNSFQAIAIQKNTSLAVVAPAIA 351

Query: 177 ESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           E+L +  +GL  +IP+ IA+N F   + K+A ++EGFA++ S  + R+     
Sbjct: 352 EALFATAIGLVAAIPAYIAFNAFSTSAGKYAARLEGFADDLSTAIQRRLAERA 404


>gi|90418973|ref|ZP_01226884.1| TolQ biopolymer transport protein, tolerance to group A tolicins
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90337053|gb|EAS50758.1| TolQ biopolymer transport protein, tolerance to group A tolicins
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 238

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 100/220 (45%), Positives = 147/220 (66%), Gaps = 1/220 (0%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S++ LF Q G  VK ++  L   S+ +W++II KS+ +   RRQ  +FE  FWSGQSLE 
Sbjct: 17  SLWDLFWQAGFIVKLVMIGLMAASVWTWAIIIDKSMRYGRFRRQLNKFESNFWSGQSLED 76

Query: 72  VCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEK 131
           +  +L      G+ A+F++AM EWKKS +KGARSP+G+Q RID+ MDV +ARE++E+  +
Sbjct: 77  LYHNLSERKTSGMGALFVAAMREWKKSFEKGARSPLGLQTRIDKAMDVTLAREMDELESR 136

Query: 132 LSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSI 190
           L FL ++ SA   VG+ G V+G+M  FQ+IAG    ++  +   I E+L++  +GL  +I
Sbjct: 137 LGFLATIGSAAPFVGLFGTVIGIMTSFQAIAGSQQTSLAVVAPGIAEALLATAIGLVAAI 196

Query: 191 PSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           P+ IAYNK   D+ K  M++E FA+EFSAILSRQ +  +S
Sbjct: 197 PAVIAYNKLSADAGKLGMRLESFADEFSAILSRQIDEKLS 236


>gi|114706801|ref|ZP_01439701.1| putative transport transmembrane protein [Fulvimarina pelagi
           HTCC2506]
 gi|114537749|gb|EAU40873.1| putative transport transmembrane protein [Fulvimarina pelagi
           HTCC2506]
          Length = 241

 Score =  182 bits (462), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 98/220 (44%), Positives = 148/220 (67%), Gaps = 1/220 (0%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S++ LF Q GL VK ++  L + S+ +W++II K + +  +RRQ   FE  FWSG+SLE 
Sbjct: 17  SMWDLFWQAGLIVKLVMIGLVVASVWTWAIIIDKVMRYAAMRRQLNNFENQFWSGRSLEE 76

Query: 72  VCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEK 131
           + ++L +    G+ A+F++AM EWKKS +KGARSPIG+Q RI++ MDV +ARE++ +  +
Sbjct: 77  LYQTLVDRKPTGMGAVFVAAMREWKKSFEKGARSPIGLQQRIEKAMDVTLAREMDHLESR 136

Query: 132 LSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSI 190
           L FL ++ SA   VG+ G V+G+M  FQ+IAG    ++  +   I E+L++  +GL  +I
Sbjct: 137 LGFLATIGSAAPFVGLFGTVIGIMTSFQAIAGSQQTSLAVVAPGIAEALLATAIGLVAAI 196

Query: 191 PSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           P+ IAYNK   D+ K  M+ME FA+EFS+ILSRQ +   S
Sbjct: 197 PAVIAYNKLTADAGKIGMRMESFADEFSSILSRQIDERQS 236


>gi|254780551|ref|YP_003064964.1| tolQ protein [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040228|gb|ACT57024.1| tolQ protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 230

 Score =  182 bits (461), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 230/230 (100%), Positives = 230/230 (100%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE
Sbjct: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
           QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA
Sbjct: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLI 180
           IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLI
Sbjct: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLI 180

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
Sbjct: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230


>gi|254487877|ref|ZP_05101082.1| protein TolQ [Roseobacter sp. GAI101]
 gi|214044746|gb|EEB85384.1| protein TolQ [Roseobacter sp. GAI101]
          Length = 231

 Score =  181 bits (460), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 77/219 (35%), Positives = 121/219 (55%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S+  LF++    VK ++  L + S  SWS+I+QK + +   + +   F+Q FWSG+ 
Sbjct: 12  IDFSLLGLFLRATFTVKLVMISLIVASFWSWSIIVQKILQYRRAKAEAERFDQAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +  S+          IF + M+EW++S  +      G   RIDR MDVAIA+E E++
Sbjct: 72  LDGLYDSIGPDPEGAADKIFAAGMTEWRRSHREDGGLIPGATARIDRSMDVAIAKESEKL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L  L +  S    VG+ G V G+M  F  IA   + ++V +   I E+L++  +GL 
Sbjct: 132 QKGLPVLATTGSTAPFVGLFGTVFGIMHSFIEIAAQQNTSLVVVAPGIAEALLATGIGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRILGGYEAFADEFATILSRQLD 230


>gi|163745822|ref|ZP_02153181.1| MotA/TolQ/ExbB proton channel [Oceanibulbus indolifex HEL-45]
 gi|161380567|gb|EDQ04977.1| MotA/TolQ/ExbB proton channel [Oceanibulbus indolifex HEL-45]
          Length = 231

 Score =  181 bits (460), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 75/219 (34%), Positives = 124/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  + VK ++ +L   S  SWS+I+QK++ +   R +  +F+Q FWSG+ 
Sbjct: 12  IDFSLWGLFAKATVTVKLVMIMLIGASFWSWSIIVQKTIQYRKARAEAAQFDQAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +  ++    +     IF + MSEW++S  +      G   RIDR MDVAI++E E +
Sbjct: 72  LDGLFDNIGADPDGSSEKIFAAGMSEWRRSHREDGALIPGATARIDRSMDVAISKEAERL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L  L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 132 QKGLPVLATVGSTAPFVGLFGTVFGIMNSFIEIAAQQNTNLAVVAPGIAEALLATGIGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YNK   DS +     E F++EF+ ILSRQ +
Sbjct: 192 AAIPAVVFYNKLSADSDRILGNYEAFSDEFATILSRQLD 230


>gi|310816580|ref|YP_003964544.1| MotA/TolQ/ExbB proton channel [Ketogulonicigenium vulgare Y25]
 gi|308755315|gb|ADO43244.1| MotA/TolQ/ExbB proton channel [Ketogulonicigenium vulgare Y25]
          Length = 216

 Score =  181 bits (459), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 70/216 (32%), Positives = 118/216 (54%), Gaps = 1/216 (0%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
           ++ALF +  L VK ++ LL + S+  W++++ K + +   + +  +F++ FWSG+ L+ +
Sbjct: 1   MWALFARATLIVKIVMILLVLASVWCWAIVVDKYIQYRRAKAEAEQFDRAFWSGEPLDLL 60

Query: 73  CKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKL 132
            + +  + +     +F + M EW++S         G   RI+R MDV I +E E + + L
Sbjct: 61  YQQIGPNPDGASQRVFAAGMGEWRRSHRTDGALIPGALSRIERAMDVVIGKESERLQKGL 120

Query: 133 SFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIP 191
             L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L +  LGL  +IP
Sbjct: 121 PVLATVGSVAPFVGLFGTVWGIMNAFVEIAAQQNTNLAVVAPGIAEALFATGLGLVAAIP 180

Query: 192 SSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           + I YNKF  D+ +     E FA+EFS ILSRQ + 
Sbjct: 181 AVIFYNKFNTDADRITASHEVFADEFSTILSRQLDA 216


>gi|328542541|ref|YP_004302650.1| Protein transporter [polymorphum gilvum SL003B-26A1]
 gi|326412287|gb|ADZ69350.1| Protein transporter protein [Polymorphum gilvum SL003B-26A1]
          Length = 235

 Score =  181 bits (459), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 98/221 (44%), Positives = 138/221 (62%), Gaps = 1/221 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S FALF+Q  + VK ++  L   S+  W++I  K V F   +RQ   FE +FWSGQSL
Sbjct: 15  DLSFFALFLQAHIVVKLVMIGLIGASVWCWAIIFDKVVLFARTKRQMTRFETVFWSGQSL 74

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           E + K+L N  N  +AA+F++AM EWK+S +    +   +Q RIDR+MDV I RE+E + 
Sbjct: 75  EELYKTLSNRANHSMAALFVAAMREWKRSHEGARPALASLQQRIDRVMDVTIQREIERLE 134

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
            +L  L ++ SA   +G+ G V G+M  FQ+IA   S N+  +   I E+L +  LGL  
Sbjct: 135 ARLLILATVGSAAPFIGLFGTVWGIMTSFQAIAASESTNLAVVAPGIAEALFATALGLLA 194

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +IP+ IAYNK   D  K + +MEGFA+EFSAILSRQ +  I
Sbjct: 195 AIPAVIAYNKLSTDVGKLSARMEGFADEFSAILSRQIDERI 235


>gi|220924304|ref|YP_002499606.1| protein TolQ [Methylobacterium nodulans ORS 2060]
 gi|219948911|gb|ACL59303.1| protein TolQ [Methylobacterium nodulans ORS 2060]
          Length = 238

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 89/235 (37%), Positives = 139/235 (59%), Gaps = 5/235 (2%)

Query: 1   MNNY----GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQF 56
           MN       L + +I++F LF Q    VK ++  L   S+  W++I+ K++ F   R + 
Sbjct: 1   MNPADAVQALPVHEITLFGLFWQAHFVVKVVMLGLLGASVWCWAIIVDKTLLFRRTRAEM 60

Query: 57  REFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRM 116
             FE+ FWSG+SLE + +S  +    GL A+F++AM EWK+S +   RS   +  RID++
Sbjct: 61  DAFEESFWSGRSLEELYRSFNDKAPTGLGAVFVAAMREWKRSFEGSGRSIHSLGQRIDKV 120

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           +DV I RE+E +  +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I
Sbjct: 121 LDVTIQREVERLESRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGI 180

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            E+L +  +GL  +IP+ +AYNK      K   ++EGFA+EFSAILSRQ +  ++
Sbjct: 181 AEALFATAIGLFAAIPAVLAYNKLQASVAKAQGRLEGFADEFSAILSRQIDERLA 235


>gi|148258092|ref|YP_001242677.1| TolQ protein [Bradyrhizobium sp. BTAi1]
 gi|146410265|gb|ABQ38771.1| Cell division and transport-associated protein TolQ [Bradyrhizobium
           sp. BTAi1]
          Length = 237

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 93/236 (39%), Positives = 141/236 (59%), Gaps = 8/236 (3%)

Query: 1   MNNYGLAIM-------DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLR 53
           MN   +A         D+S+ ALF Q    VK ++  L   S+  W++ I K   +   R
Sbjct: 1   MNPADVAPAALPVVSGDVSLIALFWQAHWVVKGVMLGLITCSVWVWAIAIDKLFLYSRTR 60

Query: 54  RQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRI 113
           R    FEQ FWSG+S+E + ++L       +AA F++AM EWK+S +  ARS  G+Q RI
Sbjct: 61  RSMDRFEQAFWSGESIEELYRALSAKPTQSMAACFVAAMREWKRSFEGHARSFAGLQMRI 120

Query: 114 DRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIP 173
           +++M+V+IARE+E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  + 
Sbjct: 121 EKVMNVSIAREVERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVA 180

Query: 174 G-IIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             I E+L +  +GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +  
Sbjct: 181 PGIAEALFATAIGLIAAIPATIFYNKFTSEVNRQAQRLEGFADEFSAILSRQIDER 236


>gi|86748932|ref|YP_485428.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris HaA2]
 gi|86571960|gb|ABD06517.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris HaA2]
          Length = 237

 Score =  181 bits (458), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 86/225 (38%), Positives = 137/225 (60%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S+  LF Q    VK ++  L   S+  W++ I K + +   +R    FEQ FWS
Sbjct: 13  LVSADMSLIGLFWQAHWIVKSVMLGLIGCSVWVWAIAIDKLILYSRTKRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S++ + ++L       +AA F++AM EWK+S +  +RS  G+Q RI+++M+V+IARE+
Sbjct: 73  GESIDDLYRTLSAKPTHSMAACFVAAMREWKRSFESHSRSFAGLQMRIEKVMNVSIAREV 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAI 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  +   ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFTSEVNRQTQRLEGFADEFSAILSRQIDERA 237


>gi|316932661|ref|YP_004107643.1| protein TolQ [Rhodopseudomonas palustris DX-1]
 gi|315600375|gb|ADU42910.1| protein TolQ [Rhodopseudomonas palustris DX-1]
          Length = 236

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 87/222 (39%), Positives = 136/222 (61%), Gaps = 1/222 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S+ +LF      VK I+  L   S+  W++ I K + F   RR    FEQ FWSG+
Sbjct: 14  STDVSLLSLFWHAHWVVKSIMLGLLGCSVWVWAIAIDKLLLFSRTRRAMDRFEQAFWSGE 73

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           S++ + ++L       +AA F++AM EWK+S +  +RS  G+Q RI+++M+V+IARE+E 
Sbjct: 74  SIDELYRALSAKPTHSMAACFVAAMREWKRSFESHSRSFAGLQMRIEKVMNVSIAREVER 133

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +GL
Sbjct: 134 LERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAIGL 193

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP++I YNKF  +  +   ++EGFA+EFSAILSRQ +  
Sbjct: 194 IAAIPATIFYNKFTSEVNRQTQRLEGFADEFSAILSRQIDER 235


>gi|39934192|ref|NP_946468.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris CGA009]
 gi|192289718|ref|YP_001990323.1| protein TolQ [Rhodopseudomonas palustris TIE-1]
 gi|39648040|emb|CAE26560.1| TolQ protein, inner membrane protein, tolerance to group A colicins
           [Rhodopseudomonas palustris CGA009]
 gi|192283467|gb|ACE99847.1| protein TolQ [Rhodopseudomonas palustris TIE-1]
          Length = 236

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 86/222 (38%), Positives = 136/222 (61%), Gaps = 1/222 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S+ +LF      VK I+  L   S+  W++ I K + F   +R    FEQ FWSG+
Sbjct: 14  STDVSLLSLFWHAHWVVKSIMLGLLGCSVWVWAIAIDKLLLFSRTKRAMDRFEQAFWSGE 73

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           S++ + ++L       +AA F++AM EWK+S +  +RS  G+Q RI+++M+V+IARE+E 
Sbjct: 74  SIDELYRALSAKPTHSMAACFVAAMREWKRSFESHSRSFAGLQMRIEKVMNVSIAREVER 133

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +GL
Sbjct: 134 LERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAIGL 193

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP++I YNKF  +  +   ++EGFA+EFSAILSRQ +  
Sbjct: 194 IAAIPATIFYNKFTSEVNRQTQRLEGFADEFSAILSRQIDER 235


>gi|58040116|ref|YP_192080.1| MotA/TolQ/ExbB proton channel family protein [Gluconobacter oxydans
           621H]
 gi|58002530|gb|AAW61424.1| MotA/TolQ/ExbB proton channel family protein [Gluconobacter oxydans
           621H]
          Length = 247

 Score =  180 bits (457), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 79/227 (34%), Positives = 126/227 (55%), Gaps = 3/227 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +    +S   LF+   + VK ++  L + S   W++I +K +    + R+  EFE  FWS
Sbjct: 13  VGATGLSPLDLFLHASIVVKLVMLGLLLCSAGVWAIIAEKIILIRRVNREATEFEDRFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIAR 123
           G SL+ + +S        +AA+F +AM EW++S   G       G+++R+DR +D+ I R
Sbjct: 73  GGSLDDLYESDGARPTHPMAAVFGAAMGEWRRSARIGGIDLSRGGVRERVDRAIDITIMR 132

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISI 182
           E + +T +L FL ++      VG+ G V G+M  F SIA  ++ N+  +   I E+L + 
Sbjct: 133 ENDRLTRRLIFLATIGPVAPFVGLFGTVWGIMHSFASIAQMHNTNLSVVAPGISEALFAT 192

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            +GL  +IP+ IAYN      +KFA +ME F  EF+AILSRQ+E   
Sbjct: 193 AIGLVTAIPAYIAYNGLSNSFEKFADRMEAFGTEFAAILSRQSEERA 239


>gi|254502321|ref|ZP_05114472.1| protein TolQ [Labrenzia alexandrii DFL-11]
 gi|222438392|gb|EEE45071.1| protein TolQ [Labrenzia alexandrii DFL-11]
          Length = 235

 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 92/221 (41%), Positives = 136/221 (61%), Gaps = 1/221 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S +ALF Q  + V+ ++  L   S+  W++I+ K + F   +RQ   FE +FWSGQSL
Sbjct: 15  DLSFYALFWQAHIVVQVVMLGLLAASVWCWAIIVDKIMIFGKTKRQMNRFETVFWSGQSL 74

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           E +  +L N  N  +AA+F++AM EWK+S +    +   +Q RIDR+MDV I RE E + 
Sbjct: 75  EELYGTLHNRVNHSMAALFVAAMREWKRSHEGARPAIGSLQQRIDRVMDVTIQREQERLE 134

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
            +L  L ++ S+   +G+ G V G+M  FQ+IA   S N+  +   I E+L +  LGL  
Sbjct: 135 NRLLILATVGSSAPFIGLFGTVWGIMTAFQAIAASESTNLAVVAPGIAEALFATALGLLA 194

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +IP+ IAYNKF  D  +   +MEGFA+EFSAILSRQ +  +
Sbjct: 195 AIPAVIAYNKFSSDVGRAVARMEGFADEFSAILSRQIDERV 235


>gi|329113833|ref|ZP_08242604.1| Protein TolQ [Acetobacter pomorum DM001]
 gi|326696843|gb|EGE48513.1| Protein TolQ [Acetobacter pomorum DM001]
          Length = 246

 Score =  180 bits (455), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/225 (34%), Positives = 127/225 (56%), Gaps = 3/225 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+S++ALFM   L VK ++  L I S++ W++I+ K V    + R+   FE  FWSG
Sbjct: 21  AAGDLSVWALFMHASLVVKIVMLGLLICSVMVWAIILDKFVTLRRINREATGFEDRFWSG 80

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARE 124
            SL+ + +S        ++A+F +AM EW++S           G+++R+DR + + I RE
Sbjct: 81  GSLDDLYESDGAKPTNPMSAVFGAAMGEWRRSARIPGVDLVRGGVKERVDRAIGITITRE 140

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
           ++ +   + FL +++     VG+ G V G+M  F SIA  ++ N+  +   I E+L +  
Sbjct: 141 MDRLRRWVIFLATVAPVAPFVGLFGTVWGIMHSFSSIAAEHNTNLSVVAPGISEALFATA 200

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +GL  +IP+ +AYN        F  ++EGF  EF+AILSRQ+E  
Sbjct: 201 IGLLTAIPAYVAYNVISNSMDLFQDRLEGFGTEFAAILSRQSEER 245


>gi|154246988|ref|YP_001417946.1| Tol-Pal system TolQ [Xanthobacter autotrophicus Py2]
 gi|154161073|gb|ABS68289.1| Tol-Pal system TolQ [Xanthobacter autotrophicus Py2]
          Length = 274

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 95/227 (41%), Positives = 142/227 (62%), Gaps = 1/227 (0%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
                  DIS   LF+Q    VK ++  L   SI  W++II K + F   +R+   FEQ+
Sbjct: 47  PLAAPSADISFLGLFLQAHFVVKLVMIGLITSSIWVWAIIIDKWMLFSRNKREMDRFEQV 106

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
           FWSGQSLE + ++L    N G+AAIF++AM EWK++ +  ARS  G+  R+D++M+V IA
Sbjct: 107 FWSGQSLEDLYRTLAGRSNQGMAAIFVAAMREWKRTYEGSARSFAGLNQRLDKVMNVTIA 166

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
           RE+E +  +L  L ++ SAG  +G+ G V G+M  FQSIA   + ++  +   I E+L +
Sbjct: 167 REVERLESRLLVLATVGSAGPFIGLFGTVWGIMTSFQSIAASKNTSLAVVAPGIAEALFA 226

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +GL  +IP++I YNKFI  + + A ++EGFA+EFSAILSRQ +  
Sbjct: 227 TAMGLIAAIPATIFYNKFISQTGRQAQRLEGFADEFSAILSRQIDER 273


>gi|83943915|ref|ZP_00956372.1| proton transporter TolQ [Sulfitobacter sp. EE-36]
 gi|83954488|ref|ZP_00963199.1| proton transporter TolQ [Sulfitobacter sp. NAS-14.1]
 gi|83840772|gb|EAP79943.1| proton transporter TolQ [Sulfitobacter sp. NAS-14.1]
 gi|83845162|gb|EAP83042.1| proton transporter TolQ [Sulfitobacter sp. EE-36]
          Length = 231

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 76/219 (34%), Positives = 123/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S+  LF++  + VK ++ +L + S  SWS+IIQK + +   + +   F+Q FWSG+ 
Sbjct: 12  IDFSLLGLFLRATITVKLVMIMLIVASFWSWSIIIQKMIQYRHAKAEAERFDQAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +  ++    +     IF + M+EW++S  +      G   RIDR MDVAIA+E E +
Sbjct: 72  LDGLYDTIGPDPDGAAEKIFAAGMTEWRRSHREDGGLIPGATARIDRSMDVAIAKEAERL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L  L +  S    +G+ G V G+M  F  IA   + ++V +   I E+L++  +GL 
Sbjct: 132 QKGLPVLATTGSTAPFIGLFGTVFGIMNSFIEIAAQQNTSLVVVAPGIAEALLATGIGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRILGGYEAFADEFATILSRQLD 230


>gi|258543666|ref|YP_003189099.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-01]
 gi|256634744|dbj|BAI00720.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-01]
 gi|256637800|dbj|BAI03769.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-03]
 gi|256640854|dbj|BAI06816.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-07]
 gi|256643909|dbj|BAI09864.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-22]
 gi|256646964|dbj|BAI12912.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-26]
 gi|256650017|dbj|BAI15958.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-32]
 gi|256653007|dbj|BAI18941.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656061|dbj|BAI21988.1| ExbB/TolQ/MotA [Acetobacter pasteurianus IFO 3283-12]
          Length = 246

 Score =  179 bits (454), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 77/225 (34%), Positives = 127/225 (56%), Gaps = 3/225 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+S++ALFM   L VK ++  L I S++ W++I+ K V    + R+   FE  FWSG
Sbjct: 21  AAGDLSVWALFMHASLVVKIVMLGLLICSVMVWAIILDKFVTLRRINREATGFEDRFWSG 80

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARE 124
            SL+ + +S        ++A+F +AM EW++S           G+++R+DR + + I RE
Sbjct: 81  GSLDDLYESDGAKPTNPMSAVFGAAMGEWRRSARIPGVDLVRGGVKERVDRAIGITITRE 140

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
           ++ +   + FL +++     VG+ G V G+M  F SIA  ++ N+  +   I E+L +  
Sbjct: 141 MDRLRRWVIFLATVAPVAPFVGLFGTVWGIMHSFSSIAAEHNTNLSVVAPGISEALFATA 200

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +GL  +IP+ +AYN        F  ++EGF  EF+AILSRQ+E  
Sbjct: 201 IGLLTAIPAYVAYNVISNSMDLFQDRLEGFGTEFAAILSRQSEER 245


>gi|27382266|ref|NP_773795.1| tolQ protein [Bradyrhizobium japonicum USDA 110]
 gi|27355437|dbj|BAC52420.1| tolQ Protein [Bradyrhizobium japonicum USDA 110]
          Length = 238

 Score =  178 bits (452), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 93/223 (41%), Positives = 139/223 (62%), Gaps = 1/223 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+S+ ALF Q    VK ++  L   S+  W++ I K   F   RR    FEQ+FWSG
Sbjct: 15  ASADVSLIALFWQAHWIVKAVMLGLLSCSVWVWAIAIDKIFLFARTRRSMDRFEQVFWSG 74

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           +S+E + ++L       +AA F++AM EWK+S +  ARS  G+Q RID++M+V+IARE+E
Sbjct: 75  ESIEELYRTLSAKPTHSMAACFVAAMREWKRSFESHARSVAGLQMRIDKVMNVSIAREVE 134

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +G
Sbjct: 135 RLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAVG 194

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +  
Sbjct: 195 LIAAIPATIFYNKFTSEVNRQAQRLEGFADEFSAILSRQIDER 237


>gi|91978611|ref|YP_571270.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisB5]
 gi|91685067|gb|ABE41369.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisB5]
          Length = 227

 Score =  178 bits (451), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 87/225 (38%), Positives = 138/225 (61%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S+ ALF Q    VK ++  L   S+  W++ I K + +   +R    FEQ FWS
Sbjct: 3   LVSADVSLIALFWQAHWIVKSVMLGLIGCSVWVWAIAIDKLLLYSRTKRAMDRFEQAFWS 62

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S++ + ++L       +AA F++AM EWK+S +  +RS  G+Q RI+++M+V+IARE+
Sbjct: 63  GESIDDLYRTLSAKPTHSMAACFVAAMREWKRSFESQSRSFAGLQMRIEKVMNVSIAREV 122

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 123 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAV 182

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  +   ++EGFA+EFSAILSRQ +   
Sbjct: 183 GLIAAIPATIFYNKFTSEVNRQTQRLEGFADEFSAILSRQIDERA 227


>gi|115526698|ref|YP_783609.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisA53]
 gi|115520645|gb|ABJ08629.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisA53]
          Length = 227

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 91/224 (40%), Positives = 139/224 (62%), Gaps = 1/224 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S+ ALF Q    VK ++  L   S+  W++ I K + +   +R    FEQ FWS
Sbjct: 3   LVSTDVSLIALFWQAHWVVKAVMLGLLACSVWVWAIAIDKILLYSRTKRAMDRFEQAFWS 62

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S++ + ++L       +AA F++AM EWK+S D  ARS  G+Q RID++M+V+IARE+
Sbjct: 63  GESIDELYRALAAKPTQSMAACFVAAMREWKRSFDSQARSVAGLQMRIDKVMNVSIAREI 122

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 123 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAI 182

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +  
Sbjct: 183 GLIAAIPATIFYNKFTSEVNRQAQRLEGFADEFSAILSRQIDER 226


>gi|260547184|ref|ZP_05822922.1| TolQ protein [Brucella abortus NCTC 8038]
 gi|260095549|gb|EEW79427.1| TolQ protein [Brucella abortus NCTC 8038]
          Length = 228

 Score =  178 bits (451), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 103/228 (45%), Positives = 150/228 (65%), Gaps = 3/228 (1%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M N  LA    D++++ LFMQ    VK ++  L   SI +W++I+ K++ +   RR    
Sbjct: 1   MENVALAAPAADVTLWGLFMQANWVVKLVMLGLLFASIWTWAIIVDKTIAYGRARRAIDR 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FEQ FWSGQSLE + ++L      G+A+IFM+AM EWKKS +KGARSPIG+Q RID+ MD
Sbjct: 61  FEQSFWSGQSLEELYRNLSERRTSGMASIFMAAMREWKKSFEKGARSPIGLQMRIDKAMD 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIE 177
           VA+ARE  ++  +L FL ++ SA   +G+ G V+G+M  FQ+IA   + ++  +   I E
Sbjct: 121 VALARESGKLESRLGFLATIGSAAPFIGLFGTVVGIMTSFQAIAASKNTSLAVVAPGIAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +L++  +GL  +IP+ IAYNK   D+ K   ++EGFA+EFSAILSRQ 
Sbjct: 181 ALLATAIGLLAAIPAVIAYNKLSADAGKIGGRLEGFADEFSAILSRQI 228


>gi|254473148|ref|ZP_05086546.1| protein TolQ [Pseudovibrio sp. JE062]
 gi|211957869|gb|EEA93071.1| protein TolQ [Pseudovibrio sp. JE062]
          Length = 261

 Score =  178 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 96/220 (43%), Positives = 140/220 (63%), Gaps = 1/220 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S  +LFM+  + VK ++  L   S+ SW++I  K V +   RRQ   FE +FWSGQSLE
Sbjct: 42  LSYISLFMEADIVVKIVMIGLIAASVWSWAIIFDKVVLYGRSRRQMNRFENVFWSGQSLE 101

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            + KSL +  N G++A+F++AM EWK+S +    +   +Q RIDR+MD+ I+RE+E + +
Sbjct: 102 ELYKSLSSRANNGMSALFVAAMREWKRSHEGDKPAIASLQQRIDRVMDLTISREVERLEK 161

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L FL ++ SA   VG+ G V G+M  F SIA   + N+  +   I E+L +  LGL  +
Sbjct: 162 RLLFLATIGSAAPFVGLFGTVWGIMNAFTSIAASKNTNLAVVAPGIAEALFATGLGLIAA 221

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           IP+ IAYNK   DS K A +MEGFA+EFSAILSR+ +   
Sbjct: 222 IPAVIAYNKLQSDSGKLAARMEGFADEFSAILSRRIDERA 261


>gi|90426225|ref|YP_534595.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisB18]
 gi|90108239|gb|ABD90276.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisB18]
          Length = 237

 Score =  178 bits (450), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 90/225 (40%), Positives = 141/225 (62%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           LA  D+S+ ALF+Q    VK ++  L   S+  W++ I K + +   +R    FEQ FWS
Sbjct: 13  LASSDVSLIALFLQAHWVVKAVMLGLLGCSVWVWAIAIDKMLLYSRTKRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S++ + ++L       +AA F++AM EWK+S +  ARS  G+Q RI+++M+V+IARE+
Sbjct: 73  GESIDELYRALSAKPTQSMAACFVAAMREWKRSFESQARSFAGLQMRIEKVMNVSIAREV 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAI 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFASEVNRQAQRLEGFADEFSAILSRQIDERA 237


>gi|75676904|ref|YP_319325.1| MotA/TolQ/ExbB proton channel [Nitrobacter winogradskyi Nb-255]
 gi|74421774|gb|ABA05973.1| Cell division and transport-associated protein TolQ [Nitrobacter
           winogradskyi Nb-255]
          Length = 237

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 89/225 (39%), Positives = 138/225 (61%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           LA  D+S+  LF      VK ++  L   S+  W++ I K+  +   +R    FEQ FWS
Sbjct: 13  LASADVSLITLFFHAHWIVKAVMLGLLACSVWVWAIAIDKTFLYARTKRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S+E + ++L       +AA F++AM EWK+S +  ARS  G+Q RI+++M+V+IARE+
Sbjct: 73  GESIEDLYRALSAKPTQSMAACFVAAMREWKRSFESQARSIAGLQMRIEKVMNVSIAREV 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAI 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFTAEVNRQAQRLEGFADEFSAILSRQIDERA 237


>gi|254465478|ref|ZP_05078889.1| protein TolQ [Rhodobacterales bacterium Y4I]
 gi|206686386|gb|EDZ46868.1| protein TolQ [Rhodobacterales bacterium Y4I]
          Length = 231

 Score =  177 bits (449), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 82/219 (37%), Positives = 123/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  + VK ++ +L   SI SW +IIQK +N+   R++   F++ FWSG  
Sbjct: 12  IDFSMWGLFARATVTVKLVMLMLVGASIWSWGIIIQKMINYRKARQEADAFDRAFWSGNP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+T+   +        A IF + M+EW++S         G Q RIDR MDVAIA+E E +
Sbjct: 72  LDTLFDQIGAEPPGQAARIFSAGMTEWRRSHRSDGGLIPGAQARIDRSMDVAIAKETEGL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLSVLATVGSTAPFVGLFGTVWGIMTAFIEIAEQQNTNLAVVAPGIAEALMATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVVFYNKLSADSDRIIGGYEAFADEFATILSRQLD 230


>gi|83592427|ref|YP_426179.1| MotA/TolQ/ExbB proton channel [Rhodospirillum rubrum ATCC 11170]
 gi|83575341|gb|ABC21892.1| MotA/TolQ/ExbB proton channel [Rhodospirillum rubrum ATCC 11170]
          Length = 308

 Score =  177 bits (449), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 74/222 (33%), Positives = 121/222 (54%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S +++F Q  + VK ++  L   SI SW+++ +K V    L ++  +FE+ FWSG SLE
Sbjct: 86  LSAWSMFWQADIIVKMVMLSLVGASIWSWTIVFEKIVRLRDLNKKAEQFEEKFWSGGSLE 145

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIG---IQDRIDRMMDVAIARELEE 127
            +   +       + A+F++AM EW+ S  +   +      +  R++R+M +   RELE 
Sbjct: 146 DLFDRIGQRPRDPMTAVFVAAMREWRHSAQRRNGAAGARAMLAQRVERVMGITQNRELET 205

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +  +L FL S  +    VG+ G V G+M  F +I      ++    PGI E+L +  LGL
Sbjct: 206 LERRLGFLASTGAVAPFVGLFGTVWGIMNSFHAIGMSNDTSLATVAPGIAEALFATALGL 265

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ IAYNK   D  ++A ++E F+ EF AIL RQ +  
Sbjct: 266 VAAIPAVIAYNKLSADIDRYAGRLEAFSGEFGAILGRQLDER 307


>gi|46201287|ref|ZP_00055338.2| COG0811: Biopolymer transport proteins [Magnetospirillum
           magnetotacticum MS-1]
          Length = 226

 Score =  177 bits (449), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 82/226 (36%), Positives = 128/226 (56%), Gaps = 5/226 (2%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+S++ALF++  + VK ++  L   S   W++I  K +    L  +  +FE+ FWSG S
Sbjct: 1   MDLSMWALFLRADIIVKFVMIALLCASFWCWAIIFDKIMKVRQLTTRADQFEEAFWSGGS 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPI----GIQDRIDRMMDVAIARE 124
           LE +   + +     +++IF++AM EW++S  KG          +  RIDR+M V + RE
Sbjct: 61  LEELYDRIGSRPLDPMSSIFVAAMREWRRSAAKGLADRDSTRASLPQRIDRVMSVTLGRE 120

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
           +E +  +L FL S  S    +G+ G V G+M  FQSIA   + ++  +   I E+L +  
Sbjct: 121 MELLERRLGFLASTGSTAPFIGLFGTVWGIMNSFQSIAATKNTSLAVVAPGIAEALFATA 180

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           LGL  +IP+ IAYNK   D  +++ ++E FA EF AILSRQ E   
Sbjct: 181 LGLVAAIPAVIAYNKISNDLDRYSKRLENFAGEFGAILSRQLEEKA 226


>gi|209886405|ref|YP_002290262.1| protein TolQ [Oligotropha carboxidovorans OM5]
 gi|209874601|gb|ACI94397.1| protein TolQ [Oligotropha carboxidovorans OM5]
          Length = 237

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 89/225 (39%), Positives = 140/225 (62%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +A  D+S+ ALF Q  + VK ++  L   S+  W++ I K+  +   RR    FEQ FWS
Sbjct: 13  VASSDVSLIALFWQAHIVVKIVMLGLLACSVWVWAIAIDKTFLYARTRRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           GQS++ + ++L       ++A+F++AM EWK+S +  +RS  G+Q RID++M V+IARE+
Sbjct: 73  GQSIDELYRALSAKPTHSMSALFVAAMREWKRSFESHSRSFAGLQTRIDKVMSVSIAREI 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SA   VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLDRRLLVLATVGSASPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAI 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFTSEVNRQAQRLEGFADEFSAILSRQIDERA 237


>gi|92118975|ref|YP_578704.1| MotA/TolQ/ExbB proton channel [Nitrobacter hamburgensis X14]
 gi|91801869|gb|ABE64244.1| Cell division and transport-associated protein TolQ [Nitrobacter
           hamburgensis X14]
          Length = 237

 Score =  177 bits (448), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 88/225 (39%), Positives = 136/225 (60%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           LA  D+S+  LF      VK ++  L   S+  W++ I K   +   +R    FEQ FWS
Sbjct: 13  LASADVSLITLFFHAHWIVKAVMLGLLGCSVWVWAIAIDKMFLYARTKRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S+E + ++L       +AA F++AM EWK+S +   RS  G+Q RI+++M+V+IARE+
Sbjct: 73  GESIEDLYRALSAKPTQSMAACFVAAMREWKRSFESQTRSFAGLQMRIEKVMNVSIAREI 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAV 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFTSEVNRQAQRLEGFADEFSAILSRQIDERA 237


>gi|163738346|ref|ZP_02145761.1| MotA/TolQ/ExbB proton channel [Phaeobacter gallaeciensis BS107]
 gi|163742237|ref|ZP_02149625.1| proton transporter TolQ [Phaeobacter gallaeciensis 2.10]
 gi|161384567|gb|EDQ08948.1| proton transporter TolQ [Phaeobacter gallaeciensis 2.10]
 gi|161388267|gb|EDQ12621.1| MotA/TolQ/ExbB proton channel [Phaeobacter gallaeciensis BS107]
          Length = 231

 Score =  176 bits (447), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 83/219 (37%), Positives = 125/219 (57%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  L VK ++ +L + SI SW++I+QK +N+   RR+  EF++ FWSG+ 
Sbjct: 12  IDFSMWGLFARATLTVKLVMLMLVVASIWSWAIILQKLINYRLARREAAEFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +          IF + M+EW++S         G Q RI+R MDVAIA+E E +
Sbjct: 72  LDGLFDQIGPQPKGQSQRIFAAGMTEWRRSHRTDGALIAGAQARIERSMDVAIAKESEHV 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLSILATVGSTAPFVGLFGTVWGIMTAFIEIAEQQNTNLAVVAPGIAEALMATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EFS ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRIIGSYEAFADEFSTILSRQLD 230


>gi|163854159|ref|YP_001642202.1| protein TolQ [Methylobacterium extorquens PA1]
 gi|163665764|gb|ABY33131.1| protein TolQ [Methylobacterium extorquens PA1]
          Length = 238

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 88/224 (39%), Positives = 134/224 (59%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+S+F LF Q    VK ++  L   SI  WS+I+ K++ F     +   FE+ FWSG+
Sbjct: 12  VADMSLFGLFWQAHFVVKLVMVGLLGASIWCWSIIVDKTLLFRRTEAEMDAFEEAFWSGR 71

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SLE + +S  +    GL A+F++AM EWK+S +   R    +  RID+++DV I RE+E 
Sbjct: 72  SLEELYRSFNDRQPTGLGALFVAAMREWKRSFEGSGRQIHSLSQRIDKVLDVTIQREVER 131

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I E+L +  +GL
Sbjct: 132 LDSRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGIAEALFATAIGL 191

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ +AYNK      K   ++EGFA+EFSAILSRQ +  +S
Sbjct: 192 FAAIPAVLAYNKLQATVSKSQSRLEGFADEFSAILSRQIDERLS 235


>gi|83312313|ref|YP_422577.1| biopolymer transport protein [Magnetospirillum magneticum AMB-1]
 gi|82947154|dbj|BAE52018.1| Biopolymer transport protein [Magnetospirillum magneticum AMB-1]
          Length = 241

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 82/226 (36%), Positives = 130/226 (57%), Gaps = 5/226 (2%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+S++ALF++  + VK ++  L + S   W++I  K +    L  +  +FE+ FWSG S
Sbjct: 16  MDLSMWALFLRADIIVKFVMIALLMASFWCWAIIFDKLMKVRQLTTRADQFEEAFWSGGS 75

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPI----GIQDRIDRMMDVAIARE 124
           LE +   + +     +++IF++AM EW++S  KG          +  RIDR+M V + RE
Sbjct: 76  LEELYDRIGSRPLDPMSSIFVAAMREWRRSAAKGLADRDSTRASLPQRIDRVMSVTLGRE 135

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
           +E +  +L FL S+ S    +G+ G V G+M  FQSIA   + ++  +   I E+L +  
Sbjct: 136 MELLERRLGFLASVGSTAPFIGLFGTVWGIMNSFQSIAATKNTSLAVVAPGIAEALFATA 195

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           LGL  +IP+ IAYNK   D  +++ ++E FA EF AILSRQ E   
Sbjct: 196 LGLVAAIPAVIAYNKISTDLDRYSKRLENFAGEFGAILSRQLEEKA 241


>gi|170747181|ref|YP_001753441.1| protein TolQ [Methylobacterium radiotolerans JCM 2831]
 gi|170653703|gb|ACB22758.1| protein TolQ [Methylobacterium radiotolerans JCM 2831]
          Length = 238

 Score =  176 bits (447), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 135/234 (57%), Gaps = 5/234 (2%)

Query: 1   MNNYGLA----IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQF 56
           MN         + D+++  LF+Q    VK ++  L   SI  WS+I+ K++ F   + + 
Sbjct: 1   MNPADAMQAAPVADMTLLGLFLQAHFVVKIVMIGLLSASIWCWSIIVDKTLLFRRTKAEM 60

Query: 57  REFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRM 116
             FE  FWSG+SLE + +S  +    GLAA+F++AM EWK+S +   R    +  RI++ 
Sbjct: 61  DAFEDAFWSGRSLEELFRSFNDRPATGLAAVFVAAMREWKRSFEGSGRQIQSLSQRIEKQ 120

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           +DV I RE+E +  +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I
Sbjct: 121 LDVTIHREVERLESRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGI 180

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            E+L +  +GL  +IP+ +AYNK   +  K   ++E FA+EFSAILSRQ +  +
Sbjct: 181 AEALFATAIGLFAAIPAVLAYNKLQAEVSKAQSRLESFADEFSAILSRQIDERL 234


>gi|118588329|ref|ZP_01545738.1| tolQ Protein [Stappia aggregata IAM 12614]
 gi|118439035|gb|EAV45667.1| tolQ Protein [Stappia aggregata IAM 12614]
          Length = 234

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 96/219 (43%), Positives = 133/219 (60%), Gaps = 1/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           IS FALF Q  + VK ++  L   S+  W++I+ K +     RRQ   FE +FWSGQSLE
Sbjct: 15  ISFFALFWQAHIVVKLVMLGLLGASVWCWAIIVDKIMLVGRTRRQMSRFETVFWSGQSLE 74

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  +L N  N  +AA+F++AM EWK+S +    +   +Q RIDR+MDV I RE E +  
Sbjct: 75  ELYNTLHNRVNHSMAALFVAAMREWKRSHEGARPAIGSLQQRIDRVMDVTIQREAERLES 134

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L  L ++ SA   +G+ G V G+M  FQ+IA   S N+  +   I E+L +  LGL  +
Sbjct: 135 RLLILATVGSAAPFIGLFGTVWGIMTAFQAIAASESTNLAVVAPGIAEALFATALGLLAA 194

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP+ IAYNKF  D  K   +MEGFA+EFSAILSRQ +  
Sbjct: 195 IPAVIAYNKFSSDVGKAVARMEGFADEFSAILSRQIDER 233


>gi|254441621|ref|ZP_05055114.1| protein TolQ [Octadecabacter antarcticus 307]
 gi|198251699|gb|EDY76014.1| protein TolQ [Octadecabacter antarcticus 307]
          Length = 224

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 76/221 (34%), Positives = 122/221 (55%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D +++ +F    + V+ ++ LL I S+  W+VI+ K V +   R + R F++ FWSG
Sbjct: 3   AATDFTMWGMFAHATIPVQFVMILLIIASVWCWAVIVDKWVQYRKARAEARIFDEAFWSG 62

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
             L+ +   +          IF + M EW++S  +      G   RIDR MDVAIA+E E
Sbjct: 63  NPLDELFDRIGATPKGSSEKIFAAGMLEWRRSHRQDGGLIAGATARIDRSMDVAIAKETE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L+ L ++ S+   +G+LG V+G+M  F  IA   + N+  +   I E+L++  LG
Sbjct: 123 RLQRGLTVLATVGSSAPFIGLLGTVMGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I YNK+  D+ +     E FA+EF+ ILSRQ +
Sbjct: 183 LMAAIPAVIYYNKYSADADRVVRGYEAFADEFATILSRQLD 223


>gi|218533104|ref|YP_002423920.1| protein TolQ [Methylobacterium chloromethanicum CM4]
 gi|254564127|ref|YP_003071222.1| TolA-TolQ-TolR complex membrane anchored protein [Methylobacterium
           extorquens DM4]
 gi|218525407|gb|ACK85992.1| protein TolQ [Methylobacterium chloromethanicum CM4]
 gi|254271405|emb|CAX27418.1| membrane spanning protein in TolA-TolQ-TolR complex
           [Methylobacterium extorquens DM4]
          Length = 238

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 88/224 (39%), Positives = 134/224 (59%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+S+F LF Q    VK ++  L   SI  WS+I+ K++ F     +   FE+ FWSG+
Sbjct: 12  VADMSLFGLFWQAHFVVKLVMVGLLGASIWCWSIIVDKTLLFRRTEAEMDAFEEAFWSGR 71

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SLE + +S  +    GL A+F++AM EWK+S +   R    +  RID+++DV I RE+E 
Sbjct: 72  SLEELYRSFNDRQPTGLGALFVAAMREWKRSFEGSGRQIHSLSQRIDKVLDVTIQREVER 131

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I E+L +  +GL
Sbjct: 132 LDSRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGIAEALFATAIGL 191

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ +AYNK      K   ++EGFA+EFSAILSRQ +  +S
Sbjct: 192 FAAIPAVLAYNKLQATVAKSQSRLEGFADEFSAILSRQIDERLS 235


>gi|240141618|ref|YP_002966098.1| membrane spanning protein in TolA-TolQ-TolR complex
           [Methylobacterium extorquens AM1]
 gi|240011595|gb|ACS42821.1| membrane spanning protein in TolA-TolQ-TolR complex
           [Methylobacterium extorquens AM1]
          Length = 232

 Score =  176 bits (446), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 88/224 (39%), Positives = 134/224 (59%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+S+F LF Q    VK ++  L   SI  WS+I+ K++ F     +   FE+ FWSG+
Sbjct: 6   VADMSLFGLFWQAHFVVKLVMVGLLGASIWCWSIIVDKTLLFRRTEAEMDAFEEAFWSGR 65

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SLE + +S  +    GL A+F++AM EWK+S +   R    +  RID+++DV I RE+E 
Sbjct: 66  SLEELYRSFNDRQPTGLGALFVAAMREWKRSFEGSGRQIHSLSQRIDKVLDVTIQREVER 125

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I E+L +  +GL
Sbjct: 126 LDSRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGIAEALFATAIGL 185

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ +AYNK      K   ++EGFA+EFSAILSRQ +  +S
Sbjct: 186 FAAIPAVLAYNKLQATVAKSQSRLEGFADEFSAILSRQIDERLS 229


>gi|254475158|ref|ZP_05088544.1| protein TolQ [Ruegeria sp. R11]
 gi|214029401|gb|EEB70236.1| protein TolQ [Ruegeria sp. R11]
          Length = 231

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 81/219 (36%), Positives = 124/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  + VK ++ +L   SI SW++I+QK +N+   RR+  EF++ FWSG+ 
Sbjct: 12  IDFSMWGLFERATVTVKLVMVMLVASSIWSWAIILQKLINYRQARREAAEFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +          IF + M+EW++S         G Q RI+R MDVAIA+E E +
Sbjct: 72  LDGLFDDIGPQPKGQSQRIFAAGMTEWRRSHRTDGALIAGAQARIERSMDVAIAKESESV 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLSILATIGSTAPFVGLFGTVWGIMTAFIEIAEQQNTNLAVVAPGIAEALMATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRIIGSYEAFADEFATILSRQLD 230


>gi|85706714|ref|ZP_01037806.1| proton transporter TolQ [Roseovarius sp. 217]
 gi|85668772|gb|EAQ23641.1| proton transporter TolQ [Roseovarius sp. 217]
          Length = 231

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 78/219 (35%), Positives = 118/219 (53%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD S++ALF +    VK ++ +L + S  SWS+IIQK + +   R +   F++ FWSG+ 
Sbjct: 12  MDFSMWALFARATFIVKLVMFMLIVASFWSWSIIIQKIIVYRKARLEAEIFDRRFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +          IF + M EW++S         G   RIDR MDVAIA+E E +
Sbjct: 72  LDGLFDEIGPDPAGQSERIFAAGMMEWRRSHRNDGNLIAGATARIDRSMDVAIAKESEGL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLQVLATVGSTAPFIGLFGTVWGIMHAFIEIAEQQNTNLAVVAPGIAEALLATGLGLI 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   D+ +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADADRIVAGYEAFADEFATILSRQLD 230


>gi|85714383|ref|ZP_01045371.1| MotA/TolQ/ExbB proton channel [Nitrobacter sp. Nb-311A]
 gi|85698830|gb|EAQ36699.1| MotA/TolQ/ExbB proton channel [Nitrobacter sp. Nb-311A]
          Length = 237

 Score =  176 bits (445), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 89/225 (39%), Positives = 137/225 (60%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           LA  D+S+  LF      VK ++  L   S+  W++ I K   +   +R    FEQ FWS
Sbjct: 13  LASADVSLITLFFHAHWIVKAVMLGLLACSVWVWAIAIDKMFLYTRTKRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+S+E + ++L       +AA F++AM EWK+S +  ARS  G+Q RI+++M+V+IARE+
Sbjct: 73  GESIEDLYRALSAKPTQSMAACFVAAMREWKRSFESQARSIAGLQMRIEKVMNVSIAREI 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLERRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAI 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFTAEVNRQAQRLEGFADEFSAILSRQIDERA 237


>gi|163796371|ref|ZP_02190332.1| Biopolymer transport protein [alpha proteobacterium BAL199]
 gi|159178513|gb|EDP63055.1| Biopolymer transport protein [alpha proteobacterium BAL199]
          Length = 243

 Score =  175 bits (444), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 84/222 (37%), Positives = 133/222 (59%), Gaps = 6/222 (2%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           +I+ LF+     VK ++ +L I S+  W++I  K     +LRR+  EFE+ FWSG SLE 
Sbjct: 20  NIWDLFLAADPIVKGVMGMLLIASVFCWAIIFDKWFKVRSLRRRAVEFEEAFWSGGSLED 79

Query: 72  VCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSP-----IGIQDRIDRMMDVAIARELE 126
           +   + NH    +AA+F SAM EW++S  +G  S        ++ RID++M + I+RE+E
Sbjct: 80  LYDRMGNHPEDPMAAVFSSAMREWRRSAARGLTSKGTELRASLRHRIDQVMLLTISREME 139

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            + ++++FL S+ S    +G+ G V G+M  FQSIA   + ++  +   I E+L +  LG
Sbjct: 140 ALEKRMTFLASVGSTAPFIGLFGTVWGIMNSFQSIAASKNTSLAVVAPGIAEALFATALG 199

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           L  +IP+ I YNK   D  ++A ++EGFA EF +ILSRQ + 
Sbjct: 200 LVAAIPAVIFYNKISSDLGRYAARLEGFALEFGSILSRQLDE 241


>gi|300023933|ref|YP_003756544.1| protein TolQ [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525754|gb|ADJ24223.1| protein TolQ [Hyphomicrobium denitrificans ATCC 51888]
          Length = 238

 Score =  175 bits (443), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 88/217 (40%), Positives = 137/217 (63%), Gaps = 1/217 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
            S   LFMQ  L VK ++T L + SI SW++I +K + F   R +  +FEQ+FWSGQSL+
Sbjct: 19  FSFIELFMQASLVVKIVMTGLGLASIWSWAIIFEKLLAFRRARVESDKFEQMFWSGQSLD 78

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  +L     I +AA+F++AM EWK+S +   R+  GIQ R++++MDV I+RE+E +  
Sbjct: 79  ELYANLSRGRTITMAALFVAAMREWKRSVEGNIRALGGIQLRVEKVMDVTISREMERLDR 138

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L FL ++ S    VG+ G V G+M  FQSIA   + ++  +   I E+L +  LGL  +
Sbjct: 139 RLLFLATVGSTAPFVGLFGTVWGIMTSFQSIAVSKNTSLAVVAPGIAEALFATALGLMAA 198

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           IP+ + YNKF  DS   + ++  F++EF+AI+SRQ +
Sbjct: 199 IPAVVFYNKFSADSSAISQRLYAFSDEFAAIVSRQID 235


>gi|114327767|ref|YP_744924.1| tolQ protein [Granulibacter bethesdensis CGDNIH1]
 gi|114315941|gb|ABI62001.1| tolQ protein [Granulibacter bethesdensis CGDNIH1]
          Length = 241

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 80/222 (36%), Positives = 122/222 (54%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+  LF+Q    VK ++ LL   SI  W+V I K V+     R    FE  FWSG SL
Sbjct: 19  DLSLLGLFLQADAIVKIVMLLLLFASIWVWAVAIDKYVSLRRANRAADAFEDRFWSGGSL 78

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEE 127
           + + ++        +AA+F +AM EW+++           G+++R DR M V I RE++ 
Sbjct: 79  DELYETEGAKPTNPIAAVFGAAMGEWRRTARIAGTDFSRSGVRERTDRAMGVTIGREMDR 138

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   + FL S+ S    +G+ G V G+M  F SIA  ++ N+  +   I E+L +  +GL
Sbjct: 139 LERWMVFLASVGSTAPFIGLFGTVWGIMNSFSSIAAMHNTNLSVVAPGIAEALFATAMGL 198

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ + YNK   D  +FA ++E FA EF AILSRQ+E  
Sbjct: 199 VAAIPAVLIYNKLSTDMARFAARLEAFAAEFGAILSRQSEER 240


>gi|146338266|ref|YP_001203314.1| TolQ protein [Bradyrhizobium sp. ORS278]
 gi|146191072|emb|CAL75077.1| TolQ protein [Bradyrhizobium sp. ORS278]
          Length = 234

 Score =  175 bits (443), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 90/219 (41%), Positives = 134/219 (61%), Gaps = 1/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+  LF   G  V+ I+  L   SI  W++ I K   F   RR    FEQ FWSG+S+E
Sbjct: 15  LSLIELFANAGWVVRIIMLGLISCSIWVWAIAIDKMFLFSRTRRSMDRFEQAFWSGESIE 74

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            + + L       +AA F++AM EWK+S +  ARS  G+Q RI+++M+V+IARE+E +  
Sbjct: 75  ELYRVLSAKPTQSMAACFVAAMREWKRSFEGHARSFAGLQMRIEKVMNVSIAREVERLER 134

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +GL  +
Sbjct: 135 RLLVLATVGSAGPFVGLFGTVWGIMTSFQSIAASKNTSLAVVAPGIAEALFATAIGLIAA 194

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP++I YNKF  +  + A ++EGFA+EFSAILSRQ +  
Sbjct: 195 IPATIFYNKFSSEVNRQAQRLEGFADEFSAILSRQIDER 233


>gi|240851222|ref|YP_002972625.1| inner membrane TolQ protein [Bartonella grahamii as4aup]
 gi|240268345|gb|ACS51933.1| inner membrane TolQ protein [Bartonella grahamii as4aup]
          Length = 237

 Score =  175 bits (442), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 88/218 (40%), Positives = 139/218 (63%), Gaps = 1/218 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I +  LFMQ    VK ++  L + SI SW++I  K   +  +RR+ ++FE+ FWSG++LE
Sbjct: 12  IGMLHLFMQASWIVKGVMIGLLLASIWSWAIIFDKIFTYRRIRREIKQFERTFWSGKALE 71

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  S K+ H   ++A+FM+AM EWKKS +KG  +   +Q RID+ MD+ + RE E+I  
Sbjct: 72  DLYASCKSQHTNSISAVFMAAMIEWKKSLEKGTHTSKSLQSRIDKAMDLTLGRESEKIES 131

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           KLSFL ++ SAG  +G+ G V+G+M  F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 132 KLSFLATLGSAGPFIGLFGTVIGIMESFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 191

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           IP+ IAYNK   +S +   Q+E FA+EFS I+SR+ + 
Sbjct: 192 IPAVIAYNKLTHESARIIAQIENFADEFSTIVSRRIDE 229


>gi|319407736|emb|CBI81383.1| tolQ protein [Bartonella sp. 1-1C]
          Length = 237

 Score =  175 bits (442), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 89/232 (38%), Positives = 142/232 (61%), Gaps = 2/232 (0%)

Query: 1   MNNYGLAIMD-ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M     A  + I I +LFMQ    VK ++  L   SI SW++I  K V++  +RR    F
Sbjct: 1   MEQVEFASPETIGILSLFMQANWIVKAVMIGLIFASIWSWAIIFDKIVSYRRIRRDIHHF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           E+ FWSG+SL+ +  + K+  N  ++ +F++AM+EWKKS  KG  +P+ +Q RID+ MD+
Sbjct: 61  ERNFWSGKSLDDLYTTYKSQRNNSMSIVFLAAMTEWKKSLSKGLPTPLSLQSRIDKAMDL 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
            + RE  +I  +L FL ++ SAG  +G+ G V+G+M  F SI+   + ++  +   I E+
Sbjct: 121 TLGRESVKIESRLGFLATLGSAGPFIGLFGTVVGIMNSFLSISASQNTSLAIVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L++  +GL  +IP+ IAYNK I +S +   ++E FA+EFS ILSR+ +   S
Sbjct: 181 LLATAIGLFAAIPAVIAYNKLISESGQIIAKIENFADEFSTILSRRIDETTS 232


>gi|319404772|emb|CBI78373.1| tolQ protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 237

 Score =  174 bits (441), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 87/221 (39%), Positives = 138/221 (62%), Gaps = 1/221 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I I +LFMQ    VK ++  L   SI SW++I  K V++  +RR    FE+ FWSGQSL+
Sbjct: 12  IGILSLFMQANWIVKAVMLGLIFASIWSWAIIFDKIVSYRRIRRDIHHFERNFWSGQSLD 71

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  + K+  N  ++ +F++AM+EWKKS  KG  +P+ +Q RID+ MD+ + RE  +I  
Sbjct: 72  DLYSTYKSQRNNSMSIVFLAAMTEWKKSLSKGLPTPLSLQSRIDKAMDLTLGRESVKIES 131

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L FL ++ SAG  +G+ G V+G+M  F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 132 RLGFLATLGSAGPFIGLFGTVVGIMNSFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 191

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           IP+ IAYNK   +S +   ++E FA+EFS ILSR+ +   S
Sbjct: 192 IPAVIAYNKLTSESGQIIAKIENFADEFSTILSRRIDETTS 232


>gi|188584488|ref|YP_001927933.1| protein TolQ [Methylobacterium populi BJ001]
 gi|179347986|gb|ACB83398.1| protein TolQ [Methylobacterium populi BJ001]
          Length = 238

 Score =  174 bits (441), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 88/224 (39%), Positives = 134/224 (59%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+S+F LF Q    VK ++  L   SI  WS+I+ K++ F     +   FE+ FWSG+
Sbjct: 12  VADMSLFGLFWQAHFVVKIVMMGLLGASIWCWSIIVDKTLLFRRTEAEMDAFEEAFWSGR 71

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SLE + +S  +    GL A+F++AM EWK+S +   R    +  RID+++DV I RE+E 
Sbjct: 72  SLEELYRSFNDRQPTGLGALFVAAMREWKRSFEGSGRQIHSLSQRIDKVLDVTIQREVER 131

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L FL S+ SAG  +G+ G V G+M  F SIA   + ++  +   I E+L +  +GL
Sbjct: 132 LDSRLLFLASIGSAGPYIGLFGTVWGIMTAFTSIAASKNTSLAVVAPGIAEALFATAIGL 191

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ +AYNK      K   ++EGFA+EFSAILSRQ +  +S
Sbjct: 192 FAAIPAVLAYNKLQASVAKSQSRLEGFADEFSAILSRQIDERLS 235


>gi|121602265|ref|YP_988485.1| protein TolQ [Bartonella bacilliformis KC583]
 gi|120614442|gb|ABM45043.1| protein TolQ [Bartonella bacilliformis KC583]
          Length = 235

 Score =  174 bits (441), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 147/232 (63%), Gaps = 2/232 (0%)

Query: 1   MNNYGLAIMD-ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M +  LA  + I ++ALF+Q    VK ++  L + SI SW++I+ K   +  +RR  R F
Sbjct: 1   MTHIDLASPETIGMWALFIQANWVVKAVMIGLVLASIWSWTIILHKIFAYRKIRRDIRHF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           E+ FWSG+SLE +  + +N     ++A+F++AM+EWKKS  KG  +   +Q RI++ MD+
Sbjct: 61  EKFFWSGKSLEELYTAYQNKPLNNISAVFIAAMTEWKKSLTKGIHTSPSLQIRIEKAMDL 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
           AI RE ++I  KL +L ++ SA   +G+ G V+G+M  F SI+   + ++  +   I E+
Sbjct: 121 AIGRESKKIESKLGYLATLGSAAPFIGLFGTVIGIMNSFLSISASQNTSLAIVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L++  +GL V+IP+ + YNKFI +S +   Q+E FA+EFS I+SR+ +  ++
Sbjct: 181 LLATAIGLMVAIPAVVFYNKFIGESAQIIAQIEDFADEFSTIISRRIDEKVT 232


>gi|299134175|ref|ZP_07027368.1| protein TolQ [Afipia sp. 1NLS2]
 gi|298590922|gb|EFI51124.1| protein TolQ [Afipia sp. 1NLS2]
          Length = 237

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 92/225 (40%), Positives = 141/225 (62%), Gaps = 1/225 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +A  D+S+ ALF Q  + VK ++  L   S+  W++ I K   +   RR    FEQ FWS
Sbjct: 13  VASSDVSLIALFWQAHIVVKFVMLGLLSCSVWVWAIAIDKIFLYARTRRAMDRFEQAFWS 72

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           GQS++ + ++L       +AA+F++AM EWK+S +  +RS  G+Q RID++M V+IARE+
Sbjct: 73  GQSIDDLYRALSAKPTHSMAALFVAAMREWKRSFESHSRSFAGLQTRIDKVMSVSIAREI 132

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +  +L  L ++ SAG  VG+ G V G+M  FQSIA   + ++  +   I E+L +  +
Sbjct: 133 ERLDRRLLVLATVGSAGPFVGLFGTVWGIMSSFQSIAASKNTSLAVVAPGIAEALFATAM 192

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP++I YNKFI +  + A ++EGFA+EFSAILSRQ +   
Sbjct: 193 GLIAAIPATIFYNKFISEVGRQAQRLEGFADEFSAILSRQIDERA 237


>gi|77464243|ref|YP_353747.1| biopolymer transport protein, TolQ [Rhodobacter sphaeroides 2.4.1]
 gi|126463085|ref|YP_001044199.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17029]
 gi|221640127|ref|YP_002526389.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides KD131]
 gi|332559132|ref|ZP_08413454.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides WS8N]
 gi|77388661|gb|ABA79846.1| Biopolymer transport protein, TolQ [Rhodobacter sphaeroides 2.4.1]
 gi|126104749|gb|ABN77427.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17029]
 gi|221160908|gb|ACM01888.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides KD131]
 gi|332276844|gb|EGJ22159.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides WS8N]
          Length = 232

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/220 (34%), Positives = 120/220 (54%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S+ ALF +  L VK ++ LL + S  SW++I++K + +   RR+   F++ FWSG+ 
Sbjct: 12  IDFSMLALFARATLTVKFVMILLIVMSFWSWAIIVRKHLLYRQARREAAIFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + L          IF + M EW++S         G Q RIDR M VAI +E E +
Sbjct: 72  LDELFERLGPQPEGASEKIFAAGMLEWRRSHRNDGGLIAGAQSRIDRSMGVAIDKESETL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LSFL +  S    +G+ G V G+   F+ IA   + N+  +   I E+L++   GL 
Sbjct: 132 NSGLSFLATTGSTAPFIGLFGTVWGIKHAFEQIAISQNTNLAVVAPGIAEALLATAFGLV 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ + YNK   DS++     + F++EF+ ILSRQ + 
Sbjct: 192 AAIPAVVFYNKLNADSERIIGGYDAFSDEFATILSRQLDA 231


>gi|209965098|ref|YP_002298013.1| protein TolQ [Rhodospirillum centenum SW]
 gi|209958564|gb|ACI99200.1| protein TolQ [Rhodospirillum centenum SW]
          Length = 244

 Score =  174 bits (440), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/226 (32%), Positives = 118/226 (52%), Gaps = 5/226 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             ++SI  LF+     VK ++  L   S+  W++I  K+V    ++    EFE+ FWSG 
Sbjct: 18  AHELSILGLFLAADWIVKIVMLALVGASVWCWAIIFDKAVKLRRMKAAATEFEEQFWSGG 77

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGA----RSPIGIQDRIDRMMDVAIAR 123
           SL+ +   +  +    L+A F + M EW+ + ++G          +  RI+R+M V I R
Sbjct: 78  SLDQLYDEVAANPGDPLSATFAAGMREWRHAAERGLLTTGAMRANLAQRIERVMSVTIGR 137

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISI 182
           E+      ++ L S+ S    +G+ G V G+M  F SIA   + ++  +   I E+L + 
Sbjct: 138 EMAGAERYMTVLASVGSTAPFIGLFGTVWGIMNAFTSIAAQQNTSLAVVAPGIAEALFAT 197

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            LGL  +IP+ IAYNKF  D  +FA +++ F  EFSAIL R  E  
Sbjct: 198 ALGLVAAIPAVIAYNKFSTDLGRFADRLDSFTTEFSAILQRHLEER 243


>gi|254452911|ref|ZP_05066348.1| protein TolQ [Octadecabacter antarcticus 238]
 gi|198267317|gb|EDY91587.1| protein TolQ [Octadecabacter antarcticus 238]
          Length = 216

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/215 (34%), Positives = 119/215 (55%), Gaps = 1/215 (0%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
           ++ +F    + V+ ++ LL I S+  W+VI+ K V +   R + R F++ FWSG  L+ +
Sbjct: 1   MWGMFAHATIPVQFVMILLIIASVWCWAVIVDKWVQYRKARAEARVFDEAFWSGNPLDEL 60

Query: 73  CKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKL 132
              +          IF + M EW++S  +      G   RIDR MDVAIA+E E +   L
Sbjct: 61  FDRIGATPKGPSEKIFAAGMLEWRRSHRQDGGLIAGATARIDRSMDVAIAKETERLQRGL 120

Query: 133 SFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIP 191
           + L ++ S+   +G+LG V+G+M  F  IA   + N+  +   I E+L++  LGL  +IP
Sbjct: 121 TVLATVGSSAPFIGLLGTVMGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLMAAIP 180

Query: 192 SSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           + I YNKF  D+ +     E FA+EF+ ILSRQ +
Sbjct: 181 AVIYYNKFSADADRVVSGYEAFADEFATILSRQLD 215


>gi|288957822|ref|YP_003448163.1| biopolymer transport protein [Azospirillum sp. B510]
 gi|288910130|dbj|BAI71619.1| biopolymer transport protein [Azospirillum sp. B510]
          Length = 244

 Score =  173 bits (439), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 79/232 (34%), Positives = 127/232 (54%), Gaps = 3/232 (1%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N       +I+I  LF Q    VK ++ +L I SI  W++II+K +    L  Q   FE+
Sbjct: 12  NAAATTAHEITILGLFWQADAIVKIVMMMLVIASIWCWAIIIEKLMRLRRLNAQADAFEE 71

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDK--GARSPIGIQDRIDRMMDV 119
            FWSG SL+ +   +    +  +AA F + M EW+ + D+  G      +Q R++R+M V
Sbjct: 72  AFWSGGSLDALYDRIGQSPSDPMAATFAAGMREWRHAADRGIGGTMKSSLQQRVERVMAV 131

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
            I RE+      ++FL S+ S    +G+ G V G+M  F SIAG  + ++  +   I E+
Sbjct: 132 TIGREMARAERYMTFLASVGSTAPFIGLFGTVWGIMNSFTSIAGSGNTSLAVVAPGIAEA 191

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L +  +GL  +IP+ ++YNKF  D  ++A +++ F+ EFSAILSR  E   +
Sbjct: 192 LFATAMGLLAAIPAVLSYNKFSTDLGRYADRLDTFSGEFSAILSRHLEERGA 243


>gi|146276611|ref|YP_001166770.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17025]
 gi|145554852|gb|ABP69465.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17025]
          Length = 232

 Score =  173 bits (438), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 77/220 (35%), Positives = 120/220 (54%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S+ ALF +  L VK ++ LL + S  SW++II+K + +   RR+   F++ FWSG+ 
Sbjct: 12  IDFSMLALFARATLTVKVVMILLIVMSFWSWAIIIRKHLLYRQARREAAIFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + L          IF + M EW++S         G Q RIDR M VAI +E E +
Sbjct: 72  LDELFERLGPQPEGASEKIFAAGMLEWRRSHRTDGGLIAGAQSRIDRSMGVAIDKESETL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LSFL +  S    +G+ G V G+   F+ IA   + N+  +   I E+L++   GL 
Sbjct: 132 NAGLSFLATTGSTAPFIGLFGTVWGIKHAFEQIAISQNTNLAVVAPGIAEALLATAFGLV 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ + YNK   DS++     E F++EF+ ILSRQ + 
Sbjct: 192 AAIPAVVFYNKLNADSERIIGGYEAFSDEFATILSRQLDA 231


>gi|296447813|ref|ZP_06889726.1| protein TolQ [Methylosinus trichosporium OB3b]
 gi|296254672|gb|EFH01786.1| protein TolQ [Methylosinus trichosporium OB3b]
          Length = 246

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 84/222 (37%), Positives = 140/222 (63%), Gaps = 1/222 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           ++ISI+ +F+   + VK ++  L   SI  W++I+ K + F   RR    FE++FWSG S
Sbjct: 15  VEISIWGMFLGAHIVVKLVMIGLLAASIWCWAIIVDKVILFTRTRRAMDRFEEVFWSGSS 74

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           LE +   L++     +A++F++AM EWK+S      S +G+Q RID+++DV+IARE+E++
Sbjct: 75  LEDLYSKLQDRPTGAMASLFVAAMREWKRSFQTAGASFMGLQARIDKVLDVSIAREVEKL 134

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L +++SAG  VG+ G V G+M  F+SIA   + ++  +   I E+L++  +GL 
Sbjct: 135 ESNLLVLATVASAGPFVGLFGTVWGIMTSFRSIAASKNTSLAVVAPGIAEALLATAIGLF 194

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            +IP+ +AYNK   D  +   +++ FA+EFSAILSRQ + + 
Sbjct: 195 AAIPALVAYNKLQGDVARAQARLDSFADEFSAILSRQIDQHA 236


>gi|71735754|ref|YP_275910.1| tolQ protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71556307|gb|AAZ35518.1| tolQ protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320323049|gb|EFW79138.1| tolQ protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329679|gb|EFW85668.1| tolQ protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330877976|gb|EGH12125.1| tolQ protein [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 231

 Score =  173 bits (437), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 68/218 (31%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++ +L   S+ SW VI Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASIVVQLVMLILVAASVTSWIVIFQRSNMLRAGRRALDSFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQSGVDPDAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L +L ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 AGLPYLATVGSTSPYVGLFGTVWGIMNSFRGLATAQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F+  S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFVARSETLISRYYTFADEFQAILHRKVH 227


>gi|319406259|emb|CBI79896.1| tolQ protein [Bartonella sp. AR 15-3]
          Length = 237

 Score =  173 bits (437), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 85/221 (38%), Positives = 137/221 (61%), Gaps = 1/221 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I I +LFMQ    VK ++  L   SI SW++I  K +++  +RR    FE+ FWSGQSLE
Sbjct: 12  IGILSLFMQANWIVKAVMIGLIFASIWSWAIIFDKFISYRRIRRNIHHFERNFWSGQSLE 71

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  +  +  N  ++ +F++AM+EWKKS  KG+ + + +Q RID+ MD+ + RE  +I  
Sbjct: 72  DLYATYNSQRNNSISIVFLAAMAEWKKSLSKGSPTSLNLQSRIDKAMDLTLGRESVKIES 131

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L FL ++ SAG  +G+ G V+G+M  F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 132 RLGFLATLGSAGPFIGLFGTVVGIMNSFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 191

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           IP+ IAYNK   +S +   ++E FA+EFS ILSR+ +   S
Sbjct: 192 IPAVIAYNKLTSESAQIIAKIENFADEFSTILSRRIDETTS 232


>gi|112774536|gb|ABI20705.1| putative MotA/TolQ/ExbB proton channel [Delftia sp. AN3]
          Length = 263

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 73/221 (33%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L +Q    V+ ++ +L   S+ SW+ I +KS     +R     FEQ FWS
Sbjct: 30  MNSHDMSILSLVLQASWVVQLVMLILVGASVASWATIFRKSQTLKRVRSLNDGFEQDFWS 89

Query: 66  GQSLETVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S  +H      +  IF S M E++K  ++       + D   R M  +  R
Sbjct: 90  GTSLNDLYASAAHHAKQGGPMERIFASGMREYQKLRERRIADVNQLMDGTRRAMRASFQR 149

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++E+   LSFLG++ S    VG+ G V G+M  F   A      +    PGI E+L++ 
Sbjct: 150 EMDEVESGLSFLGTVGSVSPYVGLFGTVWGVMHAFTGFANMEQITLATVAPGIAEALVAT 209

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
            +GL  +IP+  AYN++     + A Q E F  EFS IL R
Sbjct: 210 AMGLFAAIPAVTAYNRYAHQIDRVASQQETFIEEFSNILQR 250


>gi|162146625|ref|YP_001601084.1| protein TolQ [Gluconacetobacter diazotrophicus PAl 5]
 gi|209543383|ref|YP_002275612.1| protein TolQ [Gluconacetobacter diazotrophicus PAl 5]
 gi|161785200|emb|CAP54746.1| putative protein tolQ [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531060|gb|ACI50997.1| protein TolQ [Gluconacetobacter diazotrophicus PAl 5]
          Length = 238

 Score =  172 bits (436), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 77/229 (33%), Positives = 123/229 (53%), Gaps = 3/229 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           N G A   +S+++LF+   + VK ++  L   S++ W +I  K V    + RQ   FE  
Sbjct: 9   NLGAAASGLSLWSLFLHAAIVVKLVMIGLVFSSVVVWGIIFDKIVTLRRVNRQAGVFEDK 68

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVA 120
           FWSG SL+ + ++        LAA+F +AM EW++S           G+Q+R+DR M++ 
Sbjct: 69  FWSGGSLDDLYETDGAKPVHPLAAVFGAAMGEWRRSSRISGVDLARGGVQERVDRAMNIT 128

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
           I RE+E +   + FL ++      +G+ G V G+M  F +IA  ++ N+  +   I E+L
Sbjct: 129 ITREMERLGRWMIFLATIGPVAPFIGLFGTVWGIMHAFGAIAAMHNTNLAVVAPGISEAL 188

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +  +GL  +IP+ IAYN        F  +M  F  EF+AILSRQ+E  
Sbjct: 189 FATAIGLVTAIPAVIAYNVINNSLSLFEDRMAAFGTEFAAILSRQSEER 237


>gi|28871120|ref|NP_793739.1| tolQ protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|66044660|ref|YP_234501.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. syringae
           B728a]
 gi|213969188|ref|ZP_03397327.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tomato T1]
 gi|237800221|ref|ZP_04588682.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|257487007|ref|ZP_05641048.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289626499|ref|ZP_06459453.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289650945|ref|ZP_06482288.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|289674674|ref|ZP_06495564.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. syringae
           FF5]
 gi|298488206|ref|ZP_07006242.1| MotA/TolQ/ExbB proton channel family protein [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|301384817|ref|ZP_07233235.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063529|ref|ZP_07255070.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tomato K40]
 gi|302130607|ref|ZP_07256597.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|302187154|ref|ZP_07263827.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. syringae
           642]
 gi|28854370|gb|AAO57434.1| tolQ protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|63255367|gb|AAY36463.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. syringae
           B728a]
 gi|213926186|gb|EEB59742.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tomato T1]
 gi|298157264|gb|EFH98348.1| MotA/TolQ/ExbB proton channel family protein [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|330868615|gb|EGH03324.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330872650|gb|EGH06799.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330892243|gb|EGH24904.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. mori str.
           301020]
 gi|330896131|gb|EGH28352.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330936715|gb|EGH40902.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330950606|gb|EGH50866.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae Cit 7]
 gi|330959268|gb|EGH59528.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. maculicola
           str. ES4326]
 gi|330964827|gb|EGH65087.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. actinidiae
           str. M302091]
 gi|330968888|gb|EGH68954.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330988972|gb|EGH87075.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. lachrymans
           str. M301315]
 gi|331009351|gb|EGH89407.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|331016442|gb|EGH96498.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. lachrymans
           str. M302278PT]
 gi|331023078|gb|EGI03135.1| MotA/TolQ/ExbB proton channel [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 231

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 68/218 (31%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++ +L   S+ SW VI Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASIVVQLVMLILVAASVTSWIVIFQRSNMLRAGRRALDSFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQSGVDPDAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L +L ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 AGLPYLATVGSTSPYVGLFGTVWGIMNSFRGLATAQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARSETLISRYYTFADEFQAILHRKVH 227


>gi|260576648|ref|ZP_05844635.1| protein TolQ [Rhodobacter sp. SW2]
 gi|259021133|gb|EEW24442.1| protein TolQ [Rhodobacter sp. SW2]
          Length = 231

 Score =  172 bits (435), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/220 (34%), Positives = 124/220 (56%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S+ ALF++    VK ++ +L   S  SW++II+K +++   + +   F++ FWSG+ 
Sbjct: 12  IDFSLLALFLKATFTVKIVMIMLLSMSFWSWAIIIRKHIDYRKAKAEAGVFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +          IF S M EW++S  +      G Q RIDR MDVAIA+E E +
Sbjct: 72  LDELFEKIGAQPMGASERIFSSGMLEWRRSHRQDGGLIAGAQARIDRSMDVAIAKESESL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + LSFL ++ S    +G+ G V G+   F+ IA   + N+  +   I E+L++  +GL 
Sbjct: 132 NKGLSFLATVGSTAPFIGLFGTVWGIKHAFEQIAISQNTNLAVVAPGIAEALLATAIGLV 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ + YNK   DS+      E FA+EF+ ILSRQ + 
Sbjct: 192 AAIPAVVFYNKLNSDSEHIIGGYEAFADEFATILSRQLDA 231


>gi|323143604|ref|ZP_08078281.1| protein TolQ [Succinatimonas hippei YIT 12066]
 gi|322416667|gb|EFY07324.1| protein TolQ [Succinatimonas hippei YIT 12066]
          Length = 326

 Score =  172 bits (435), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 61/218 (27%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S   L +     V+ ++  L   S++SW++IIQ+S  +   R++  EFE+ FWSG  L 
Sbjct: 8   LSFTELVLNASFLVQLVMLFLLTLSVVSWTIIIQRSNQYKLGRKKADEFEEKFWSGIDLN 67

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +      +   GL  I+ +   E+ +  + G      + D   R M VA +RE+E +
Sbjct: 68  NLYQDCVKRQHSLIGLEVIYSAGFKEFVRLVNSGPADQEVVMDGTYRQMKVAASREIENL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F ++A   +  + +  P I E+LI+  +GL 
Sbjct: 128 ETHLPTLATIGSISPYIGLFGTVWGIMHAFVALAAVKNATLSMVAPPIAEALIATAMGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ + YN+F    +    +   F +EF+ IL+R+ 
Sbjct: 188 AAIPAVMFYNRFTTKLEALENRYLNFMDEFATILNRRL 225


>gi|319409336|emb|CBI82980.1| tolQ protein [Bartonella schoenbuchensis R1]
          Length = 237

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 88/232 (37%), Positives = 145/232 (62%), Gaps = 2/232 (0%)

Query: 1   MNNYGLAIMD-ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF 59
           M +  LA  D + +++LFMQ    VK ++  L + S+ SW++II K   +  +R   ++F
Sbjct: 1   MAHIELASPDTLGMWSLFMQANWVVKAVMIGLILASVWSWAIIIDKIFTYRKIRYDIKQF 60

Query: 60  EQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           EQ FWSG+SLE +  + +N H   +  +F++AM+EWKKS  KG +  + +Q RI++ MD+
Sbjct: 61  EQTFWSGKSLEELYVTYQNQHTNSICVVFIAAMTEWKKSLTKGVQPSLNLQSRIEKAMDL 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
           A+ RE  +I  KL FL ++ SA   +G+ G V+G+M  F SI+   + ++  +   I E+
Sbjct: 121 ALGRESAKIESKLGFLATLGSAAPFIGLFGTVVGIMNSFLSISASQNTSLAVVAPGIAEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L++  +GL  +IP+ IAYNK + +S +    +EGFA+EFS I+SRQ +  I+
Sbjct: 181 LLATAIGLLAAIPAVIAYNKLMHESTQIITHIEGFADEFSTIMSRQIDEKIT 232


>gi|304320245|ref|YP_003853888.1| TolQ protein, inner membrane protein, tolerance to group A colicins
           [Parvularcula bermudensis HTCC2503]
 gi|303299147|gb|ADM08746.1| TolQ protein, inner membrane protein, tolerance to group A colicins
           [Parvularcula bermudensis HTCC2503]
          Length = 231

 Score =  171 bits (434), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 69/218 (31%), Positives = 123/218 (56%), Gaps = 4/218 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D SI+ L +Q  + V+ ++ +L   S+ SW+++  KS+    ++ + ++FE  FWSG+ 
Sbjct: 13  TDFSIWGLILQADIVVQFVMLVLAGMSVWSWTIMFDKSMTLGAIKSKAKKFEDQFWSGRP 72

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +K+  +  +A IFM+ M E+ +    G  +     + + R+    + RELE+I
Sbjct: 73  LDELGRKVKDKPDHPMARIFMTLMDEFTQDRGHGDPAAASRLESVARVH---VNRELEKI 129

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
             +LS L ++ SA   +G+ G V G+M  F+ I      N+  +   I E+L +  LGL 
Sbjct: 130 QSQLSVLATIGSAAPFIGLFGTVWGIMNAFRGIGATGDANLAVVAPGIAEALFATALGLV 189

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ I YN++      +A+++EGFA EF AILSR+ 
Sbjct: 190 AAIPAVIGYNRYAAGVNSYAVRLEGFATEFVAILSRRL 227


>gi|312962756|ref|ZP_07777244.1| biopolymer transport protein TolQ [Pseudomonas fluorescens WH6]
 gi|311282973|gb|EFQ61566.1| biopolymer transport protein TolQ [Pseudomonas fluorescens WH6]
          Length = 231

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++ +L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASVVVQLVMLILVAASVTSWVMIFQRSNLLRAGRRALESFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPEAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +GL  
Sbjct: 130 QSLPFLATVGSVSPYIGLFGTVWGIMNSFRGLAQAQQATLATVAPGIAEALVATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARGENLIGRYYTFADEFQAILHRKVH 227


>gi|294678715|ref|YP_003579330.1| TolQ protein [Rhodobacter capsulatus SB 1003]
 gi|294477535|gb|ADE86923.1| TolQ protein [Rhodobacter capsulatus SB 1003]
          Length = 234

 Score =  171 bits (433), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 80/220 (36%), Positives = 124/220 (56%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD S+ ALF++  L VK ++ LL + S  SWS++I+K ++F   R +   F++ FWSG+ 
Sbjct: 15  MDFSLLALFVRASLTVKLVMILLTLASFWSWSIMIRKYISFRAARAEADAFDRAFWSGEP 74

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +    +     IF + M EW++S         G Q RI+R MDVAIA+E E +
Sbjct: 75  LDELFDQIGPAPDGASQRIFAAGMLEWRRSHRHDGELITGAQARIERSMDVAIAKEGEAL 134

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LSFL ++ S    VG+ G V G+   F+ IA   + ++  +   I E+L++  +GL 
Sbjct: 135 NSGLSFLATVGSTAPFVGLFGTVWGIKVAFEEIAISQNTSLAVVAPGISEALVATAIGLV 194

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYNK   D+ +     E FA+EFS I SRQ + 
Sbjct: 195 AAIPAVIAYNKLSSDADEITSGYEAFADEFSTIPSRQLDA 234


>gi|49476144|ref|YP_034185.1| inner membrane tolQ protein [Bartonella henselae str. Houston-1]
 gi|49238952|emb|CAF28250.1| inner membrane tolQ protein [Bartonella henselae str. Houston-1]
          Length = 237

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 90/221 (40%), Positives = 145/221 (65%), Gaps = 1/221 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I I  LFMQ G  VK ++  L + SI SW++I  K + +  +RR+ ++FE++FWSG+ LE
Sbjct: 12  IGIVHLFMQAGFVVKAVMIGLLLASIWSWAIIFDKILTYRRIRREIKQFERIFWSGKPLE 71

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  + K+     ++A+FM+AM EWKKS +KG  + I +Q RID+ MD+ + RE  +I  
Sbjct: 72  DLYATCKSQRTSSISAVFMAAMVEWKKSLEKGIHTSISLQSRIDKAMDLILGRESAKIEA 131

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           KLSFL ++ SAG  +G+ G V+G+MG F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 132 KLSFLATLGSAGPFIGLFGTVIGIMGSFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 191

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           IP+ IAYNKF+ +S +   Q+E FA+EFS I+SR+ +  ++
Sbjct: 192 IPAVIAYNKFVNESAQIIAQIENFADEFSTIISRRIDETLT 232


>gi|254455761|ref|ZP_05069190.1| protein TolQ [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082763|gb|EDZ60189.1| protein TolQ [Candidatus Pelagibacter sp. HTCC7211]
          Length = 224

 Score =  171 bits (433), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 123/222 (55%), Gaps = 7/222 (3%)

Query: 2   NNYGLAI-MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
              GL    D S+ +LF++  + VK +I +L + SI SW+VII+K   F  + +   EFE
Sbjct: 8   QAVGLGTNTDFSLLSLFLRADIVVKSVIIILILCSIYSWAVIIEKFRLFKKINKSSEEFE 67

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
           + FW+ +S E    SL       +A +F SAM    K      +S   + +R+  M++  
Sbjct: 68  EKFWNSKSAENFYNSLPTKVEDPMALVFQSAMEGLLK-----KKSKTNLSERMTAMLETG 122

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
           + +++ +I +  +FL ++ S    +G+ G V G+M  FQSIA   + ++  +   I E+L
Sbjct: 123 VEKQMTKIDKGFTFLATVGSTAPFIGLFGTVWGIMNSFQSIAISRNTSLAIVAPGIAEAL 182

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            +  LGL  +IP+ +AYNKF  DS+K++ ++E F+ +F  I+
Sbjct: 183 FATALGLLAAIPAVVAYNKFNTDSQKYSQKLENFSKKFLTII 224


>gi|53804467|ref|YP_113690.1| tolQ protein [Methylococcus capsulatus str. Bath]
 gi|53758228|gb|AAU92519.1| tolQ protein [Methylococcus capsulatus str. Bath]
          Length = 225

 Score =  171 bits (432), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 62/220 (28%), Positives = 110/220 (50%), Gaps = 3/220 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  L  +    V+ ++ +L   S++SW+ I  K        +    FE  FWSG  L
Sbjct: 4   ELSIITLIKEASPVVQIVMFILVAASVISWTFIFGKYREIRRAEQTSIAFEDRFWSGIDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L    +    L  IF++   E+ +   +    P  + +   R M VA+ REL++
Sbjct: 64  ADLYRQLATESDDCGGLELIFLAGFKEFGRLRQQSGIMPEAVMEGTQRAMRVALNRELDK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + E+L FL ++ S    +G+ G V G+M  F+S+       + +  PGI E+L++  +GL
Sbjct: 124 LDERLPFLATVGSTSPYIGLFGTVWGIMNSFRSLGSVKQATLAMVAPGISEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ IAYN++  +  + A + E F  E  ++L RQ  
Sbjct: 184 FAAIPAVIAYNRYSTNISRLANRYESFTEELLSLLHRQAH 223


>gi|83746174|ref|ZP_00943228.1| TolQ protein [Ralstonia solanacearum UW551]
 gi|207728185|ref|YP_002256579.1| tolq-related transport protein [Ralstonia solanacearum MolK2]
 gi|83727140|gb|EAP74264.1| TolQ protein [Ralstonia solanacearum UW551]
 gi|206591430|emb|CAQ57042.1| tolq-related transport protein [Ralstonia solanacearum MolK2]
          Length = 254

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/230 (31%), Positives = 118/230 (51%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 25  MNPAEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFE 83

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEW--KKSCDKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S     HH   L  IF + M E+   +   +G   P  I D   R 
Sbjct: 84  RDFWAGGDLQAMYQSAANNRHHTGALERIFEAGMREFLKTREQQRGIGDPSAILDASRRA 143

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 144 MRAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 203

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 204 AEALVATAIGLFAAIPAVIAYNRYATEMDRLANRFESFMEEFSNILQRQT 253


>gi|89094840|ref|ZP_01167773.1| TolQ protein [Oceanospirillum sp. MED92]
 gi|89080895|gb|EAR60134.1| TolQ protein [Oceanospirillum sp. MED92]
          Length = 226

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 117/221 (52%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI++L     + V+ ++ +L + S++SW +I Q+     + R+  R FE  FWSG  L 
Sbjct: 5   MSIWSLVANASVVVQLVMLMLLMASVISWVMIFQRQAVLSSARKSLRNFEDRFWSGVDLG 64

Query: 71  TVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + + + +  N       IF + + E+ +   +    P  + D I R M VA+ARE +++
Sbjct: 65  QLFREINHEPNSDCGAENIFRAGIKEYTRLTQQPGYDPDSVMDGIQRSMRVALAREEDKL 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L FL ++ S    +G+ G V G+M  F+ +A  +   +    PGI E+LI+  +GL 
Sbjct: 125 ERHLPFLATVGSTSPYIGLFGTVWGIMNSFRGLANVHQATLASVAPGISEALIATAIGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ IAYN++    +      E FA+EFS+IL R+   +
Sbjct: 185 AAIPAVIAYNRYSAQVEYLLGNYETFADEFSSILHRRMHAS 225


>gi|327481494|gb|AEA84804.1| TolQ protein [Pseudomonas stutzeri DSM 4166]
          Length = 230

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 111/219 (50%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+++L       V+ ++ +L   S+ SW +I Q+       +R    FE+ FWSG  L 
Sbjct: 8   MSMWSLISNASFVVQLVMLILVGASVTSWILIFQRGNMLRAAKRSLDAFEERFWSGIDLS 67

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +        + G+  IF +   E+ +   +    P  + D ++R M VAI+RE E++
Sbjct: 68  KLYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQQGVDPDAVMDGVNRAMRVAISREEEKL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL 
Sbjct: 128 EQSLPFLATVGSTSPYIGLFGTVWGIMNSFRGLAQVQQATLATVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 188 AAIPAVIAYNRFSARGEMLIGRYYTFADEFQAILHRKVH 226


>gi|89068043|ref|ZP_01155460.1| proton transporter TolQ [Oceanicola granulosus HTCC2516]
 gi|89046282|gb|EAR52339.1| proton transporter TolQ [Oceanicola granulosus HTCC2516]
          Length = 224

 Score =  170 bits (431), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 82/222 (36%), Positives = 123/222 (55%), Gaps = 1/222 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D S++ALF +  LAVK ++ LL   SI  W+VI+ K + +   R +   F++ FWSG
Sbjct: 3   AATDFSMWALFARATLAVKFVMILLIGASIWCWAVIVDKWLQYQRARAEAARFDRSFWSG 62

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           + L+ + + +          IF + M+EW++S  +      G Q RIDR MDVAIA+E  
Sbjct: 63  EPLDGLYEEIGPTPKGQSQKIFAAGMTEWRRSHRQDGGLIAGAQARIDRSMDVAIAKEAG 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L  L ++ S    +G+LG V G+M  F  IA   + N+  +   I E+L++  LG
Sbjct: 123 RLQRGLPVLATVGSTAPFIGLLGTVWGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           L  +IP+ I YNK   D+ +     E FA+EFS ILSRQ +G
Sbjct: 183 LLAAIPAVIFYNKLSADADRIVSGYEAFADEFSTILSRQLDG 224


>gi|114319407|ref|YP_741090.1| MotA/TolQ/ExbB proton channel [Alkalilimnicola ehrlichii MLHE-1]
 gi|114225801|gb|ABI55600.1| Cell division and transport-associated protein TolQ
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 235

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 115/221 (52%), Gaps = 3/221 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  L ++  L V+ ++ +L + S+ SW++I  K             FE+ FWSG +L
Sbjct: 4   ELSITHLVLEASLLVQLVMLILVLASVSSWALIFLKRATIRKAHDGAVHFEERFWSGGNL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + ++  H     L  IF S   E+ +   +   +P  + +   R M V+++RE+++
Sbjct: 64  AEIYRQIREPHPDHGGLERIFRSGFKEFTRMRKQTGTAPGTMVEASHRAMRVSLSREMDD 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    VG+ G V G+M  F+++       +    PGI E+LI+  LGL
Sbjct: 124 LERHLPFLATVGSVSPYVGLFGTVWGIMNSFRALGEMQQATLATVAPGIAEALIATALGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
             +IP+ IAYN++    ++   + E F  EF++IL R T G
Sbjct: 184 FAAIPAVIAYNQYANQVERLINRYETFVEEFTSILQRNTHG 224


>gi|332188251|ref|ZP_08389979.1| protein TolQ [Sphingomonas sp. S17]
 gi|332011750|gb|EGI53827.1| protein TolQ [Sphingomonas sp. S17]
          Length = 219

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 115/217 (52%), Gaps = 2/217 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S  ALF+Q    VK ++  L + SI +W++I+  S      ++    FE+ FW  + ++
Sbjct: 1   MSPVALFLQADWVVKFVMIGLLLASIWTWTIIVAFSRKLARTKKGMTRFERDFWKAEDID 60

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
                ++  + +  A +F + + EW++S   G     G ++R+   M  A+A E++++++
Sbjct: 61  -AFHRMEQDNELPSARVFSAGVQEWRRSTAGGHIDRDGTRERLATAMGSAVAGEIDKLSD 119

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L+ L ++ S    VG+ G V G+M  F  IA   ++++  +   I E+L +  +GL  +
Sbjct: 120 RLNVLATVGSVAPFVGLFGTVWGIMRSFTGIAQAQNSSLAVVAPGIAEALFATAIGLFAA 179

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           IP+ IAYN+F     K    +  FA+ F   LSRQ +
Sbjct: 180 IPAVIAYNRFSHGVNKVEASLNRFADGFHTTLSRQLD 216


>gi|90022177|ref|YP_528004.1| peptidase A8, signal peptidase II [Saccharophagus degradans 2-40]
 gi|89951777|gb|ABD81792.1| MotA/TolQ/ExbB proton channel [Saccharophagus degradans 2-40]
          Length = 231

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 68/225 (30%), Positives = 123/225 (54%), Gaps = 5/225 (2%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI++L +Q  + V+ ++ +LF+ S++SW +I+Q+ +     +  +++FE+ FWSG  L 
Sbjct: 6   LSIWSLIVQASVLVQIVMAILFLLSVVSWGLIVQRGLYQYHAKVAYKDFERQFWSGVDLT 65

Query: 71  TVCKS----LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            + +            G+  IF +   E+ +   +G+  P  I +   R M VA+ARE E
Sbjct: 66  QLYRQGNSKANRSATDGVENIFRAGFKEFTRLRQQGSTDPDAIMEGTQRTMRVAMAREEE 125

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
           ++   L FL S++S    +G+ G V G+M  F+ +A      +  +   I E+L++  +G
Sbjct: 126 KLEVFLPFLASVASVSPYIGLFGTVWGIMNSFRGLATESQATLALVAPGISEALVATAMG 185

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L  +IP+ +AYN+F  +++    + E FA EFSAIL RQ     +
Sbjct: 186 LFAAIPAVLAYNRFSSNAESLISRYETFAEEFSAILHRQVHSKSA 230


>gi|53720371|ref|YP_109357.1| putative TolQ transport transmembrane protein [Burkholderia
           pseudomallei K96243]
 gi|76811339|ref|YP_334625.1| tolQ protein [Burkholderia pseudomallei 1710b]
 gi|52210785|emb|CAH36769.1| putative TolQ transport transmembrane protein [Burkholderia
           pseudomallei K96243]
 gi|76580792|gb|ABA50267.1| tolQ protein [Burkholderia pseudomallei 1710b]
          Length = 262

 Score =  170 bits (430), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 72/222 (32%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 41  SQDLSIISLVLNASVLAQAVMGLLLVLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 100

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 101 DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPALLLDGARRAMRASFQREM 160

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 161 DVLESNLSFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 220

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 221 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 262


>gi|261252507|ref|ZP_05945080.1| MotA/TolQ/ExbB proton channel family protein [Vibrio orientalis CIP
           102891]
 gi|260935898|gb|EEX91887.1| MotA/TolQ/ExbB proton channel family protein [Vibrio orientalis CIP
           102891]
          Length = 232

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 114/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS+  LF+Q  L VK ++ +L   SI+SW++II++S       +    FE  FWSG  L
Sbjct: 4   DISMLDLFLQASLLVKMVMLILLGMSIVSWAMIIKRSKVLSQASKDAEAFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + ++ K   +       IF S  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  SVLYQNAKKRKDDLAGTEEIFYSGFTEFARLRKSNADSPDFIMEGTGRSMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F     K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRFSSKVGKLEHNYATFSEEFHSILHRQA 222


>gi|332530155|ref|ZP_08406104.1| transmembrane protein/ biopolymer transport [Hylemonella gracilis
           ATCC 19624]
 gi|332040425|gb|EGI76802.1| transmembrane protein/ biopolymer transport [Hylemonella gracilis
           ATCC 19624]
          Length = 231

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/225 (29%), Positives = 110/225 (48%), Gaps = 2/225 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D SI  L +     V+ ++ +L   SI SW+ I  K      +R    +FEQ FWSG 
Sbjct: 2   SQDFSIIQLVLHASWVVQAVMLILLCGSIASWAAIFSKHFGLKKVRASNEKFEQDFWSGA 61

Query: 68  SLETVCKSLKNHHNI-GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           +L T+        +   +  IF++ + E++K  ++       + D   R M  ++ RE++
Sbjct: 62  NLNTLYAQAAQKSDSGPMERIFVAGLREYQKLRERRVTDNSALLDGARRAMRASMQREMD 121

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   LSFL ++ S    +G+ G V G+M  F  +A      +    PGI E+L++  +G
Sbjct: 122 SVESNLSFLATVGSVSPYIGLFGTVWGIMHAFTGLASMQQVTLATVAPGIAEALVATAIG 181

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L  +IP+ +AYN+F  D  + A  +E F  EFS IL R   G  +
Sbjct: 182 LFAAIPAVVAYNRFARDIDRVANAVETFIEEFSNILQRNISGQQA 226


>gi|330811390|ref|YP_004355852.1| Proton channel family protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379498|gb|AEA70848.1| Proton channel family protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 231

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 113/218 (51%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++ +L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASVVVQLVMLILVAASVTSWIMIFQRSNMLRAGRRALESFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPEAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + LSFL ++ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +GL  
Sbjct: 130 QGLSFLATVGSVSPYIGLFGTVWGIMNSFRGLASAQQATLATVAPGIAEALVATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARSEALTSRYYTFADEFQAILHRKVH 227


>gi|254436624|ref|ZP_05050118.1| protein TolQ [Octadecabacter antarcticus 307]
 gi|198252070|gb|EDY76384.1| protein TolQ [Octadecabacter antarcticus 307]
          Length = 248

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 117/221 (52%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D +++ALF +  + V+ ++ +L   SI  W+V I K+V +   R +   F++ FWSG
Sbjct: 27  AAQDFTMWALFTRATILVQLVMIMLVAASIWCWAVFIDKTVQYRKARAEADAFDRSFWSG 86

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           + L+ +   +          IF S M EW++S  +          RI+  MDV IA++  
Sbjct: 87  EPLDALFGKIGAEPQGSTEKIFASGMLEWRRSHREDGGLIPDSTARINTSMDVTIAKQSS 146

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
           ++ + L  L ++ S    VG+ G V G+M  F  I+   + N+  +   I E+L+S  +G
Sbjct: 147 KLQKGLPILATVGSTAPFVGLFGTVWGIMNAFIEISQAQTTNLAVVAPGIAEALMSTGIG 206

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I YNK   DS++     E FA+EF+ ILSRQ E
Sbjct: 207 LLAAIPAVIIYNKLSTDSEQIVSGYEAFADEFANILSRQVE 247


>gi|330502222|ref|YP_004379091.1| MotA/TolQ/ExbB proton channel [Pseudomonas mendocina NK-01]
 gi|328916508|gb|AEB57339.1| MotA/TolQ/ExbB proton channel [Pseudomonas mendocina NK-01]
          Length = 231

 Score =  170 bits (429), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+++L     L V+ ++  L   S++SW +I Q+S      +R    FE  FWSG  L 
Sbjct: 9   MSMWSLISNASLVVQLVMLTLVAASVISWVMIFQRSNALRAAKRALDNFEDRFWSGIDLS 68

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +        + GL  IF +   E+ +   +    P  + D + R M VAI+RE E++
Sbjct: 69  KLYRQAGSNPDPDSGLEQIFRAGFKEFSRLRQQQGVDPDAVMDGVARAMRVAISREEEKL 128

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL 
Sbjct: 129 ETALPFLATVGSTSPYIGLFGTVWGIMNSFRGLAQVQQATLATVAPGIAEALIATAIGLF 188

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 189 AAIPAVIAYNRFSARGEMLIGRYYTFADEFQAILHRKVH 227


>gi|241662338|ref|YP_002980698.1| protein TolQ [Ralstonia pickettii 12D]
 gi|240864365|gb|ACS62026.1| protein TolQ [Ralstonia pickettii 12D]
          Length = 230

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 73/230 (31%), Positives = 118/230 (51%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 1   MNPVEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSC--DKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S     H    L  IF + M E+ K+    +G   P  I D   R 
Sbjct: 60  RDFWAGGDLQALYQSAANNRHTTGALERIFEAGMREYLKARELQRGGGDPSAILDASRRA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 120 MRAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 180 AEALVATAIGLFAAIPAVIAYNRYATEIDRLANRFESFMEEFSNILQRQT 229


>gi|83647599|ref|YP_436034.1| biopolymer transport protein [Hahella chejuensis KCTC 2396]
 gi|83635642|gb|ABC31609.1| Biopolymer transport protein [Hahella chejuensis KCTC 2396]
          Length = 227

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 71/223 (31%), Positives = 116/223 (52%), Gaps = 3/223 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI+AL       V+ ++ +L   SI+SW +I Q++  F   RR   +FE+ FWSG  L 
Sbjct: 5   LSIWALISNASFLVQIVMLILLAASIVSWMIIFQRARIFGLARRATTKFEERFWSGMDLN 64

Query: 71  TVCKS--LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +      + N G+  IF S   E+ +   +    P  + +   R M VA++RE++ +
Sbjct: 65  QLYRESSAAPNPNSGMEQIFRSGFKEFSRLRQQAGVDPDAVMEGTQRSMRVAMSREMDRL 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL 
Sbjct: 125 EAHLPFLATVGSTTPYIGLFGTVWGIMNSFRGLAHLQQATISTVAPGISEALIATAMGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ IAYN++   S+  A   + FA EFS+IL R+     S
Sbjct: 185 AAIPAVIAYNRYSARSESLANSFQTFAEEFSSILHRRVHAKSS 227


>gi|229592298|ref|YP_002874417.1| TolQ protein [Pseudomonas fluorescens SBW25]
 gi|229364164|emb|CAY51814.1| TolQ protein [Pseudomonas fluorescens SBW25]
          Length = 231

 Score =  169 bits (428), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASVVVQLVMLTLVAASVTSWVMIFQRSNLLRAGRRALESFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPEAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 QSLPFLATVGSVSPYIGLFGTVWGIMNSFRGLAQAQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAATSETLIGRYYTFADEFQAILHRKVH 227


>gi|309780837|ref|ZP_07675578.1| protein TolQ [Ralstonia sp. 5_7_47FAA]
 gi|308920519|gb|EFP66175.1| protein TolQ [Ralstonia sp. 5_7_47FAA]
          Length = 230

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 73/230 (31%), Positives = 118/230 (51%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 1   MNPVEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSC--DKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S     H    L  IF + M E+ K+    +G   P  I D   R 
Sbjct: 60  RDFWAGGDLQALYQSAANNRHTTGALERIFEAGMREYLKARELQRGGGDPSAILDASRRA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 120 MRAAYQREMDSLEPHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 180 AEALVATAIGLFAAIPAVIAYNRYATEIDRLANRFESFMEEFSNILQRQT 229


>gi|160897904|ref|YP_001563486.1| protein TolQ [Delftia acidovorans SPH-1]
 gi|160363488|gb|ABX35101.1| protein TolQ [Delftia acidovorans SPH-1]
          Length = 234

 Score =  169 bits (428), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L +Q    V+ ++ +L   S+ SW+ I +KS     +R     FEQ FWS
Sbjct: 1   MNSHDMSILSLVLQASWVVQLVMLILVGASVASWATIFRKSQTLKRVRSLNDGFEQDFWS 60

Query: 66  GQSLETVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S  +H      +  IF S M E++K  ++       + D   R M  +  R
Sbjct: 61  GTSLNDLYASAAHHAKQGGPMERIFASGMREYQKLRERRIADVNQLMDGTRRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++E+   LSFLG++ S    +G+ G V G+M  F   A      +    PGI E+L++ 
Sbjct: 121 EMDEVESGLSFLGTVGSVSPYIGLFGTVWGVMHAFTGFANMEQITLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
            +GL  +IP+  AYN++     + A Q E F  EFS IL R
Sbjct: 181 AMGLFAAIPAVTAYNRYAHQIDRVASQQETFIEEFSNILQR 221


>gi|49081978|gb|AAT50389.1| PA0969 [synthetic construct]
          Length = 232

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+       ++    FE+ FWSG  L  
Sbjct: 10  SMWSLISNASIVVQLVMLTLVAASVTSWIMIFQRGNAMRAAKKALDAFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPDAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 ASLPFLATVGSTSPYVGLFGTVWGIMNSFRGLATVQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFSARSEMLIGRYYTFADEFQAILHRKVH 227


>gi|27365497|ref|NP_761025.1| protein TolQ [Vibrio vulnificus CMCP6]
 gi|37680462|ref|NP_935071.1| tol biopolymer transport system, TolQ protein [Vibrio vulnificus
           YJ016]
 gi|320155879|ref|YP_004188258.1| motA/TolQ/ExbB proton channel family protein [Vibrio vulnificus
           MO6-24/O]
 gi|27361645|gb|AAO10552.1| protein TolQ [Vibrio vulnificus CMCP6]
 gi|37199210|dbj|BAC95042.1| tol biopolymer transport system, TolQ protein [Vibrio vulnificus
           YJ016]
 gi|319931191|gb|ADV86055.1| motA/TolQ/ExbB proton channel family protein [Vibrio vulnificus
           MO6-24/O]
          Length = 227

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 114/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   S++SW++II++S       +   EFE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSVVSWAMIIKRSKVLSKAAKDAEEFEDKFWSGIDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +   G   IF +  +E+ +       SP  + +   R M VA++RE++E
Sbjct: 64  SQLYQQIKARKDELSGTEEIFYAGFTEFARLRKTNPTSPDFVMEGTGRAMRVAVSREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSITPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F     K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRFASKVGKLEHNYSTFSEEFHSILHRQA 222


>gi|257465519|ref|ZP_05629890.1| colicin transport protein TolQ [Actinobacillus minor 202]
 gi|257451179|gb|EEV25222.1| colicin transport protein TolQ [Actinobacillus minor 202]
          Length = 226

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 110/217 (50%), Gaps = 3/217 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
             + +LF Q  + VK +I +L  FS+LSW++IIQ+S       +    FE  FWSG+ L 
Sbjct: 5   FDLVSLFAQASIVVKIVILILIAFSVLSWAIIIQRSRTLTKANKDSLAFEDKFWSGEDLN 64

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + + L+N  +   G   IF     E+ +  +    +P  I     R M++A+ RE+E +
Sbjct: 65  RLHEGLENRRDGLNGSEQIFYVGFKEFSRLQNANPEAPEAIIQGTSRAMNLALNREVEGL 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +GL 
Sbjct: 125 ESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +IP+ +AYN+      K       F +EF+ IL RQ
Sbjct: 185 AAIPAVMAYNRLNLRVNKLEQNYANFIDEFTTILHRQ 221


>gi|323495164|ref|ZP_08100249.1| hypothetical protein VIBR0546_08520 [Vibrio brasiliensis LMG 20546]
 gi|323310604|gb|EGA63783.1| hypothetical protein VIBR0546_08520 [Vibrio brasiliensis LMG 20546]
          Length = 231

 Score =  169 bits (427), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 114/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS+  LF+Q  L VK ++ +L   SI+SW++II++S       ++   FE  FWSG  L
Sbjct: 4   DISMLDLFLQASLLVKMVMLILLGMSIVSWAMIIKRSKVLSQASKEAETFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + ++ K   +       IF S  +E+ +     A SP  I +   R M VA+ARE+++
Sbjct: 64  SILYQNAKKRKDDLAGTEEIFYSGFTEFARLRKSNADSPDFIMEGTGRAMRVAVAREVDD 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVGKLEHNYATFSEEFHSILHRQA 222


>gi|319899379|ref|YP_004159476.1| tolQ protein [Bartonella clarridgeiae 73]
 gi|319403347|emb|CBI76906.1| tolQ protein [Bartonella clarridgeiae 73]
          Length = 238

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 85/221 (38%), Positives = 139/221 (62%), Gaps = 1/221 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I I  LFMQ    VK ++  L   SI SW++I+ K +++  +RR    FE+ FWSGQ LE
Sbjct: 13  IGILNLFMQANWIVKVVMIGLVFASIWSWAIILDKLISYRHIRRNIHHFERDFWSGQPLE 72

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  +  +  +  ++ +F++AM+EWKKS  KG+ +P+ +Q RID+ MD+A+ RE  +I  
Sbjct: 73  DLYATYNSQRSDSISVVFLAAMTEWKKSLSKGSHTPLSLQTRIDKAMDLALGRESVKIES 132

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L FL ++ SAG  +G+ G V+G+M  F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 133 RLGFLATLGSAGPFIGLFGTVVGIMNSFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 192

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           IP+ IAYNK I +S +   ++E F++EFS ILSR+ +   S
Sbjct: 193 IPAVIAYNKLISESAQIIAKIENFSDEFSTILSRRIDETTS 233


>gi|163733518|ref|ZP_02140961.1| putative proton transporter TolQ [Roseobacter litoralis Och 149]
 gi|161393306|gb|EDQ17632.1| putative proton transporter TolQ [Roseobacter litoralis Och 149]
          Length = 231

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 75/219 (34%), Positives = 122/219 (55%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S F LF +  + VK ++ +L + S  +WSVI+ K + +   R +   F++ FWSG+ 
Sbjct: 12  IDFSFFGLFARATIVVKLVMIMLIVASFWAWSVIVIKLILYRKTRHEAAVFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    + G   IF + M EW++S         G   RIDR MDVAI +E E +
Sbjct: 72  LDGLFEEVGPAPSGGTEKIFAAGMMEWQRSHHDDGGLIAGATQRIDRSMDVAINKESEHL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L+ L ++ S+   +G+ G V+G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 RDGLTVLATIGSSTPFIGLFGTVIGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLF 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   D+ +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIYYNKLSADADRILAGYESFADEFATILSRQLD 230


>gi|15596166|ref|NP_249660.1| TolQ protein [Pseudomonas aeruginosa PAO1]
 gi|107100425|ref|ZP_01364343.1| hypothetical protein PaerPA_01001450 [Pseudomonas aeruginosa PACS2]
 gi|116048894|ref|YP_792305.1| TolQ protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152986028|ref|YP_001349888.1| TolQ protein [Pseudomonas aeruginosa PA7]
 gi|218893060|ref|YP_002441929.1| TolQ protein [Pseudomonas aeruginosa LESB58]
 gi|254245252|ref|ZP_04938574.1| TolQ protein [Pseudomonas aeruginosa 2192]
 gi|296390672|ref|ZP_06880147.1| TolQ protein [Pseudomonas aeruginosa PAb1]
 gi|313105856|ref|ZP_07792119.1| TolQ protein [Pseudomonas aeruginosa 39016]
 gi|1729993|sp|P50598|TOLQ_PSEAE RecName: Full=Protein tolQ
 gi|9946876|gb|AAG04358.1|AE004530_11 TolQ protein [Pseudomonas aeruginosa PAO1]
 gi|1103860|gb|AAC44658.1| TolQ [Pseudomonas aeruginosa]
 gi|115584115|gb|ABJ10130.1| TolQ protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126198630|gb|EAZ62693.1| TolQ protein [Pseudomonas aeruginosa 2192]
 gi|150961186|gb|ABR83211.1| protein TolQ [Pseudomonas aeruginosa PA7]
 gi|218773288|emb|CAW29100.1| TolQ protein [Pseudomonas aeruginosa LESB58]
 gi|310878621|gb|EFQ37215.1| TolQ protein [Pseudomonas aeruginosa 39016]
          Length = 231

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+       ++    FE+ FWSG  L  
Sbjct: 10  SMWSLISNASIVVQLVMLTLVAASVTSWIMIFQRGNAMRAAKKALDAFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPDAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 ASLPFLATVGSTSPYVGLFGTVWGIMNSFRGLATVQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFSARSEMLIGRYYTFADEFQAILHRKVH 227


>gi|254506113|ref|ZP_05118257.1| protein TolQ [Vibrio parahaemolyticus 16]
 gi|219550931|gb|EED27912.1| protein TolQ [Vibrio parahaemolyticus 16]
          Length = 232

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS+  LF+Q  L VK ++  L   S++SW++II++S       +    FE  FWSG  L
Sbjct: 4   DISMLDLFLQASLLVKMVMLTLLGMSVVSWAMIIKRSKVLSQASKDADAFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + ++ K   +   G   IF S  +E+ +     + SP  I +   R M V++ARE++E
Sbjct: 64  SILYQNAKKRKDELSGTEEIFYSGFTEFARLRKSNSDSPDYIMEGTGRSMRVSVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHNYATFSEEFHSILHRQA 222


>gi|70732086|ref|YP_261842.1| tolQ protein [Pseudomonas fluorescens Pf-5]
 gi|68346385|gb|AAY93991.1| tolQ protein [Pseudomonas fluorescens Pf-5]
          Length = 231

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASVVVQLVMLTLVAASVTSWIMIFQRSNLLRAGRRALESFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPEAVMEGVARAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 QSLPFLATVGSVSPYIGLFGTVWGIMNSFRGLAQAQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARGETLISRYYTFADEFQAILHRKVH 227


>gi|152996213|ref|YP_001341048.1| Tol-Pal system TolQ [Marinomonas sp. MWYL1]
 gi|150837137|gb|ABR71113.1| Tol-Pal system TolQ [Marinomonas sp. MWYL1]
          Length = 226

 Score =  168 bits (426), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 109/219 (49%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI+ L       V+ ++ +L   SI SW VI Q+       ++    FE+ FWSG  L 
Sbjct: 1   MSIWGLIASASFVVQLVMLILLAASIFSWIVIFQRIRVLKEAKKVRTAFEESFWSGIDLS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + + L        G+  IF S + E+ +        P  I D + R M VA+ RE E++
Sbjct: 61  QLYRKLTQEGRKVEGMENIFTSGIKEFTRLRQSHNVDPEAIMDGVQRAMRVALYREEEKL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL 
Sbjct: 121 DQHLPFLATVGSTSPYIGLFGTVWGIMHSFIGLAEVQQATLATVAPGIAEALIATAIGLA 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ IAYN+F   ++      E FA+EF++IL R+  
Sbjct: 181 AAIPAVIAYNRFSSTAESLGSSYENFADEFTSILHRKVH 219


>gi|240948552|ref|ZP_04752925.1| colicin transport protein TolQ [Actinobacillus minor NM305]
 gi|240297060|gb|EER47631.1| colicin transport protein TolQ [Actinobacillus minor NM305]
          Length = 226

 Score =  168 bits (426), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 67/217 (30%), Positives = 110/217 (50%), Gaps = 3/217 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
             + +LF Q  + VK +I +L  FS+LSW++IIQ+S       +    FE  FWSG+ L 
Sbjct: 5   FDLVSLFAQASIVVKIVILILIAFSVLSWAIIIQRSRTLTKANKDSLAFEDKFWSGEDLN 64

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + + L+N  +   G   IF     E+ +  +    +P  I     R M++A+ RE+E +
Sbjct: 65  RLHEGLENRRDGLNGSEQIFYVGFKEFSRLQNANPEAPEAIIQGTSRAMNLALNREVEGL 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +GL 
Sbjct: 125 ESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +IP+ +AYN+      K       F +EF+ IL RQ
Sbjct: 185 AAIPAVMAYNRLNLRVNKLEQNYANFIDEFTTILHRQ 221


>gi|182677271|ref|YP_001831417.1| protein TolQ [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182633154|gb|ACB93928.1| protein TolQ [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 241

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 86/234 (36%), Positives = 140/234 (59%), Gaps = 6/234 (2%)

Query: 1   MNNYGLA-----IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQ 55
           MN   LA     + ++S+F++F    + VK ++  L   SI  W++I+ K + F  + R 
Sbjct: 1   MNPADLASAAAPVTEVSLFSMFWSAHIIVKIVMLGLLGSSIWCWAIIVNKVLLFSKVDRD 60

Query: 56  FREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDR 115
              FE +FWSG SL+ +  +L      G+A++F++ M EWK+S    A S +G+Q RI++
Sbjct: 61  MARFEDIFWSGTSLDELYATLSAKPVSGMASLFVAGMREWKRSMQGAAHSFLGLQARIEK 120

Query: 116 MMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG- 174
            +DV+IARE+E+    L  L +++SAG  VG+ G V G+M  F+SIA   + ++  +   
Sbjct: 121 ALDVSIAREVEKYESSLLVLATVASAGPFVGLFGTVWGIMTAFRSIAASKNTSLAVVAPG 180

Query: 175 IIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           I E+L +  +GL  +IP+ IAYNK   D  +   ++E FA+EFS+ILSRQ + +
Sbjct: 181 IAEALFATAIGLFAAIPALIAYNKLQNDVARKQAKLESFADEFSSILSRQIDQH 234


>gi|146283141|ref|YP_001173294.1| TolQ protein [Pseudomonas stutzeri A1501]
 gi|145571346|gb|ABP80452.1| TolQ protein [Pseudomonas stutzeri A1501]
          Length = 221

 Score =  168 bits (425), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 109/217 (50%), Gaps = 3/217 (1%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
           +++L       V+ ++ +L   S+ SW +I Q+       +R    FE+ FWSG  L  +
Sbjct: 1   MWSLISNASFVVQLVMLILVGASVTSWILIFQRGNMLRAAKRSLDAFEERFWSGIDLSKL 60

Query: 73  CKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +        + G+  IF +   E+ +   +    P  + D ++R M VAI+RE E++ +
Sbjct: 61  YRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQQGVDPDAVMDGVNRAMRVAISREEEKLEQ 120

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVS 189
            L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL  +
Sbjct: 121 SLPFLATVGSTSPYIGLFGTVWGIMNSFRGLAQVQQATLATVAPGIAEALIATAIGLFAA 180

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 181 IPAVIAYNRFSARGEMLIGRYYTFADEFQAILHRKVH 217


>gi|26987954|ref|NP_743379.1| biopolymer transport protein TolQ [Pseudomonas putida KT2440]
 gi|148546491|ref|YP_001266593.1| Tol-Pal system, TolQ [Pseudomonas putida F1]
 gi|167035192|ref|YP_001670423.1| protein TolQ [Pseudomonas putida GB-1]
 gi|170723157|ref|YP_001750845.1| protein TolQ [Pseudomonas putida W619]
 gi|24982667|gb|AAN66843.1|AE016313_2 biopolymer transport protein TolQ [Pseudomonas putida KT2440]
 gi|5514776|emb|CAB50778.1| TolQ protein [Pseudomonas putida]
 gi|148510549|gb|ABQ77409.1| Tol-Pal system, TolQ [Pseudomonas putida F1]
 gi|166861680|gb|ABZ00088.1| protein TolQ [Pseudomonas putida GB-1]
 gi|169761160|gb|ACA74476.1| protein TolQ [Pseudomonas putida W619]
 gi|313497570|gb|ADR58936.1| TolQ [Pseudomonas putida BIRD-1]
          Length = 231

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASVVVQLVMLTLVAASVTSWIMIFQRSTMLRAGRRALDAFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  +F +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQVFRAGFKEFSRLRQQPGVDPDAVMEGVGRAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 QSLPFLATVGSTSPYIGLFGTVWGIMNSFRGLASAQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARSEVLIGRYYTFADEFQAILHRKVH 227


>gi|260912910|ref|ZP_05919395.1| TolQ colicin import protein [Pasteurella dagmatis ATCC 43325]
 gi|260632900|gb|EEX51066.1| TolQ colicin import protein [Pasteurella dagmatis ATCC 43325]
          Length = 229

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 68/224 (30%), Positives = 117/224 (52%), Gaps = 3/224 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D++   LF++  + V+ +I +L IFSI+SW++IIQ+S       +    FE  FWSG+ L
Sbjct: 4   DLNFLELFLKASIVVQLVIVILLIFSIMSWAIIIQRSRVLTRALKDSAAFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L+N  +   G   IF     E+ +       +P  I     R M++A+ RE+E+
Sbjct: 64  NRLYEGLENRRDGLSGSEQIFYVGFKEFSRLKQANPDAPESIIQGSTRAMNLAMNREVED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ +AYN+      K       F +EF+ IL RQ  G  S
Sbjct: 184 FAAIPAVMAYNRLSLRVNKLEQNYGNFIDEFTTILHRQVFGRNS 227


>gi|71083299|ref|YP_266018.1| inner membrane protein TolQ [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|71062412|gb|AAZ21415.1| inner membrane protein TolQ [Candidatus Pelagibacter ubique
           HTCC1062]
          Length = 224

 Score =  168 bits (425), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 74/222 (33%), Positives = 122/222 (54%), Gaps = 7/222 (3%)

Query: 2   NNYGLAI-MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
              GLA   D S+++LF++    VK +I +L   SI SW+VII+K   F  +  +  EFE
Sbjct: 8   QAVGLASNTDFSLWSLFLRADFIVKSVILMLIGCSIYSWAVIIEKFRLFKKINLESEEFE 67

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
           + FW  +S E+   SL        A +F   M    K     A+S   + +RI  +++V 
Sbjct: 68  EKFWKSKSAESFYNSLPADVENPTALLFKDTMQSLLK-----AKSKTNLNERIASILEVN 122

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
           I +++ +I +  +FL ++ S    +G+ G V G+M  FQSIA   + ++  +   I E+L
Sbjct: 123 IEKQISKIDKGFTFLATVGSTAPFIGLFGTVWGIMNSFQSIAISRNTSLAIVAPGIAEAL 182

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            +  LGL  +IP+ +AYNKF  DSKK++ ++E F+  F +I+
Sbjct: 183 FATALGLLAAIPAVVAYNKFNNDSKKYSQRLENFSKRFLSII 224


>gi|149192084|ref|ZP_01870308.1| TolQ protein [Vibrio shilonii AK1]
 gi|148834070|gb|EDL51083.1| TolQ protein [Vibrio shilonii AK1]
          Length = 228

 Score =  168 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   L ++  L V+ ++ +L   S++SW++II++S       +   EFE  FWSG  L
Sbjct: 4   DISFVDLILEASLLVQLVMLILLGMSVVSWAMIIKRSKVLKQATKDSDEFEDKFWSGADL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +   G   IF S  +E+ +     A SP  I +   R M VA++RE+E+
Sbjct: 64  SQIYQDVKKRKDDLSGTEEIFYSGFTEFLRLRKSNAESPAFIMEGTGRSMRVAVSREVED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVGKLEHNYATFSEEFHSILHRQA 222


>gi|126728383|ref|ZP_01744199.1| proton transporter TolQ [Sagittula stellata E-37]
 gi|126711348|gb|EBA10398.1| proton transporter TolQ [Sagittula stellata E-37]
          Length = 231

 Score =  168 bits (424), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 80/219 (36%), Positives = 124/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S +ALF +  L VK ++ +L   SI SW++II+K V++   RR+   F+++FWSG+ 
Sbjct: 12  IDFSFWALFARATLTVKLVMIMLIAASIWSWAIIIEKFVSYRKARREASRFDRMFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   L          +F + M EW++S  +        Q RIDR MDVAI +E +E+
Sbjct: 72  LDELFDQLGPEPKGRSERVFAAGMIEWRRSHREDGALIANAQSRIDRSMDVAIQKEADEL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F  IA   + ++V +   I E+L++  LGL 
Sbjct: 132 QRGLPVLATVGSTSPFIGLFGTVFGIMHAFVQIAETQNTSLVVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNKF  D+ +     E FA+EFS ILSRQ +
Sbjct: 192 AAIPAVIFYNKFSADADRIVGNYEAFADEFSTILSRQLD 230


>gi|153832499|ref|ZP_01985166.1| protein TolQ [Vibrio harveyi HY01]
 gi|156973897|ref|YP_001444804.1| hypothetical protein VIBHAR_01607 [Vibrio harveyi ATCC BAA-1116]
 gi|148871294|gb|EDL70166.1| protein TolQ [Vibrio harveyi HY01]
 gi|156525491|gb|ABU70577.1| hypothetical protein VIBHAR_01607 [Vibrio harveyi ATCC BAA-1116]
          Length = 232

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 111/219 (50%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   SI SW++II++S       +    FE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSIASWAMIIKRSKVLSQASKDAESFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +       IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  SQLYQKVKGRKDDITGTEEIFYAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHSILHRQA 222


>gi|312882594|ref|ZP_07742334.1| hypothetical protein VIBC2010_09537 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309369754|gb|EFP97266.1| hypothetical protein VIBC2010_09537 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 232

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 110/222 (49%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D S+  L ++    V+ ++ +L   S++SW++II++S       +    FE  FWSG  L
Sbjct: 4   DTSMLDLILKASFLVQLVMMILLGMSVISWAMIIKRSKVLSKAAKDADSFEDKFWSGADL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + ++ K   +  +    IF S  +E+ +     + SP  + +   R M VA+ARE+++
Sbjct: 64  SILYQNAKKRKDDLMGTEEIFYSGFTEFARLRKSNSDSPDFVMEGTGRAMRVAVAREVDD 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F  +       +    PGI E+LI+  +GL
Sbjct: 124 LEANLPFLATVGSISPYIGLFGTVWGIMHAFMELGQVKQATLATVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F+ EF +IL RQ   N
Sbjct: 184 FAAIPAVMAYNRLSNKVGKLEHNYATFSEEFHSILHRQAMAN 225


>gi|187927777|ref|YP_001898264.1| protein TolQ [Ralstonia pickettii 12J]
 gi|187724667|gb|ACD25832.1| protein TolQ [Ralstonia pickettii 12J]
          Length = 230

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 73/230 (31%), Positives = 118/230 (51%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 1   MNPVEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSC--DKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S     H    L  IF + M E+ K+    +G   P  I D   R 
Sbjct: 60  RDFWAGGDLQALYQSAANNRHTTGALERIFEAGMREYLKARELQRGGGDPSAILDASRRA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 120 MRAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 180 AEALVATAIGLFAAIPAVIAYNRYATEMDRLANRFESFMEEFSNILQRQT 229


>gi|104783070|ref|YP_609568.1| biopolymer transport protein TolQ [Pseudomonas entomophila L48]
 gi|95112057|emb|CAK16784.1| biopolymer transport protein TolQ [Pseudomonas entomophila L48]
          Length = 231

 Score =  168 bits (424), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVANASVVVQLVMLTLVAASVTSWIMIFQRSTMLRAGRRALDAFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  +F +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQVFRAGFKEFSRLRQQPGVDPDAVMEGVGRAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +GL  
Sbjct: 130 QSLPFLATVGSTSPYIGLFGTVWGIMNSFRGLASAQQATLATVAPGIAEALVATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARSEVLIGRYYTFADEFQAILHRKVH 227


>gi|71909665|ref|YP_287252.1| MotA/TolQ/ExbB proton channel [Dechloromonas aromatica RCB]
 gi|71849286|gb|AAZ48782.1| Cell division and transport-associated protein TolQ [Dechloromonas
           aromatica RCB]
          Length = 225

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 106/220 (48%), Gaps = 3/220 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI  L +Q    V+ ++ LL   S +SW  I  K  +    R +   FE+ FWSG 
Sbjct: 4   TQDLSILHLILQASAVVQAVMALLAGVSFMSWYYIFMKLFSVKQARSKTETFERDFWSGG 63

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  +  S     HH   +  IF +   E+ K   +    P  I D   R M     RE+
Sbjct: 64  DLNNLYNSAVNDRHHAGSMERIFEAGFREFTKLKGQKNLDPKDIVDGSRRAMRATYQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL S+ S    +G+ G V G+M  F+ ++      +    PGI E+L++  +
Sbjct: 124 DALESHLSFLASVGSVSPYIGLFGTVWGIMHAFRGLSNVGQATLASVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           GL  +IP+ +AYN+F  D  + A + E F  EFS IL RQ
Sbjct: 184 GLFAAIPAVLAYNRFSHDIDRLATRYESFMEEFSNILQRQ 223


>gi|91227607|ref|ZP_01261911.1| TolQ protein [Vibrio alginolyticus 12G01]
 gi|269967689|ref|ZP_06181739.1| tolQ protein [Vibrio alginolyticus 40B]
 gi|91188500|gb|EAS74793.1| TolQ protein [Vibrio alginolyticus 12G01]
 gi|269827776|gb|EEZ82060.1| tolQ protein [Vibrio alginolyticus 40B]
          Length = 232

 Score =  167 bits (423), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   SI+SW++II++S       +   +FE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSIVSWAMIIKRSKVLSQASKNAEQFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +       IF +  +E+ +     A SP  I +   R M VA++RE++E
Sbjct: 64  SQLYQKVKARKDEIEGTEEIFYAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVSREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHSILHRQA 222


>gi|323138234|ref|ZP_08073306.1| protein TolQ [Methylocystis sp. ATCC 49242]
 gi|322396486|gb|EFX99015.1| protein TolQ [Methylocystis sp. ATCC 49242]
          Length = 247

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 89/223 (39%), Positives = 142/223 (63%), Gaps = 2/223 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DI+I+++F    + VK ++  L + S+  W++II K++ F  +RR    FE+ FWSG SL
Sbjct: 17  DITIWSMFWGAHIVVKFVMVGLLLASVWCWAIIIDKTLLFSRMRRAMDRFEESFWSGNSL 76

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSP-IGIQDRIDRMMDVAIARELEEI 128
           E +   L      G+A +F++AM EWK+S   GA +  +G+Q RI++++DV+IARE+E++
Sbjct: 77  EELYGKLSERPTTGMATLFVAAMREWKRSFQSGASASFMGLQARIEKVLDVSIAREVEKL 136

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L +++SAG  VG+ G V G+M  F+SIA   + ++  +   I E+L++  +GL 
Sbjct: 137 ESNLLVLATVASAGPFVGLFGTVWGIMTSFRSIAASKNTSLAVVAPGIAEALLATAIGLF 196

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ IAYNK   D  K   +ME FA+EFSAILSRQ + + +
Sbjct: 197 AAIPALIAYNKMQGDVAKAQARMESFADEFSAILSRQIDQHAA 239


>gi|256823068|ref|YP_003147031.1| protein TolQ [Kangiella koreensis DSM 16069]
 gi|256796607|gb|ACV27263.1| protein TolQ [Kangiella koreensis DSM 16069]
          Length = 237

 Score =  167 bits (423), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 117/219 (53%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  LF+   + V+ I+ LL + S++SW++I Q+S    +  R+ ++FE  FWSG  L 
Sbjct: 18  MSIANLFLHASIPVQAIMVLLLVISVISWAMIFQRSSVLNSASRESKKFEDRFWSGIDLG 77

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +   L        GL ++F +   E+ +   +   SP  + D   R M VA +RE+E++
Sbjct: 78  KLSTDLSQRQKPVTGLESLFQAGYREFMRLRQQSGVSPEAVMDGTHRAMRVAHSREVEKL 137

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              LSFL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL 
Sbjct: 138 ERNLSFLATVGSVTPYIGLFGTVWGIMNSFIALGAVKQATLAMVAPGIAEALIATAMGLF 197

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ IAYN+F    ++   Q E F  EFS +L R+  
Sbjct: 198 AAIPAVIAYNRFTNRLQRIETQYENFLEEFSGVLHRKAH 236


>gi|77460626|ref|YP_350133.1| MotA/TolQ/ExbB proton channel [Pseudomonas fluorescens Pf0-1]
 gi|77384629|gb|ABA76142.1| Cell division and transport-associated protein TolQ [Pseudomonas
           fluorescens Pf0-1]
          Length = 221

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/217 (30%), Positives = 110/217 (50%), Gaps = 3/217 (1%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
           +++L     + V+ ++  L   S+ SW +I Q+S      RR    FE+ FWSG  L  +
Sbjct: 1   MWSLVSNASIVVQLVMLTLVAASVTSWIMIFQRSNLIRAGRRALESFEERFWSGIDLSKL 60

Query: 73  CKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +        + G+  IF +   E+ +   +    P  + + + R M VAI+RE E++ +
Sbjct: 61  YRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPEAVMEGVARAMRVAISREEEKLEQ 120

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVS 189
            L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL  +
Sbjct: 121 SLPFLATVGSVSPYIGLFGTVWGIMNSFRGLASAQQATLATVAPGIAEALIATAIGLFAA 180

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 181 IPAVIAYNRFSARSETLLSRYYTFADEFQAILHRKVH 217


>gi|121998993|ref|YP_001003780.1| MotA/TolQ/ExbB proton channel [Halorhodospira halophila SL1]
 gi|121590398|gb|ABM62978.1| Cell division and transport-associated protein TolQ [Halorhodospira
           halophila SL1]
          Length = 232

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 66/222 (29%), Positives = 115/222 (51%), Gaps = 4/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+  L +   L V+ ++  L + S+ SW++I+ K +      +    FE+ FW+G +L
Sbjct: 4   DVSVLRLILDASLLVQAVMLSLILASVTSWALILSKRLTLKRAEQTAIRFEEEFWAGGNL 63

Query: 70  ETVCKSL---KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
             + + L       + G+  IF +   E+ +   +    P  + +   R M V+++REL+
Sbjct: 64  AEIYRRLSDEGPGEHAGMERIFRAGFQEFSRMRKQSGAPPSAVVEAAHRAMRVSVSRELD 123

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
                L FL ++ S    VG+ G V G+M  F+++AG     +    PGI E+LI+  LG
Sbjct: 124 NAERHLQFLATVGSVSPYVGLFGTVWGIMNSFRALAGQQQATLATVAPGIAEALIATALG 183

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           L  +IP+ IAYN +   +++ A + E F  EF++IL R T  
Sbjct: 184 LFAAIPAVIAYNHYANRAERLANRYETFVEEFTSILERHTHA 225


>gi|325274577|ref|ZP_08140635.1| protein TolQ [Pseudomonas sp. TJI-51]
 gi|324100304|gb|EGB98092.1| protein TolQ [Pseudomonas sp. TJI-51]
          Length = 231

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+S      RR    FE+ FWSG  L  
Sbjct: 10  SMWSLVSNASVVVQLVMLTLVAASVTSWIMIFQRSAMLRAGRRALDAFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  +F +   E+ +   +    P  + + + R M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQVFRAGFKEFSRLRQQPGVDPDAVMEGVGRAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +GL  
Sbjct: 130 QSLPFLATVGSTSPYIGLFGTVWGIMNSFRGLASAQQATLATVAPGIAEALVATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFAARSEVLIGRYYTFADEFQAILHRKVH 227


>gi|260900757|ref|ZP_05909152.1| protein TolQ [Vibrio parahaemolyticus AQ4037]
 gi|308110199|gb|EFO47739.1| protein TolQ [Vibrio parahaemolyticus AQ4037]
 gi|328473196|gb|EGF44044.1| TolQ protein [Vibrio parahaemolyticus 10329]
          Length = 232

 Score =  167 bits (423), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 112/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   SI SW++II++S       +   +FE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSIASWAMIIKRSKVLSQASKNAEQFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +       IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  SQLYQKVKGRKDEIAGTEEIFYAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHSILHRQA 222


>gi|146306306|ref|YP_001186771.1| MotA/TolQ/ExbB proton channel [Pseudomonas mendocina ymp]
 gi|145574507|gb|ABP84039.1| Cell division and transport-associated protein TolQ [Pseudomonas
           mendocina ymp]
          Length = 231

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+++L     L V+ ++  L   S++SW +I Q+S      +R    FE  FWSG  L 
Sbjct: 9   MSMWSLISNASLLVQLVMLTLVAASVISWVMIFQRSNAIRAAKRALDNFEDRFWSGIDLS 68

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +        + GL  IF +   E+ +   +    P  + D + R M VAI+RE E++
Sbjct: 69  KLYRQAGSNPDPDSGLEQIFRAGFKEFSRLRQQQGVDPDAVMDGVARAMRVAISREEEKL 128

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL 
Sbjct: 129 ETALPFLATVGSTSPYIGLFGTVWGIMNSFRGLAQVQQATLATVAPGIAEALIATAIGLF 188

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 189 AAIPAVIAYNRFSARGEMLIGRYYTFADEFQAILHRKVH 227


>gi|167855028|ref|ZP_02477802.1| colicin transport protein TolQ [Haemophilus parasuis 29755]
 gi|167853876|gb|EDS25116.1| colicin transport protein TolQ [Haemophilus parasuis 29755]
          Length = 226

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             + ++ +LFM+  + VK +I +L  FS+LSW+VIIQ+S      ++    FE  FWSG+
Sbjct: 2   ATEFNLVSLFMEASIVVKLVILILISFSVLSWAVIIQRSRVLTRAKKDSLNFEDRFWSGE 61

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + + L++  +   G   IF     E+ +       SP  I     R M++A+ REL
Sbjct: 62  DLHRLHEGLEHRRDGLTGAEHIFYVGFKEFNRLQQANPDSPESIIQGSSRAMNLALNREL 121

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           EE+   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +
Sbjct: 122 EELENYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAI 181

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K       F +EF+ IL RQ 
Sbjct: 182 GLFAAIPAVMAYNRLNLRVGKLEQNYVNFIDEFTTILHRQA 222


>gi|124268138|ref|YP_001022142.1| transmembrane protein/ biopolymer transport [Methylibium
           petroleiphilum PM1]
 gi|124260913|gb|ABM95907.1| transmembrane protein/ biopolymer transport [Methylibium
           petroleiphilum PM1]
          Length = 227

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 77/223 (34%), Positives = 113/223 (50%), Gaps = 3/223 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SIF L +   L V+ +I  L   S+ SW+VI  K      +R     FE+ FWS
Sbjct: 1   MNSQDLSIFQLVLHASLVVQLVIVALLAMSLASWTVIFGKLFGLKRVRALNEGFERDFWS 60

Query: 66  GQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           GQ+L+ +      K   +  +  IF S M E+ K  ++    P  + D   R M  +  R
Sbjct: 61  GQNLQDLYADAAKKADRSGPMTRIFASGMREFMKLRERRVADPGALLDGSRRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           EL+ +   LSFL S+ S    VG+ G V G+M  F  +A      +    PGI E+L++ 
Sbjct: 121 ELDTVESHLSFLASVGSVSPYVGLFGTVWGIMHAFTGLANLQQVTLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +GL  +IP+ +AYN+F  D  + A+QME F  EFS IL R  
Sbjct: 181 AIGLFAAIPAVLAYNRFARDIDRIAIQMETFIEEFSNILQRNI 223


>gi|91762271|ref|ZP_01264236.1| inner membrane protein TolQ [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718073|gb|EAS84723.1| inner membrane protein TolQ [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 224

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 73/222 (32%), Positives = 122/222 (54%), Gaps = 7/222 (3%)

Query: 2   NNYGLAI-MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
              GLA   D S+++LF++    VK +I +L   SI SW+VII+K   F  +  +  EFE
Sbjct: 8   QAVGLASNTDFSLWSLFLRADFIVKSVILMLIGCSIYSWAVIIEKFRLFKKINLESEEFE 67

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
           + FW  +S E+   SL        A +F   M    K     A+S   + +R+  +++V 
Sbjct: 68  EKFWKSKSAESFYNSLPADVENPTALLFKDTMQSLLK-----AKSKTNLNERMASILEVN 122

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
           I +++ +I +  +FL ++ S    +G+ G V G+M  FQSIA   + ++  +   I E+L
Sbjct: 123 IEKQISKIDKGFTFLATVGSTAPFIGLFGTVWGIMNSFQSIAISRNTSLAIVAPGIAEAL 182

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            +  LGL  +IP+ +AYNKF  DSKK++ ++E F+  F +I+
Sbjct: 183 FATALGLLAAIPAVVAYNKFNNDSKKYSQRLENFSKRFLSII 224


>gi|110679373|ref|YP_682380.1| putative proton transporter TolQ [Roseobacter denitrificans OCh
           114]
 gi|109455489|gb|ABG31694.1| putative proton transporter TolQ [Roseobacter denitrificans OCh
           114]
          Length = 231

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 76/219 (34%), Positives = 122/219 (55%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S F LF +  L VK ++ +L + S  +WSVI+ K + +   R +   F++ FWSG+ 
Sbjct: 12  IDFSFFGLFARATLIVKIVMIMLIVASFWAWSVIVIKLILYRKTRHEAAVFDRAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    + G   IF + M EW++S         G   RIDR MDVAI +E E +
Sbjct: 72  LDGLFEEVGPAPSGGTEKIFAAGMMEWQRSHHDDGGLIAGATQRIDRSMDVAINKEAEHL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L+ L ++ S+   +G+ G V+G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 RDGLTVLATIGSSTPFIGLFGTVIGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLF 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   D+ +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIYYNKLSADADRILAGYESFADEFATILSRQLD 230


>gi|117923785|ref|YP_864402.1| MotA/TolQ/ExbB proton channel [Magnetococcus sp. MC-1]
 gi|117607541|gb|ABK42996.1| Cell division and transport-associated protein TolQ [Magnetococcus
           sp. MC-1]
          Length = 230

 Score =  167 bits (422), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 116/222 (52%), Gaps = 5/222 (2%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+F L  Q G  V+ ++  L   S++SW++I  K   +  + +    FE+ FWSG S+ +
Sbjct: 5   SVFDLITQAGPLVQLVMLALLAASVVSWAIIFDKWRRYRRITQDAEAFEERFWSGGSVAS 64

Query: 72  VCKSL-KNHHNIGLAAIFMSAMSEWKKS---CDKGARSPIGIQDRIDRMMDVAIARELEE 127
           + +S  K   +  +  +F +   EWK+              +   + R M VA+ RELE 
Sbjct: 65  LFQSATKEWPDSPMVVMFSAGFREWKRWESNEPTSEGDGGDLVTNVRRAMTVALNRELEN 124

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + + L+FL ++ S    VG+ G V G+M  F  + G  ++ + +  PGI E+LI+  +GL
Sbjct: 125 LEKGLTFLATVGSTSPFVGLFGTVWGIMNAFLGLTGAKASTLTMVAPGIAEALIATAMGL 184

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IPS IAYNK+  + ++   +M+ F  EF  IL R++   
Sbjct: 185 VAAIPSVIAYNKYSSEMRRLHAKMDNFGAEFLNILERRSASR 226


>gi|94501017|ref|ZP_01307541.1| Biopolymer transport protein [Oceanobacter sp. RED65]
 gi|94426764|gb|EAT11748.1| Biopolymer transport protein [Oceanobacter sp. RED65]
          Length = 231

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 63/216 (29%), Positives = 103/216 (47%), Gaps = 3/216 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI++L       V+ ++ +L     +SW++IIQ+      ++  + +FE  FWSG  L 
Sbjct: 5   MSIWSLIANASWVVQGVMLVLVAAVFISWTIIIQRHRLLTAVKDGYEDFEDRFWSGMDLS 64

Query: 71  TVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
            + K +        +  IF +   E+ +   +G   P  I     R M VA  +E E + 
Sbjct: 65  QLYKEINQEPPAFGVENIFAAGFREFSRLRQQGG-DPEAIIQGTQRAMRVATTKEAELLE 123

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
             L FL ++ S    VG+ G V G+M  F+ +A      +  +   I E+LI+  +GL  
Sbjct: 124 NHLPFLATVGSTSPYVGLFGTVWGIMNSFRGLANVQQATLAVVAPGIAEALIATAIGLFA 183

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           +IP+ I YN+F     +     E FA EF +IL RQ
Sbjct: 184 AIPAVIFYNRFTTKVDQITSHYETFAEEFISILHRQ 219


>gi|307826392|ref|ZP_07656594.1| protein TolQ [Methylobacter tundripaludum SV96]
 gi|307732569|gb|EFO03444.1| protein TolQ [Methylobacter tundripaludum SV96]
          Length = 225

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 108/221 (48%), Gaps = 3/221 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SIF L  +    V+ ++ +L   S+ SW+ I  K            EFE+ FWSG  
Sbjct: 3   TDLSIFHLVKEASFVVQFVMLILLSASVSSWTFIFSKRKELNRAIEITDEFEEQFWSGVV 62

Query: 69  LETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L  K+    G+  IF++   E+ +    G   P    +   R+M + ++RELE
Sbjct: 63  LAELYRKLAAKDFEPEGIEKIFLAGYKEFSRMRQAGNVEPGVQVESAQRVMRIELSRELE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            + E L+FL ++ S    +G+ G V G+M  F S+       +    PGI E+LI+  +G
Sbjct: 123 RLDEHLAFLATVGSISPYIGLFGTVWGIMNSFMSLGNVKQATLAQVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I+YN+F     +   + E F  EF  +L RQ  
Sbjct: 183 LFAAIPAVISYNRFSTRLDRLTGRYELFVEEFVVLLQRQAH 223


>gi|28897831|ref|NP_797436.1| TolQ protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260361762|ref|ZP_05774787.1| protein TolQ [Vibrio parahaemolyticus K5030]
 gi|260876991|ref|ZP_05889346.1| protein TolQ [Vibrio parahaemolyticus AN-5034]
 gi|260899062|ref|ZP_05907503.1| protein TolQ [Vibrio parahaemolyticus Peru-466]
 gi|28806044|dbj|BAC59320.1| TolQ protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308089139|gb|EFO38834.1| protein TolQ [Vibrio parahaemolyticus Peru-466]
 gi|308093873|gb|EFO43568.1| protein TolQ [Vibrio parahaemolyticus AN-5034]
 gi|308113252|gb|EFO50792.1| protein TolQ [Vibrio parahaemolyticus K5030]
          Length = 232

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 112/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   SI SW++II++S       +   +FE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSIASWAMIIKRSKVLSQASKNAEQFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +       IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  SQLYQKVKGRKDEIAGTEEIFFAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHSILHRQA 222


>gi|296117352|ref|ZP_06835942.1| protein TolQ [Gluconacetobacter hansenii ATCC 23769]
 gi|295976118|gb|EFG82906.1| protein TolQ [Gluconacetobacter hansenii ATCC 23769]
          Length = 254

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/220 (33%), Positives = 124/220 (56%), Gaps = 3/220 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++LF+Q  + VK ++  L + S++ W++I  K V    + RQ  +FE+ FW+G SLE 
Sbjct: 34  SLWSLFLQAAIVVKLVMMGLVVSSVIVWAIIFDKIVTIRRVNRQASDFEERFWAGGSLED 93

Query: 72  VCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEIT 129
           + +S        +AA+F +AM EW++S           G+QDR++R M + I RE++ + 
Sbjct: 94  LYESDGAKPIHPMAAVFGAAMGEWRRSSRITGIDLVHGGVQDRVNRAMSITITREMDRLN 153

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
             L F+ ++      +G+ G V G+M  F SIA  ++ N+  +   I E+L +  +GL  
Sbjct: 154 RWLIFVATIGPVAPFIGLFGTVWGIMHAFGSIAAMHNTNLSVVAPGISEALFATAIGLVT 213

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ IAYN        F  +++ F  EF+AILSRQ+E  
Sbjct: 214 AIPAVIAYNVIGNSLGVFEDRLDAFGTEFAAILSRQSEER 253


>gi|91776694|ref|YP_546450.1| MotA/TolQ/ExbB proton channel [Methylobacillus flagellatus KT]
 gi|91710681|gb|ABE50609.1| Cell division and transport-associated protein TolQ
           [Methylobacillus flagellatus KT]
          Length = 224

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/228 (28%), Positives = 115/228 (50%), Gaps = 7/228 (3%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN       D+S  +L     + V+ ++ LL + S++SW  I  K  +  +   +  EFE
Sbjct: 1   MNP----TEDMSFISLISGASVPVQIVMALLLLTSLISWWYIFIKFFSIRSADNEAEEFE 56

Query: 61  QLFWSGQSLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           ++FW G  L  + +S+ +       LA+IF +   E+ +   + +     + +   R M 
Sbjct: 57  RVFWKGGDLNQLYESVTSGRRSTQGLASIFEAGFKEYARLKRQPSLDVGDVTEGARRAMR 116

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A  RE++E+   L FL S+ S    +G+ G V G+M  F+ +A      +    PGI E
Sbjct: 117 AAYNREMDELDSHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLANMAQATLSHVAPGIAE 176

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +L++  +GL  +IP+ IAYN+F   + + A++ E F  EF+ IL R+ 
Sbjct: 177 ALVATAIGLFAAIPAVIAYNRFTASADRLAVRYESFIEEFTNILQRKA 224


>gi|269963135|ref|ZP_06177470.1| tolQ protein [Vibrio harveyi 1DA3]
 gi|269832099|gb|EEZ86223.1| tolQ protein [Vibrio harveyi 1DA3]
          Length = 232

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   SI SW++II++S       +    FE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSIASWAMIIKRSKVLSQASKDAESFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K           IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  SQLYQKVKGRKEDITGTEEIFYAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHSILHRQA 222


>gi|260772524|ref|ZP_05881440.1| MotA/TolQ/ExbB proton channel family protein [Vibrio metschnikovii
           CIP 69.14]
 gi|260611663|gb|EEX36866.1| MotA/TolQ/ExbB proton channel family protein [Vibrio metschnikovii
           CIP 69.14]
          Length = 227

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 114/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS+  LF+Q  L VK ++ +L   S+ SW+VII++        RQ  EFE  FWSG  L
Sbjct: 4   DISMLDLFLQASLLVKLVMLILLAMSVASWAVIIKRHKALAQAERQAEEFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +   G   IF S  +E+ +     A +P  I +   R M V +ARE++E
Sbjct: 64  SILYQEVKKRKDTLEGTEEIFYSGFTEFARLHKSNANAPDYIMEGTGRTMRVTVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LEAHLPFLATVGSITPYIGLFGTVWGIMHAFIALGAVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F     K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVIAYNRFSSKVTKLEHIYATFSEEFHSILHRQA 222


>gi|217977107|ref|YP_002361254.1| protein TolQ [Methylocella silvestris BL2]
 gi|217502483|gb|ACK49892.1| protein TolQ [Methylocella silvestris BL2]
          Length = 248

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 84/243 (34%), Positives = 142/243 (58%), Gaps = 13/243 (5%)

Query: 1   MNNYGLAIM-----------DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNF 49
           MN   +A             ++S+ ++F    + VK ++  L   S+  W++II K +  
Sbjct: 1   MNPADIAATGVAATGFAQGSEVSLLSMFWSAHIVVKLVMLGLLAASVWCWAIIINKVILL 60

Query: 50  ITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSP-IG 108
              +R   +FE++FWSG SL+ +  +L      G+A++F++AM EW++S    A S  +G
Sbjct: 61  RRTQRAIDQFEEVFWSGASLDELYTTLSARPTSGMASLFVAAMREWRRSVQGAATSTFMG 120

Query: 109 IQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN 168
           +Q RI++++DV+IARE+E++   L  L +++SA   +G+ G V G+M  F+SIA   + +
Sbjct: 121 LQARIEKVLDVSIAREVEKLESNLLVLATVASASPFIGLFGTVWGIMSSFRSIAASRNTS 180

Query: 169 VVSIPG-IIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           +  +   I E+L +  +GL  +IP+ IAYNK   D  K   Q+EGFA+EFS+ILSRQ + 
Sbjct: 181 LAVVAPGIAEALFATAIGLFAAIPALIAYNKLQGDVAKKQAQLEGFADEFSSILSRQIDQ 240

Query: 228 NIS 230
             +
Sbjct: 241 RAA 243


>gi|257095748|ref|YP_003169389.1| protein TolQ [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257048272|gb|ACV37460.1| protein TolQ [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 225

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/220 (30%), Positives = 108/220 (49%), Gaps = 3/220 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI  L +     V+ ++ LL   S +SW  I +K       R Q  +FE+ FWSG 
Sbjct: 4   SQDLSILHLILNASAVVQAVMLLLAGVSFMSWYYIFRKWFTVKAARAQTEQFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L ++ +S  N  +    +  IF +   E+ K   +    P  + D   R M     RE+
Sbjct: 64  DLNSLYQSAINDRHSTGNMERIFEAGFREFTKLRSQKNLDPKDVIDGSRRAMRATYQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           + I   L+FL S+ S    VG+ G V G+M  F+ ++      + ++   I E+L++  +
Sbjct: 124 DSIDSHLAFLASVGSVSPYVGLFGTVWGIMHSFRGLSNVGQATLAAVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           GL  +IP+ +AYN+F  +  + + + E F  EFS IL RQ
Sbjct: 184 GLFAAIPAVVAYNRFAHEIDRLSSRFESFMEEFSNILQRQ 223


>gi|322514839|ref|ZP_08067858.1| TolQ colicin import protein [Actinobacillus ureae ATCC 25976]
 gi|322119221|gb|EFX91362.1| TolQ colicin import protein [Actinobacillus ureae ATCC 25976]
          Length = 226

 Score =  166 bits (421), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/220 (32%), Positives = 114/220 (51%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D ++ +LFMQ  + VK +I +L  FSILSW+VIIQ+S      ++    FE  FWSG+ 
Sbjct: 3   TDFNLVSLFMQASIVVKIVILILITFSILSWAVIIQRSRVLTAAKKDALAFENKFWSGED 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L+N  +   G   IF +   E+ +     A +P        R M++A+ RE+E
Sbjct: 63  LHRLHEGLENRRDGLSGSEQIFYAGFKEYMRLQQVNADAPEATMKGSSRAMNLALNREIE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +G
Sbjct: 123 NLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ +AYN+      K       F +EF+ IL RQ 
Sbjct: 183 LFAAIPAVMAYNRLSLRVNKLEQDYANFIDEFTTILHRQA 222


>gi|37525404|ref|NP_928748.1| colicin uptake protein TolQ [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36784832|emb|CAE13745.1| TolQ protein [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 231

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 112/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++ GL V+ I+ +L  FS+ SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKAGLLVQLIMLILICFSVASWAIIIQRTKILNAATRESEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  ++  +   G   IF S   E+ +       +P  +     R M +++ REL
Sbjct: 61  ELSRLYKESQSRRDSLGGTEQIFYSGFKEFARLHHANNHAPEAVITGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESLESHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFLAILHRQA 221


>gi|326795236|ref|YP_004313056.1| protein TolQ [Marinomonas mediterranea MMB-1]
 gi|326546000|gb|ADZ91220.1| protein TolQ [Marinomonas mediterranea MMB-1]
          Length = 226

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI+ L     + V+ ++  L + S+ SW VI Q+       +     FE+ FWSG  L 
Sbjct: 1   MSIWGLIASASIVVQLVMLTLLLASLFSWIVIFQRVRILKRAKVVRNRFEEQFWSGIDLS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + K L        G+  IF S + E+ +     +  P  + + + R M VA+ +E E++
Sbjct: 61  KLYKQLTADGRKVEGIENIFTSGIREFTRLRQGSSVEPDAVMEGVARSMRVALYKEEEKL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL 
Sbjct: 121 DQHLPFLATVGSISPYIGLFGTVWGIMHSFIGLAQVQQATIATVAPGIAEALIATAIGLA 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ IAYN+F   +   A   E F++EFS+IL R+    
Sbjct: 181 AAIPAVIAYNRFSAGADNLASSYENFSDEFSSILHRKVHSR 221


>gi|52424775|ref|YP_087912.1| TolQ protein [Mannheimia succiniciproducens MBEL55E]
 gi|52306827|gb|AAU37327.1| TolQ protein [Mannheimia succiniciproducens MBEL55E]
          Length = 228

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 116/222 (52%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D++ F LF++  + V+ +I +L  FS++SW++IIQ+S    T  +    FE  FWSG+ L
Sbjct: 4   DLNFFELFIKASIVVQIVILILIAFSVISWTIIIQRSRVLTTALKDSSAFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I +   R M++ + RE+EE
Sbjct: 64  TKLYEGLSNRRDGLTGSEQIFYVGFKEFSRLKQANPEAPESIIEGSSRAMNLTMNREIEE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F  ++G     +  +   I E+LI+  +GL
Sbjct: 124 LEGRIPFLATVASISPYIGLFGTVWGIMHAFMGLSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G+
Sbjct: 184 FAAIPAVMAYNRLSLRLNKLEQNYGNFIDEFTTILHRQVFGS 225


>gi|261822333|ref|YP_003260439.1| colicin uptake protein TolQ [Pectobacterium wasabiae WPP163]
 gi|261606346|gb|ACX88832.1| protein TolQ [Pectobacterium wasabiae WPP163]
          Length = 228

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 112/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++F LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNVFDLFLKASLLVKLIMLILICFSIASWAIIIQRTRILNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     +  P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQTRRDSLTGTEQIFHSGFKEFARLHRVNSHVPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVGKLEQNYDNFTEEFIAILHRQA 221


>gi|163802044|ref|ZP_02195940.1| TolQ protein [Vibrio sp. AND4]
 gi|159174185|gb|EDP58993.1| TolQ protein [Vibrio sp. AND4]
          Length = 232

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 111/219 (50%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   SI SW++II++S       +    FE  FWSG  L
Sbjct: 4   DISILDLFLQASLLVKLVMLTLLGMSIASWAMIIKRSKVLSQESKSAESFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +   G   IF +  +E+ +     A SP  + +   R M VA+ARE++E
Sbjct: 64  SLLYQKVKGRKDEITGTEEIFYAGFTEFARLRKSNANSPDYVMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ + YN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMFYNRLSNKVSKLEHTYATFSEEFHSILHRQA 222


>gi|237809445|ref|YP_002893885.1| protein TolQ [Tolumonas auensis DSM 9187]
 gi|237501706|gb|ACQ94299.1| protein TolQ [Tolumonas auensis DSM 9187]
          Length = 228

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 118/223 (52%), Gaps = 3/223 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   ++S   L ++    V+ ++ +L   SI SW++I+Q++    T R    +FE+ FWS
Sbjct: 1   MQPAEMSFTNLILEASPLVQIVMLILLSMSIASWAIIVQRTKVLKTARSISEQFEERFWS 60

Query: 66  GQSLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G  L  + +   N  +   GL  IF S   E+ +  + G ++   I D   R M V+++R
Sbjct: 61  GIDLNRLYQECANRRDELSGLEQIFYSGFKEFARLHNSGLKNQEMIMDGTYRAMRVSLSR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           EL+E+   L  L ++ S    +G+ G V G+M  F +++   + ++ +  P I E+LI+ 
Sbjct: 121 ELDELETHLPVLATIGSISPYIGLFGTVWGIMHAFIALSAVKNASLAMVAPPIAEALIAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +GL  +IP+ +AYN+F    ++       F +EFS IL+RQ 
Sbjct: 181 AMGLFAAIPAVVAYNRFSTKVERLDNSYINFMDEFSTILNRQL 223


>gi|260779151|ref|ZP_05888043.1| MotA/TolQ/ExbB proton channel family protein [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605315|gb|EEX31610.1| MotA/TolQ/ExbB proton channel family protein [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 232

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS+  LF+Q  L VK ++  L   SI+SW++II++S       +    FE  FWSG  L
Sbjct: 4   DISMLDLFLQASLLVKMVMLTLLGMSIVSWAMIIKRSKVLSQAAKGAETFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + ++ K   +   G   IF S  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  SVLYQNAKKRKDELEGTEEIFYSGFTEFARLRKSNADSPDFIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVGKLEHNYATFSEEFHSILHRQA 222


>gi|219870348|ref|YP_002474723.1| colicin transport protein/biopolymer transport protein, membrane
           spanning protein in TolA-TolQ-TolR complex [Haemophilus
           parasuis SH0165]
 gi|219690552|gb|ACL31775.1| colicin transport protein/biopolymer transport protein, membrane
           spanning protein in TolA-TolQ-TolR complex [Haemophilus
           parasuis SH0165]
          Length = 226

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             + ++ +LFM+  + VK +I +L  FS+LSW+VIIQ+S      ++    FE  FWSG+
Sbjct: 2   ATEFNLVSLFMEASIVVKLVILILISFSVLSWAVIIQRSRVLTRAKKDSLNFEDRFWSGE 61

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + + L++  +   G   IF     E+ +       SP  I     R M++A+ REL
Sbjct: 62  DLHRLHEGLEHRRDGLTGAEQIFYVGFKEFNRLQQANPDSPESIIQGSSRAMNLALNREL 121

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           EE+   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +
Sbjct: 122 EELENYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAI 181

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K       F +EF+ IL R+ 
Sbjct: 182 GLFAAIPAVMAYNRLNLRVGKLEQNYVNFIDEFTTILHRKA 222


>gi|260768869|ref|ZP_05877803.1| MotA/TolQ/ExbB proton channel family protein [Vibrio furnissii CIP
           102972]
 gi|260616899|gb|EEX42084.1| MotA/TolQ/ExbB proton channel family protein [Vibrio furnissii CIP
           102972]
 gi|315180562|gb|ADT87476.1| TolQ protein [Vibrio furnissii NCTC 11218]
          Length = 227

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 112/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q    VK ++ +L   SI+SW++II++S       R    FE  FWSG  L
Sbjct: 4   DISILDLFLQASFLVKVVMLILLGMSIVSWAMIIKRSKVLSQAARSAEAFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +       IF S  +E+ +     A SP  + +   R M V++ARE+++
Sbjct: 64  SVLYQDVKKRKDEIAGTEEIFYSGFTEFARLRKTNAASPDYVMEGTGRAMRVSVAREVDD 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGQVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHGYATFSEEFHSILHRQA 222


>gi|254239317|ref|ZP_04932640.1| TolQ protein [Pseudomonas aeruginosa C3719]
 gi|126171248|gb|EAZ56759.1| TolQ protein [Pseudomonas aeruginosa C3719]
          Length = 231

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 64/218 (29%), Positives = 108/218 (49%), Gaps = 3/218 (1%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           S+++L     + V+ ++  L   S+ SW +I Q+       ++    FE+ FWSG  L  
Sbjct: 10  SMWSLISNASIVVQLVMLTLVAASVTSWIMIFQRGNAMRAAKKALDAFEERFWSGIDLSK 69

Query: 72  VCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           + +        + G+  IF +   E+ +   +    P  + + +   M VAI+RE E++ 
Sbjct: 70  LYRQAGSNPDPDSGVEQIFRAGFKEFSRLRQQPGVDPDAVMEGVALAMRVAISREEEKLE 129

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL  
Sbjct: 130 ASLPFLATVGSTSPYVGLFGTVWGIMNSFRGLATVQQATLATVAPGIAEALIATAIGLFA 189

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+F   S+    +   FA+EF AIL R+  
Sbjct: 190 AIPAVIAYNRFSARSEMLIGRYYTFADEFQAILHRKVH 227


>gi|322833834|ref|YP_004213861.1| protein TolQ [Rahnella sp. Y9602]
 gi|321169035|gb|ADW74734.1| protein TolQ [Rahnella sp. Y9602]
          Length = 229

 Score =  166 bits (420), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  + VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASILVKLIMLVLVCFSIASWAIIIQRTKVLNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF S   E+ +     + +P  + +   R M ++  REL
Sbjct: 61  ELSRLYQESQGRRETLSGAEQIFHSGFKEFARLHRANSHAPEAVIEGSSRAMRISFNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F  +       +  +   I E+LI+  +
Sbjct: 121 ESLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIGLGSVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFTAILHRQA 221


>gi|220935400|ref|YP_002514299.1| TolQ protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996710|gb|ACL73312.1| TolQ protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 228

 Score =  166 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 119/220 (54%), Gaps = 2/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            +D+S++ L ++    V+ ++ +L + S+LSW+V+I K       R    EFE+ FWSG 
Sbjct: 2   SVDLSLYRLILEASFIVQLVMLILVVMSVLSWTVMIIKWRVLRDTRAATDEFEERFWSGV 61

Query: 68  SLETVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            L  + + ++      GL  +FM+   E+ +     +     + +   R M VA++RE++
Sbjct: 62  DLAHLYEGIRRKSEVTGLEHVFMAGFKEFLRGRKHRSDRGATLGESAQRSMRVAVSREVD 121

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   LSFL ++ S    +G+ G V G+M  F  ++G     + +  PGI E+LI+  LG
Sbjct: 122 GLESYLSFLATVGSTSPYIGLFGTVWGIMHAFIGLSGAQQATLAMVAPGIAEALIATALG 181

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ IAYN+F +D  +   + + F  EF+++L RQ 
Sbjct: 182 LFAAIPAVIAYNRFSDDVDRIVTRYDNFTEEFTSLLQRQA 221


>gi|165975757|ref|YP_001651350.1| colicin transport protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|165875858|gb|ABY68906.1| colicin transport protein [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
          Length = 226

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 114/220 (51%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + ++ +LFMQ  + VK +I +L  FSILSW+VIIQ+S      ++    FE  FWSG+ 
Sbjct: 3   TEFNLVSLFMQASIVVKIVILILISFSILSWAVIIQRSRVLTEAKKNALAFENKFWSGED 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L+N  +   G   IF +   E+ +       +P        R M++A+ RE+E
Sbjct: 63  LHRLHEGLENRRDGLNGSEQIFYAGFKEYMRLQQVNPDAPEATMKGSSRAMNLALNREVE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
           ++   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +G
Sbjct: 123 DLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ +AYN+      K       F +EF+ IL RQ 
Sbjct: 183 LFAAIPAVMAYNRLSLRVNKLEQDYANFIDEFTTILHRQA 222


>gi|217969216|ref|YP_002354450.1| protein TolQ [Thauera sp. MZ1T]
 gi|217506543|gb|ACK53554.1| protein TolQ [Thauera sp. MZ1T]
          Length = 222

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 114/219 (52%), Gaps = 2/219 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L  Q  + V+ ++ LL   S++SW  I +K+      R Q  EFE+ FWSG 
Sbjct: 4   THDLSILSLISQASVLVQLVMALLASLSLVSWYWIFRKAFQIRQARAQTDEFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L T+ +S   H + G+  IF +   E+ K   KG        D   R M     RE+++
Sbjct: 64  DLNTLYESAGRHQSEGMERIFEAGYREFTKLRGKG-HDHGATLDGARRAMRATYQREIDD 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L+FL S+ S    +G+LG V G+M  F+ ++   +  +    PGI E+L++  +GL
Sbjct: 123 LEAHLAFLASVGSVSPYIGLLGTVWGIMNSFRGLSSVGAATLAQVAPGIAEALVATAIGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F  D  +  ++ E F  EFS IL R  
Sbjct: 183 FAAIPAVVAYNRFAHDIDRLGIRFESFMEEFSNILQRNL 221


>gi|253997447|ref|YP_003049511.1| protein TolQ [Methylotenera mobilis JLW8]
 gi|253984126|gb|ACT48984.1| protein TolQ [Methylotenera mobilis JLW8]
          Length = 224

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 110/222 (49%), Gaps = 3/222 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+S F+L     L V+ ++ +L I S+ SW  I  K        R   +FE  FWSG
Sbjct: 3   ASSDMSFFSLVAGASLPVQLVMLILIITSLFSWWYIFIKVATVKRAERDAEDFEDTFWSG 62

Query: 67  QSLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             L  +  S+  H     G+A+IF +   E+ +   +       + +   R M  A  RE
Sbjct: 63  GDLNKLYDSITAHRRKPQGMASIFEAGFKEYARHKQQTRMDVSDVMEGARRAMRAAYNRE 122

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           ++E+   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E+L++  
Sbjct: 123 MDELDAHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSSVGQATLTQVAPGIAEALVATA 182

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +GL  +IP+ IAYN+F     + +++ E F  EF+ IL R++
Sbjct: 183 IGLFAAIPAVIAYNRFASSVDRLSVRYESFMEEFTNILQRKS 224


>gi|170727079|ref|YP_001761105.1| protein TolQ [Shewanella woodyi ATCC 51908]
 gi|169812426|gb|ACA87010.1| protein TolQ [Shewanella woodyi ATCC 51908]
          Length = 229

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q  L VK ++  L   S++SW+VIIQ+       R+   +FE  FWSG  L
Sbjct: 4   DISFIGLFLQASLLVKFVMLTLLALSVVSWAVIIQRRRLLTAARQSSLKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L    +    L A+F S   E+ +      + P  + D   R M V+++RE+E+
Sbjct: 64  NKLYKELSARQDSNAGLEALFHSGFKEYARLSKLNNKVPEAVMDGSYRAMRVSLSREMEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F     K  M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFSTQVDKIEMSYANFMEEFSSILHRQA 222


>gi|46143832|ref|ZP_00133961.2| COG0811: Biopolymer transport proteins [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126207784|ref|YP_001053009.1| colicin transport protein TolQ [Actinobacillus pleuropneumoniae
           L20]
 gi|307245113|ref|ZP_07527206.1| hypothetical protein appser1_3230 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307249516|ref|ZP_07531503.1| hypothetical protein appser4_3270 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307254069|ref|ZP_07535916.1| hypothetical protein appser9_3240 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258524|ref|ZP_07540261.1| hypothetical protein appser11_3250 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|126096576|gb|ABN73404.1| colicin transport protein TolQ [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306854002|gb|EFM86214.1| hypothetical protein appser1_3230 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306858371|gb|EFM90440.1| hypothetical protein appser4_3270 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306862994|gb|EFM94941.1| hypothetical protein appser9_3240 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306867428|gb|EFM99279.1| hypothetical protein appser11_3250 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 226

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 113/220 (51%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + ++ +LFMQ  + VK +I +L  FSILSW+VIIQ+S      ++    FE  FWSG+ 
Sbjct: 3   TEFNLVSLFMQASIVVKIVILILISFSILSWAVIIQRSRVLTEAKKNALAFENKFWSGED 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L+N  +   G   IF +   E+ +       +P        R M++A+ RE+E
Sbjct: 63  LHRLHEGLENRRDGLNGSEQIFYAGFKEYMRLQQVNPDAPEATMKGSSRAMNLALNREVE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +G
Sbjct: 123 NLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ +AYN+      K       F +EF+ IL RQ 
Sbjct: 183 LFAAIPAVMAYNRLSLRVNKLEQDYANFIDEFTTILHRQA 222


>gi|254362581|ref|ZP_04978678.1| TonB family auxiliary protein TolQ [Mannheimia haemolytica PHL213]
 gi|261493431|ref|ZP_05989956.1| colicin transport protein, TolQ [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261496880|ref|ZP_05993248.1| colicin transport protein, TolQ [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|110735353|gb|ABG89247.1| TolQ [Mannheimia haemolytica]
 gi|153094187|gb|EDN75074.1| TonB family auxiliary protein TolQ [Mannheimia haemolytica PHL213]
 gi|261307404|gb|EEY08739.1| colicin transport protein, TolQ [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261310925|gb|EEY12103.1| colicin transport protein, TolQ [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 226

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 114/220 (51%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + S+ +LF++  + VK ++ +L +FSILSW+VIIQ+S      ++    FE  FWSG+ 
Sbjct: 3   TEFSLLSLFLEASIVVKIVMLILIVFSILSWAVIIQRSKILTKAKKDSLAFEDRFWSGED 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L+N  +   G   IF     E+ +       +P  I     R M++A+ RE+E
Sbjct: 63  LNRLHQGLENRRDALNGSEQIFYVGFKEFTRLQQANPDAPESIIQGSTRAMNLALNREME 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +G
Sbjct: 123 SLENYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ +AYN+      K       F +EF+ +L RQ 
Sbjct: 183 LFAAIPAVMAYNRLNLRLGKVEQGYVNFIDEFTTLLHRQA 222


>gi|127512453|ref|YP_001093650.1| MotA/TolQ/ExbB proton channel [Shewanella loihica PV-4]
 gi|126637748|gb|ABO23391.1| MotA/TolQ/ExbB proton channel [Shewanella loihica PV-4]
          Length = 229

 Score =  166 bits (419), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 116/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q  L VK ++  L   S++SW+VIIQ+     + R++  +FE  FWSG  L
Sbjct: 4   DISFIGLFLQASLLVKFVMLTLLALSVVSWAVIIQRRRLLTSARQRSLKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L         L A+F +   E+ +  +   + P  + D   R M V+++RELE+
Sbjct: 64  NKLYKELSARQESNTGLEAMFYAGFKEYARLSNLNGKVPAAVMDGCYRAMRVSLSRELEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F    +K  M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFSTQVEKIEMSYANFMEEFSSILHRQA 222


>gi|251790485|ref|YP_003005206.1| colicin uptake protein TolQ [Dickeya zeae Ech1591]
 gi|271499761|ref|YP_003332786.1| protein TolQ [Dickeya dadantii Ech586]
 gi|247539106|gb|ACT07727.1| protein TolQ [Dickeya zeae Ech1591]
 gi|270343316|gb|ACZ76081.1| protein TolQ [Dickeya dadantii Ech586]
          Length = 228

 Score =  165 bits (418), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF +   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQTRRENLTGTEQIFYAGFKEFARLHRANSHAPEAVVEGASRAMRISLNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFIAILHRQA 221


>gi|50120309|ref|YP_049476.1| colicin uptake protein TolQ [Pectobacterium atrosepticum SCRI1043]
 gi|49610835|emb|CAG74280.1| TolQ protein [Pectobacterium atrosepticum SCRI1043]
          Length = 228

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++F LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNVFDLFLKASLLVKLIMLILICFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     +  P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQTRRDSLTGTEQIFHSGFKEFARLHRVNSHVPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLSQRVGKLEQNYDNFTEEFIAILHRQA 221


>gi|126173972|ref|YP_001050121.1| MotA/TolQ/ExbB proton channel [Shewanella baltica OS155]
 gi|125997177|gb|ABN61252.1| MotA/TolQ/ExbB proton channel [Shewanella baltica OS155]
          Length = 228

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 116/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  LF+Q  L VK ++  L   S++SW+VI+Q+     + + +  +FE  FWSG  L
Sbjct: 4   DMSIVGLFLQASLLVKFVMFTLLCLSVMSWTVILQRRSLLTSAKSKSAKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHH-NIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + K L     N GL ++F++   E+ +     ++ P  + D   R M V ++RE+E++
Sbjct: 64  NRLYKELSTRPDNSGLESLFVTGFKEYSRLNKLNSKVPDAVMDGTSRAMRVTLSREMEKL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L    ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL 
Sbjct: 124 EANLPLFATIGSTSPYIGLFGTVWGIMNSFIAIGSMENATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F     K  M    F  EFS+IL RQ 
Sbjct: 184 AAIPAVIAYNRFSTQVDKLEMAYANFMEEFSSILHRQA 221


>gi|296103333|ref|YP_003613479.1| colicin uptake protein TolQ [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295057792|gb|ADF62530.1| colicin uptake protein TolQ [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 230

 Score =  165 bits (417), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +       IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDSLAGSEQIFYSGFKEFARLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|317047354|ref|YP_004115002.1| protein TolQ [Pantoea sp. At-9b]
 gi|316948971|gb|ADU68446.1| protein TolQ [Pantoea sp. At-9b]
          Length = 228

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDELNGSEQIFYSGFKEFARLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQGYDNFMEEFTAILHRQA 221


>gi|323496597|ref|ZP_08101650.1| hypothetical protein VISI1226_13296 [Vibrio sinaloensis DSM 21326]
 gi|323318343|gb|EGA71301.1| hypothetical protein VISI1226_13296 [Vibrio sinaloensis DSM 21326]
          Length = 232

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS+  LF+Q  L VK ++  L   SI SW++II++S       +    FE  FWSG  L
Sbjct: 4   EISMLDLFLQASLLVKMVMLTLLGMSIASWAMIIKRSKVLSQAAKDAEAFEDKFWSGTDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +  +   +       IF S  +E+ +     + SP  I +   R M VA+ARE++E
Sbjct: 64  AVLYQKAQKRKDELAGTEEIFYSGFTEFARLRKSNSDSPDFIMEGTGRSMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVGKLEHNYATFSEEFHSILHRQA 222


>gi|91792749|ref|YP_562400.1| MotA/TolQ/ExbB proton channel [Shewanella denitrificans OS217]
 gi|91714751|gb|ABE54677.1| MotA/TolQ/ExbB proton channel [Shewanella denitrificans OS217]
          Length = 229

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS   LF++  L VK ++  L   SI+SW+VIIQ+     T + +   FE  FWSG  L
Sbjct: 4   EISFIGLFLEASLLVKLVMLTLLGLSIMSWAVIIQRRKLLNTAKAKSARFEDTFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L    +    L  +F++   E+ +      + P  + D   R M V+++RE+E+
Sbjct: 64  NRLYKELVARGDSIAGLECLFVAGFKEYSRLSKSSGKQPDAVMDGTSRAMRVSLSREIEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL
Sbjct: 124 LENNLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGTVQNATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ I YN+F     K       F  EFS IL RQ 
Sbjct: 184 FAAIPAVIGYNRFTTQVDKLETAYVNFMEEFSNILHRQA 222


>gi|307256328|ref|ZP_07538111.1| hypothetical protein appser10_3350 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306865154|gb|EFM97054.1| hypothetical protein appser10_3350 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 226

 Score =  165 bits (417), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 114/220 (51%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + ++ +LFMQ  + VK +I +L  FSILSW+VIIQ+S      ++    FE  FWSG+ 
Sbjct: 3   TEFNLISLFMQASIVVKIVILILISFSILSWAVIIQRSRVLTEAKKNALAFENKFWSGED 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L+N  +   G   IF +   E+ +       +P        R M++A+ RE+E
Sbjct: 63  LHRLHEGLENRRDALNGSEQIFYAGFKEYMRLQQVNPDAPEATMKGSSRAMNLALNREVE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +G
Sbjct: 123 NLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ +AYN+      K   +   F +EF+ IL RQ 
Sbjct: 183 LFAAIPAVMAYNRLSLRVNKLEQEYANFIDEFTTILHRQA 222


>gi|300692240|ref|YP_003753235.1| protein tolQ, essential components of the Tol-Pal system [Ralstonia
           solanacearum PSI07]
 gi|299079300|emb|CBJ51972.1| Protein tolQ, essential components of the Tol-Pal system [Ralstonia
           solanacearum PSI07]
          Length = 230

 Score =  164 bits (416), Expect = 5e-39,   Method: Composition-based stats.
 Identities = 72/230 (31%), Positives = 119/230 (51%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 1   MNPVEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFE 59

Query: 61  QLFWSGQSLETVCKSLKNHHNIG--LAAIFMSAMSEW--KKSCDKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S  N+ +    L  IF + M E+   +   +G   P  I D   R 
Sbjct: 60  RDFWAGGDLQAMYQSAANNRHNTGALERIFEAGMREFLKTREQQRGIGDPSAILDASRRA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 120 MRAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 180 AEALVATAIGLFAAIPAVIAYNRYATEMDRLANRFESFMEEFSNILQRQT 229


>gi|253990436|ref|YP_003041792.1| colicin uptake protein TolQ [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781886|emb|CAQ85050.1| tolq protein [Photorhabdus asymbiotica]
          Length = 231

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 112/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++ GL V+ I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MADMNILDLFLKAGLLVQLIMLILICFSIASWAIIIQRTKILNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  ++  +   G   IF S   E+ +       +P  +     R M +++ REL
Sbjct: 61  ELSRLYKESQSRRDSLGGTEQIFYSGFKEFARLHHANNHAPEAVVTGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLESHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFLAILHRQA 221


>gi|153000264|ref|YP_001365945.1| Tol-Pal system TolQ [Shewanella baltica OS185]
 gi|160874897|ref|YP_001554213.1| protein TolQ [Shewanella baltica OS195]
 gi|217973707|ref|YP_002358458.1| protein TolQ [Shewanella baltica OS223]
 gi|304409841|ref|ZP_07391461.1| protein TolQ [Shewanella baltica OS183]
 gi|307304197|ref|ZP_07583950.1| protein TolQ [Shewanella baltica BA175]
 gi|151364882|gb|ABS07882.1| Tol-Pal system TolQ [Shewanella baltica OS185]
 gi|160860419|gb|ABX48953.1| protein TolQ [Shewanella baltica OS195]
 gi|217498842|gb|ACK47035.1| protein TolQ [Shewanella baltica OS223]
 gi|304352359|gb|EFM16757.1| protein TolQ [Shewanella baltica OS183]
 gi|306913095|gb|EFN43518.1| protein TolQ [Shewanella baltica BA175]
 gi|315267134|gb|ADT93987.1| protein TolQ [Shewanella baltica OS678]
          Length = 228

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/218 (33%), Positives = 117/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  LF+Q  L VK ++  L   S++SW+VI+Q+     + + +  +FE  FWSG  L
Sbjct: 4   DMSIVGLFLQASLLVKFVMFTLLCLSVMSWTVILQRRSLLTSAKSKSAKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHH-NIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + K L     N GL ++F++   E+ +     ++ P  + D   R M V ++RE+E++
Sbjct: 64  NRLYKELSTRPDNSGLESLFVTGFKEYSRLNKLNSKVPDAVMDGTSRAMRVTLSREMEKL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL 
Sbjct: 124 EANLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGSMENATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F     K  M    F  EFS+IL RQ 
Sbjct: 184 AAIPAVIAYNRFSTQVDKLEMAYANFMEEFSSILHRQA 221


>gi|206580447|ref|YP_002239641.1| protein TolQ [Klebsiella pneumoniae 342]
 gi|238893773|ref|YP_002918507.1| colicin uptake protein TolQ [Klebsiella pneumoniae NTUH-K2044]
 gi|288936482|ref|YP_003440541.1| protein TolQ [Klebsiella variicola At-22]
 gi|290510461|ref|ZP_06549831.1| TolQ [Klebsiella sp. 1_1_55]
 gi|206569505|gb|ACI11281.1| protein TolQ [Klebsiella pneumoniae 342]
 gi|238546089|dbj|BAH62440.1| inner membrane protein [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|288891191|gb|ADC59509.1| protein TolQ [Klebsiella variicola At-22]
 gi|289777177|gb|EFD85175.1| TolQ [Klebsiella sp. 1_1_55]
          Length = 230

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 115/221 (52%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++    +  R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNSAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  I +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDNLTGSEQIFYSGFKEFARLHRANSHAPEAIVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|190149573|ref|YP_001968098.1| colicin transporter TolQ [Actinobacillus pleuropneumoniae serovar 7
           str. AP76]
 gi|303249540|ref|ZP_07335747.1| colicin transport protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303252542|ref|ZP_07338705.1| colicin transport protein [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307247292|ref|ZP_07529340.1| hypothetical protein appser2_2890 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251831|ref|ZP_07533733.1| hypothetical protein appser6_3520 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307260767|ref|ZP_07542454.1| hypothetical protein appser12_3390 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307262893|ref|ZP_07544517.1| hypothetical protein appser13_3180 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189914704|gb|ACE60956.1| colicin transport protein TolQ [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302648510|gb|EFL78703.1| colicin transport protein [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302651614|gb|EFL81763.1| colicin transport protein [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306856136|gb|EFM88291.1| hypothetical protein appser2_2890 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306860738|gb|EFM92749.1| hypothetical protein appser6_3520 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306869493|gb|EFN01283.1| hypothetical protein appser12_3390 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306871798|gb|EFN03518.1| hypothetical protein appser13_3180 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 226

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 114/220 (51%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + ++ +LFMQ  + VK +I +L  FSILSW+VIIQ+S      ++    FE  FWSG+ 
Sbjct: 3   TEFNLVSLFMQASIVVKIVILILISFSILSWAVIIQRSRVLTEAKKNALAFENKFWSGED 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + + L+N  +   G   IF +   E+ +       +P        R M++A+ RE+E
Sbjct: 63  LHRLHEGLENRRDALNGSEQIFYAGFKEYMRLQQVNPDAPEATMKGSSRAMNLALNREVE 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FLG++ S    +G+ G V G+M  F  ++      + S+   I E+LI+  +G
Sbjct: 123 NLESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSAVKQATLQSVAPGIAEALIATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ +AYN+      K   +   F +EF+ IL RQ 
Sbjct: 183 LFAAIPAVMAYNRLSLRVNKLEQEYANFIDEFTTILHRQA 222


>gi|307130106|ref|YP_003882122.1| membrane spanning protein in TolA-TolQ-TolR complex [Dickeya
           dadantii 3937]
 gi|16116634|emb|CAC82706.1| TolQ protein [Erwinia chrysanthemi]
 gi|306527635|gb|ADM97565.1| membrane spanning protein in TolA-TolQ-TolR complex [Dickeya
           dadantii 3937]
          Length = 228

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF +   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQTRRESLGGTEQIFYAGFKEFARLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFIAILHRQA 221


>gi|167648385|ref|YP_001686048.1| protein TolQ [Caulobacter sp. K31]
 gi|167350815|gb|ABZ73550.1| protein TolQ [Caulobacter sp. K31]
          Length = 232

 Score =  164 bits (416), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 73/227 (32%), Positives = 117/227 (51%), Gaps = 4/227 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
                S  +LF+Q    VK ++  L + S+ SW+VII K   F  +      FE    +G
Sbjct: 6   GPQSFSFISLFLQADWVVKGVMVGLILASLGSWAVIIDKLFRFSAMNSAANRFEDQVSAG 65

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDK---GARSPIGIQDRIDRMMDVAIAR 123
           Q LE V      +    L  +  +A+ EW+++  K   G      +  RIDRM+D  IAR
Sbjct: 66  QGLEEVAAQAGPNPRHPLPRMLQTALKEWREAKAKGVVGEAQAAFLIQRIDRMLDTLIAR 125

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISI 182
           E  +  E L  L  +++A   +G+ G V G+M  FQ+IA   + ++  + P I E+L + 
Sbjct: 126 ETGKAEEGLGSLAIVATASPFIGLFGTVWGIMHAFQNIAISKNTSLAVVAPSIAEALFAT 185

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            +GL  +IP+ IAYNKF  D+ K+A ++E FA++ S  + R+    +
Sbjct: 186 AIGLIAAIPAYIAYNKFSTDAGKYAGRLENFADDLSTAIQRRLSERV 232


>gi|237730718|ref|ZP_04561199.1| colicin uptake protein TolQ [Citrobacter sp. 30_2]
 gi|226906257|gb|EEH92175.1| colicin uptake protein TolQ [Citrobacter sp. 30_2]
          Length = 230

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAASREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +       IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDNLAGSEQIFYSGFKEFARLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|171059622|ref|YP_001791971.1| protein TolQ [Leptothrix cholodnii SP-6]
 gi|170777067|gb|ACB35206.1| protein TolQ [Leptothrix cholodnii SP-6]
          Length = 236

 Score =  164 bits (415), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 70/220 (31%), Positives = 115/220 (52%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D++I  L  Q    V+ ++  L + S+ SW+VI  K +    +R     FE+ FWSG++
Sbjct: 3   QDLNILHLITQASFVVQLVMATLMLVSLASWAVIFGKLIGLRRVRGANDGFEREFWSGRN 62

Query: 69  LETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           ++ +    + +  I   L  IF S M E+ K  ++       + D   R M  ++ RE++
Sbjct: 63  VQELYAHSERNAEIGAPLERIFASGMREFLKLRERRVGDAGSLLDGARRAMRASLQREMD 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   LSFL ++ S    VG+ G V G+M  F  +A     ++    PGI E+L++  +G
Sbjct: 123 AVEHNLSFLATVGSVSPYVGLFGTVWGIMHAFTGLANVQQVSLATVAPGIAEALVATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ IAYN+F  D  + A+Q+E F  EFS IL+R  
Sbjct: 183 LFAAIPAVIAYNRFSRDIDRIAIQLETFVEEFSNILARNI 222


>gi|294140558|ref|YP_003556536.1| MotA/TolQ/ExbB proton channel family protein [Shewanella violacea
           DSS12]
 gi|293327027|dbj|BAJ01758.1| MotA/TolQ/ExbB proton channel family protein [Shewanella violacea
           DSS12]
          Length = 229

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  L VK ++  L   S++SW+VI Q+     T ++   +FE  FWSG  L
Sbjct: 4   DISIIGLFLQASLLVKFVMLTLLSLSVMSWAVIFQRHRLLNTAKKNALKFEDQFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L    +    L  +F +   E+ +     ++ P  + D   R M V+++RE+E+
Sbjct: 64  NKLYKELSARQDSNTGLEILFHTGFKEYTRLSKLNSKVPGAVMDGSYRAMRVSLSREMEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVQNATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F        M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFTTQVDSVEMSYANFMEEFSSILHRQA 222


>gi|300704853|ref|YP_003746456.1| protein tolq, essential components of the tol-pal system [Ralstonia
           solanacearum CFBP2957]
 gi|299072517|emb|CBJ43867.1| Protein tolQ, essential components of the Tol-Pal system [Ralstonia
           solanacearum CFBP2957]
          Length = 230

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 72/230 (31%), Positives = 117/230 (50%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 1   MNPAEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARSQTESFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEW--KKSCDKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S     H    L  IF + M E+   +   +G   P  I D   R 
Sbjct: 60  RDFWAGGDLQAMYQSAANNRHRTGALERIFEAGMREFLKTREQQRGIGDPSAILDASRRA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 120 MRAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 180 AEALVATAIGLFAAIPAVIAYNRYATEMDRLANRFESFMEEFSNILQRQT 229


>gi|242238599|ref|YP_002986780.1| colicin uptake protein TolQ [Dickeya dadantii Ech703]
 gi|242130656|gb|ACS84958.1| protein TolQ [Dickeya dadantii Ech703]
          Length = 228

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 112/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  ++H     G   IF +   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQSHRETLGGTEQIFYAGFKEFARLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFIAILHRQA 221


>gi|253687640|ref|YP_003016830.1| protein TolQ [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251754218|gb|ACT12294.1| protein TolQ [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 228

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++F LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNVFDLFLKASLLVKLIMLILICFSIASWAIIIQRTRILNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  ++  +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQSRRDSLTGTEQIFHSGFKEFARLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLSLRVGKLEQNYDNFTEEFIAILHRQA 221


>gi|226938987|ref|YP_002794058.1| TolQ [Laribacter hongkongensis HLHK9]
 gi|226713911|gb|ACO73049.1| TolQ [Laribacter hongkongensis HLHK9]
          Length = 225

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 73/221 (33%), Positives = 113/221 (51%), Gaps = 2/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   +S+  L +   L V+ I+ LL   S+LSW+ I+ K+V   T RR   +FE+ FWSG
Sbjct: 3   ATQSLSVVQLILDASLPVQLIMALLVAMSVLSWTRILTKAVEVRTARRHTEDFERAFWSG 62

Query: 67  QSLETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             L  + + +    +   +  IF S  +E+ K   +       I D   R M  A  REL
Sbjct: 63  TDLNHIYQQVSAKPDGIGMEKIFQSGFAEFLKLRRQPGGELSDIMDGTRRAMKAAAQREL 122

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           +++    SFL ++ S    +G+ G V G+M  F  +    +  +    PGI E+LI+  +
Sbjct: 123 DDLDRHTSFLATVGSVSPYIGLFGTVWGIMHAFIGLGNAGNATLATVAPGIAEALIATAI 182

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+F  D  +FA + + F  EFS IL RQ 
Sbjct: 183 GLFAAIPAVVAYNRFAYDIDRFATRFDTFMEEFSNILQRQA 223


>gi|157962388|ref|YP_001502422.1| Tol-Pal system TolQ [Shewanella pealeana ATCC 700345]
 gi|157847388|gb|ABV87887.1| Tol-Pal system TolQ [Shewanella pealeana ATCC 700345]
          Length = 229

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 73/219 (33%), Positives = 116/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q  L VK ++  L   SI SW+VIIQ+       +++  +FE  FWSG  L
Sbjct: 4   DISFIGLFLQASLLVKLVMLTLLGLSIASWAVIIQRRRLLNAAKKEALKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L    +    L+++F++   E+ +      R P  + D   R M V+++RELE+
Sbjct: 64  NKLYQELSARQDSNSGLSSLFVTGFKEYARLSKLNGRVPEAVMDGSYRAMRVSLSRELEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F    +K  M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFSTQVEKVEMSYANFMEEFSSILHRQA 222


>gi|221065983|ref|ZP_03542088.1| protein TolQ [Comamonas testosteroni KF-1]
 gi|220711006|gb|EED66374.1| protein TolQ [Comamonas testosteroni KF-1]
          Length = 234

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 77/228 (33%), Positives = 113/228 (49%), Gaps = 3/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L MQ    V+ ++ +L I SI SW+ I +K+     +R     FEQ FWS
Sbjct: 1   MNSQDMSILSLIMQASWVVQLVMLILVIASIASWATIFRKAQTLKRVRTLNDNFEQDFWS 60

Query: 66  GQSLETVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S   +      +  IF S M E++K  ++       + D   R M  +  R
Sbjct: 61  GTSLNDLYASAAQNAKTGGPMERIFASGMREYQKLRERRIGDVATLLDGTRRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           EL+EI   LSFLG+++S    VG+ G V G+M  F   A      +    PGI E+L++ 
Sbjct: 121 ELDEIESGLSFLGTVASVSPYVGLFGTVWGVMHAFTGFANMEQITLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +GL  +IP+  AYN++     + A Q E F  EFS IL R      S
Sbjct: 181 AMGLFAAIPAVTAYNRYAHHIDRIASQEETFIEEFSNILQRNVGATAS 228


>gi|260597136|ref|YP_003209707.1| colicin uptake protein TolQ [Cronobacter turicensis z3032]
 gi|260216313|emb|CBA29295.1| Protein tolQ [Cronobacter turicensis z3032]
          Length = 231

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAASREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF +   E+ +     + +P  I +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRENLSGSEQIFYAGFKEFARLHRANSHAPEAIVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|238920741|ref|YP_002934256.1| colicin uptake protein TolQ [Edwardsiella ictaluri 93-146]
 gi|238870310|gb|ACR70021.1| protein TolQ, putative [Edwardsiella ictaluri 93-146]
          Length = 227

 Score =  164 bits (415), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FS+ SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLVLICFSVASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P G+ +   R M +++ RE+
Sbjct: 61  ELSRLYQESQTRRDGLSGSEQIFYSGFKEFARLHRMNSHAPEGVIEGASRAMRISLNREI 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F  +       +  +   I E+LI+  +
Sbjct: 121 EAMENHIPFLGTVGSISPYIGLFGTVWGIMHAFIGLGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K     E F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNLRVNKLEQNYENFMEEFIAILHRQA 221


>gi|120599222|ref|YP_963796.1| MotA/TolQ/ExbB proton channel [Shewanella sp. W3-18-1]
 gi|146292704|ref|YP_001183128.1| MotA/TolQ/ExbB proton channel [Shewanella putrefaciens CN-32]
 gi|120559315|gb|ABM25242.1| MotA/TolQ/ExbB proton channel [Shewanella sp. W3-18-1]
 gi|145564394|gb|ABP75329.1| MotA/TolQ/ExbB proton channel [Shewanella putrefaciens CN-32]
 gi|319426008|gb|ADV54082.1| TonB system biopolymer transport inner membrane component, TolQ
           [Shewanella putrefaciens 200]
          Length = 228

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  LF+Q  L VK ++  L   S++SW+VI+Q+     + + +  +FE  FWSG  L
Sbjct: 4   DMSIVGLFLQASLLVKFVMFTLLALSVMSWTVILQRRSLLSSAKGKSAKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + K L    +   L ++F++   E+ +     ++ P  + D   R M V ++RE+E++
Sbjct: 64  NRLYKELSARPDNTGLESLFVTGFKEYSRLNKLNSKVPDAVMDGTSRAMRVTLSREMEKL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL 
Sbjct: 124 EANLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGSMENATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F     K  M    F  EFS+IL RQ 
Sbjct: 184 AAIPAVIAYNRFSTQVDKLEMAYANFMEEFSSILHRQA 221


>gi|49474674|ref|YP_032716.1| inner membrane tolQ protein [Bartonella quintana str. Toulouse]
 gi|49240178|emb|CAF26644.1| Inner membrane tolQ protein [Bartonella quintana str. Toulouse]
          Length = 237

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 86/218 (39%), Positives = 141/218 (64%), Gaps = 1/218 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I +  LF+Q    VK I+  L + S+ SW++I +K   +  +R + ++FE++FWSG+ LE
Sbjct: 12  IGMLRLFIQANWVVKAIMISLLLASVWSWAIIFEKIFTYRKIRCEIKQFERIFWSGKPLE 71

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  + K+     ++A+FM+AM EWKKS +KG  + I +Q RID+ MD+ + RE  +I  
Sbjct: 72  DLYSTCKSQRPSSISAVFMAAMVEWKKSLEKGIHTSISLQSRIDKAMDLTLGRESAKIES 131

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           KLSFL ++ SAG  +G+LG V+G+MG F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 132 KLSFLATLGSAGPFIGLLGTVIGVMGSFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 191

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           IP+ IAYNK + +S +   Q+E FA+EFS I+SR+ + 
Sbjct: 192 IPAVIAYNKLVNESAQIIAQIENFADEFSTIVSRRIDE 229


>gi|330991875|ref|ZP_08315824.1| Protein tolQ [Gluconacetobacter sp. SXCC-1]
 gi|329760896|gb|EGG77391.1| Protein tolQ [Gluconacetobacter sp. SXCC-1]
          Length = 221

 Score =  164 bits (415), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 73/221 (33%), Positives = 122/221 (55%), Gaps = 3/221 (1%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
           ++ALFM   + VK ++  L   S++ W++I  K +    + RQ  +FE+ FW+G SLE +
Sbjct: 1   MWALFMHASIVVKLVMIGLVSCSVIVWAIIFDKFMTVRRVNRQANDFEERFWAGGSLEDL 60

Query: 73  CKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITE 130
            +S        +AA+F +AM EW++S           G+QDR++R M + I RE++ +  
Sbjct: 61  YESDGAKPVHPMAAVFGAAMGEWRRSSRISGIDLVHGGVQDRVNRAMAITITREMDRLNR 120

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
            + FL ++      +G+ G V G+M  F SIA  ++ N+  +   I E+L +  +GL  +
Sbjct: 121 WIIFLATIGPVAPFIGLFGTVWGIMHAFGSIAAMHNTNLSVVAPGISEALFATAIGLVTA 180

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           IP+ IAYN        F  +++ F  EF+AILSRQ+E   +
Sbjct: 181 IPAVIAYNVISNSMSVFEDRLDAFGTEFAAILSRQSEERGA 221


>gi|120610901|ref|YP_970579.1| MotA/TolQ/ExbB proton channel [Acidovorax citrulli AAC00-1]
 gi|326317712|ref|YP_004235384.1| protein TolQ [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|120589365|gb|ABM32805.1| Cell division and transport-associated protein TolQ [Acidovorax
           citrulli AAC00-1]
 gi|323374548|gb|ADX46817.1| protein TolQ [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 233

 Score =  164 bits (414), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 75/228 (32%), Positives = 112/228 (49%), Gaps = 3/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI  L +     V+ ++ LL   SI SW+ I +K      +R    EFE+ FWS
Sbjct: 1   MNSQDMSILHLVLNASWVVQLVMALLIGVSIASWAAIFRKLFALKRVRSLNDEFEREFWS 60

Query: 66  GQSLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S   +      +  IF S M E+ K  ++    P  + D   R M  +  R
Sbjct: 61  GTSLNDLYASAAQNAKNAGPMERIFASGMREFHKLRERRITDPGTLLDGARRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++ +   LSFLGS++S    VG+ G V G+M  F   AG     +    PGI E+L++ 
Sbjct: 121 EMDVVESSLSFLGSVASVSPYVGLFGTVWGIMHAFTGFAGMEQVTLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +GL  +IP+ +AYN+F  D  + A+  E F  EFS IL R      +
Sbjct: 181 AIGLFAAIPAVVAYNRFARDIDRVAIHQETFIEEFSNILQRNLGAAPA 228


>gi|16127463|ref|NP_422027.1| MotA/TolQ/ExbB proton channel family protein [Caulobacter
           crescentus CB15]
 gi|221236276|ref|YP_002518713.1| TolQ protein [Caulobacter crescentus NA1000]
 gi|13424917|gb|AAK25195.1| MotA/TolQ/ExbB proton channel family protein [Caulobacter
           crescentus CB15]
 gi|220965449|gb|ACL96805.1| TolQ protein [Caulobacter crescentus NA1000]
          Length = 232

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 80/227 (35%), Positives = 125/227 (55%), Gaps = 4/227 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  + S FALFMQ    VK ++  L + S+ SW+VI+ K   F  L R    FE+    G
Sbjct: 6   AAPNFSFFALFMQADWVVKSVMIGLILASLGSWAVILDKLFRFQALNRAANRFEEQVSGG 65

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIG---IQDRIDRMMDVAIAR 123
           +SLE V      +    L  +  +A+ EW+ +  KGA S      +  RIDR++D  IAR
Sbjct: 66  RSLEDVAGEAGANPRHALPRMLQAALKEWRDAKSKGAMSETQAGFLIARIDRILDTQIAR 125

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISI 182
           E  ++ E L  L  +++A   +G+ G V G+M  FQ+IA   + ++  + P I E+L + 
Sbjct: 126 ETTKVEEGLGSLAIVATASPFIGLFGTVWGIMHAFQNIALSKNTSLAVVAPSIAEALFAT 185

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            +GL  +IP+ IAYNKF  D+ K+A ++EGFA++ S  + R+    +
Sbjct: 186 AIGLIAAIPAYIAYNKFSTDAGKYAGRLEGFADDLSTAIQRRLAERV 232


>gi|157825551|ref|YP_001493271.1| TolQ protein [Rickettsia akari str. Hartford]
 gi|157799509|gb|ABV74763.1| TolQ protein [Rickettsia akari str. Hartford]
          Length = 241

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 76/219 (34%), Positives = 124/219 (56%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+FAL     +  K ++ +L I SI SW++I+ K      ++R+ ++FE +FWSG  LE
Sbjct: 19  LSLFALINSSDIIGKSVMLMLLITSIWSWAIILDKIFKLAQVQRRMKDFENVFWSGGVLE 78

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEI 128
            +  S+K   N  LA IF+SAM E K    KG         ++RI   M +A  RE+E++
Sbjct: 79  QLYDSIKRSVNNPLALIFVSAMDECKSLSTKGLSDALKNNHKERITGAMYLAQNREVEKL 138

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + LSFL ++ S+   VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL 
Sbjct: 139 EKNLSFLATVGSSAPFVGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLF 198

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YN  I        ++E F++E ++ILS+  +
Sbjct: 199 AAIPAVIFYNYLISRITLINNKIEDFSSELNSILSKAID 237


>gi|264679474|ref|YP_003279381.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni CNB-2]
 gi|299530556|ref|ZP_07043976.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni S44]
 gi|262209987|gb|ACY34085.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni CNB-2]
 gi|298721532|gb|EFI62469.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni S44]
          Length = 234

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 77/228 (33%), Positives = 113/228 (49%), Gaps = 3/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L MQ    V+ ++ +L I SI SW+ I +K+     +R     FEQ FWS
Sbjct: 1   MNSQDMSILSLIMQASWVVQLVMLILVIASIASWATIFRKAQTLKRVRSLNDNFEQDFWS 60

Query: 66  GQSLETVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S   +      +  IF S M E++K  ++       + D   R M  +  R
Sbjct: 61  GTSLNDLYASAAQNAKTGGPMERIFASGMREYQKLRERRIGDVATLMDGTRRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           EL+EI   LSFLG+++S    VG+ G V G+M  F   A      +    PGI E+L++ 
Sbjct: 121 ELDEIESGLSFLGTVASVSPYVGLFGTVWGVMHAFTGFANMEQITLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +GL  +IP+  AYN++     + A Q E F  EFS IL R      S
Sbjct: 181 AMGLFAAIPAVTAYNRYAHHIDRIASQEETFIEEFSNILQRNVGATAS 228


>gi|261868495|ref|YP_003256417.1| protein TolQ [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293390511|ref|ZP_06634845.1| protein TolQ [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|261413827|gb|ACX83198.1| protein TolQ [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|290951045|gb|EFE01164.1| protein TolQ [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 229

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/222 (29%), Positives = 115/222 (51%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L IFSI SW++IIQ+S       ++   FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVILILIIFSITSWAIIIQRSRVLTKALKESMAFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++++ RE+E+
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFYVGFKEFSRLKQANPDAPEAIIQGSTRAMNLSMNREIED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F S++G     +  +   I E+LI+  +GL
Sbjct: 124 LETRVPFLATVASISPYIGLFGTVWGIMHAFLSLSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G 
Sbjct: 184 FAAIPAVMAYNRLSLRVNKLEQNYGNFIDEFTTILHRQVFGK 225


>gi|15602835|ref|NP_245907.1| hypothetical protein PM0970 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721295|gb|AAK03054.1| TolQ [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 229

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 115/222 (51%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D++   LF++  + V+ +I +L IFSI+SW++IIQ+S       +    FE  FWSG+ L
Sbjct: 4   DLNFLELFLKASIVVQFVIVILIIFSIMSWAIIIQRSRILTKALKDSAAFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   L+N  +   G   IF     E+ +       +P  I     R M++A+ RE+EE
Sbjct: 64  NRLFDGLENKRDGLSGSEQIFYVGFKEFSRLKQANPNAPEAIIQGSSRAMNLAMNREVEE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G 
Sbjct: 184 FAAIPAVMAYNRLSLRVSKLEQNYGNFIDEFTTILHRQAFGK 225


>gi|113970706|ref|YP_734499.1| MotA/TolQ/ExbB proton channel [Shewanella sp. MR-4]
 gi|113885390|gb|ABI39442.1| MotA/TolQ/ExbB proton channel [Shewanella sp. MR-4]
          Length = 228

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 116/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  LF+Q  L VK ++  L   S++SW+VI+Q+     + + +  +FE  FWSG  L
Sbjct: 4   DMSIVGLFLQASLLVKFVMFTLLCLSVMSWTVILQRRSLLTSAKSKSAKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + K L    +   L ++F++   E+ +      + P  + D   R M V ++RELE++
Sbjct: 64  NRLYKELSARPDNTGLESLFVTGFKEYSRLNKLNNKVPDAVMDGTSRAMRVTLSRELEKL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL 
Sbjct: 124 EANLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGSMENATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F    +K  +    F  EFS+IL RQ 
Sbjct: 184 AAIPAVIAYNRFATQVEKLEIGYANFMEEFSSILHRQA 221


>gi|329295945|ref|ZP_08253281.1| colicin uptake protein TolQ [Plautia stali symbiont]
          Length = 228

 Score =  164 bits (414), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNVLDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQARRDELSGSEQIFYSGFKEFARLHRANSHAPEAVVEGAGRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQGYDNFMEEFTAILHRQA 221


>gi|258621412|ref|ZP_05716446.1| tolQ protein [Vibrio mimicus VM573]
 gi|258626841|ref|ZP_05721648.1| tolQ protein [Vibrio mimicus VM603]
 gi|262171196|ref|ZP_06038874.1| MotA/TolQ/ExbB proton channel family protein [Vibrio mimicus
           MB-451]
 gi|258580888|gb|EEW05830.1| tolQ protein [Vibrio mimicus VM603]
 gi|258586800|gb|EEW11515.1| tolQ protein [Vibrio mimicus VM573]
 gi|261892272|gb|EEY38258.1| MotA/TolQ/ExbB proton channel family protein [Vibrio mimicus
           MB-451]
          Length = 227

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 107/219 (48%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q    VK ++  L   S+ SW+ II++S       ++   FE  FWSG  L
Sbjct: 4   DISFLDLFLQASFLVKMVMLTLLGMSVASWAAIIKRSKVISAAEKEADTFEDRFWSGIDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +    +  IF +  +E+ +       +P  + +   R M VA+ARE++ 
Sbjct: 64  GALYQDVKKRKDDIYGIEEIFYAGFTEFARLRKTNPSAPDFVMEGTGRAMRVAVAREVDS 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF  IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHNYATFSEEFHTILHRQA 222


>gi|260222862|emb|CBA32854.1| Protein tolQ [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 242

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 72/225 (32%), Positives = 114/225 (50%), Gaps = 3/225 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SI  L +   + V+ ++ LL + SI SW+ I +K  +   ++ Q   FE+ FWSG S
Sbjct: 14  QDLSILHLVLNASIVVQAVMALLMMVSIASWAAIFRKLFSLKRVKTQNEAFEREFWSGSS 73

Query: 69  LETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  +  +   +      +  IF S M E++K  ++       + D   R M  +  RE++
Sbjct: 74  LNDLFNAASRNAQTCGPMERIFASGMREFQKLRERRVSDVGTLMDGARRAMRASFQREMD 133

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
           E+   LSFL S+ S    VG+ G V G+M  F  +A      +    PGI E+L++  +G
Sbjct: 134 EVESNLSFLASVGSVSPYVGLFGTVWGIMHAFTGLASLQQVTLSTVAPGIAEALVATAIG 193

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L  +IP+ +AYN+F  D  + A+Q E F  EFS IL R      +
Sbjct: 194 LFAAIPAVVAYNRFARDLDRIAIQQETFIEEFSNILQRNVSAQPA 238


>gi|114047935|ref|YP_738485.1| MotA/TolQ/ExbB proton channel [Shewanella sp. MR-7]
 gi|117920975|ref|YP_870167.1| MotA/TolQ/ExbB proton channel [Shewanella sp. ANA-3]
 gi|113889377|gb|ABI43428.1| MotA/TolQ/ExbB proton channel [Shewanella sp. MR-7]
 gi|117613307|gb|ABK48761.1| MotA/TolQ/ExbB proton channel [Shewanella sp. ANA-3]
          Length = 228

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 117/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  LF+Q  L VK ++  L   S++SW+VI+Q+     + + +  +FE  FWSG  L
Sbjct: 4   DMSIVGLFLQASLLVKFVMFTLLCLSVMSWTVILQRRSLLTSAKSKSAKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + K L    +   L ++F++   E+ +     ++ P  + D   R M V ++RELE++
Sbjct: 64  NRLYKELSARPDNTGLESLFVTGFKEYSRLNKLNSKVPDAVMDGTSRAMRVTLSRELEKL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL 
Sbjct: 124 EANLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGSMENATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F    +K  +    F  EFS+IL RQ 
Sbjct: 184 AAIPAVIAYNRFATQVEKLEIGYANFMEEFSSILHRQA 221


>gi|262404185|ref|ZP_06080740.1| MotA/TolQ/ExbB proton channel family protein [Vibrio sp. RC586]
 gi|262349217|gb|EEY98355.1| MotA/TolQ/ExbB proton channel family protein [Vibrio sp. RC586]
          Length = 227

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 107/219 (48%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q    VK ++  L   S+ SW+ II++S       R+   FE  FWSG  L
Sbjct: 4   DISFLDLFLQASFLVKMVMLTLLGMSVASWAAIIKRSKVISAAEREADTFEDRFWSGIDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +    +  IF +  +E+ +       +P  + +   R M VA+ARE++ 
Sbjct: 64  GALYQDVKKRKDDIYGIEEIFYAGFTEFARLRKTNPSAPDFVMEGTGRAMRVAVAREVDS 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF  IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHNYATFSEEFHTILHRQA 222


>gi|85058861|ref|YP_454563.1| colicin uptake protein TolQ [Sodalis glossinidius str. 'morsitans']
 gi|84779381|dbj|BAE74158.1| colicin import protein TolQ [Sodalis glossinidius str. 'morsitans']
          Length = 228

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 68/226 (30%), Positives = 112/226 (49%), Gaps = 3/226 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++IF LF++ G  VK I+ +L  FSI SW++IIQ+S    +  R+   FE  FWSG 
Sbjct: 1   MTDMNIFDLFLKAGFLVKLIMLILICFSIASWAIIIQRSRILTSAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +      +   G   IF +   E+ +       +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESLTRRDSLSGSEQIFYAGFKEFARLHRANNHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F  +       +  +   I E+LI+  +
Sbjct: 121 EALETHIPFLGTVGSISPYIGLFGTVWGIMHAFIGLGTVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ +A+N+      K     + F  EF AIL RQ   + S
Sbjct: 181 GLFAAIPAVMAFNRLSLRVNKLEQNYDNFTEEFIAILHRQAFASDS 226


>gi|192362359|ref|YP_001981528.1| tolQ protein [Cellvibrio japonicus Ueda107]
 gi|190688524|gb|ACE86202.1| tolQ protein [Cellvibrio japonicus Ueda107]
          Length = 228

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 112/219 (51%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  L +Q    V+ ++ +L + S++SW++I Q+          F  FE+ FWSG  L 
Sbjct: 8   LSITHLILQASFLVQLVMLILVLASVISWAMIFQRERYQRKASSAFSYFEKQFWSGIDLN 67

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +      +   G+  IF +   E+ +           I +   R M VA+ARE E++
Sbjct: 68  QLYRQGNGRTDLAEGIENIFRAGFKEFTRLRQTAGADSDAIMEGSMRAMRVALAREQEKL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            E L FL S++S    +G+ G V G+M  F +IA     ++    PGI E+LI+  +GL 
Sbjct: 128 EENLPFLASVASVSPYIGLFGTVWGIMVSFLNIANAGQPSLATVAPGIAEALIATAMGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ +AYNKF   ++      + FA EFSAIL RQ  
Sbjct: 188 AAIPAVLAYNKFSARAESLLSNYQTFAEEFSAILHRQVH 226


>gi|167623619|ref|YP_001673913.1| Tol-Pal system TolQ [Shewanella halifaxensis HAW-EB4]
 gi|167353641|gb|ABZ76254.1| Tol-Pal system TolQ [Shewanella halifaxensis HAW-EB4]
          Length = 229

 Score =  163 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q  L VK ++  L   SI SW+VIIQ+       +    +FE  FWSG  L
Sbjct: 4   DISFIGLFLQASLLVKFVMLTLLSLSIASWAVIIQRRKLLNAAKNDALKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L    +    L A+F++   E+ +      R P  + D   R M V+++RELE+
Sbjct: 64  NKLYQELSARQDSNTGLEALFVTGFKEYARLNKLNGRVPEAVMDGSYRAMRVSLSRELEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F    +K  M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFSTQVEKIEMSYANFMEEFSSILHRQA 222


>gi|307294756|ref|ZP_07574598.1| protein TolQ [Sphingobium chlorophenolicum L-1]
 gi|306879230|gb|EFN10448.1| protein TolQ [Sphingobium chlorophenolicum L-1]
          Length = 235

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 115/219 (52%), Gaps = 2/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           IS  ALF+Q  + VK ++  L + SI +W++II  S       RQ R FEQ FW  + ++
Sbjct: 17  ISPLALFLQADIVVKVVMLGLLLASIWTWAMIIGFSFTLRKASRQSRAFEQDFWKAEDID 76

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
              +  +       A +  + ++EW++S  +      G +DR+   M   IA E++ +++
Sbjct: 77  RFYE-ARGKSEFPAARVMAAGVTEWRRSTAQKVIDREGTRDRLSTAMSSTIAAEVDRLSD 135

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L+ L ++ S    VG+ G V G+M  F SIA   ++++  +   I E+L +  +GL  +
Sbjct: 136 RLNILATIGSVAPFVGLFGTVWGIMRAFTSIAAEQNSSLAVVAPGIAEALFATAIGLFAA 195

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP+ IAYN+F     +    +  FA+ F + LSR+ E  
Sbjct: 196 IPAVIAYNRFSHGINRMESGLTRFADNFYSTLSRELEAQ 234


>gi|145634619|ref|ZP_01790328.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittAA]
 gi|145640340|ref|ZP_01795924.1| TolQ [Haemophilus influenzae R3021]
 gi|145268164|gb|EDK08159.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittAA]
 gi|145274926|gb|EDK14788.1| TolQ [Haemophilus influenzae 22.4-21]
          Length = 228

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 114/223 (51%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S       ++ R FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEARTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEAIIKGTTRAMNLAMNREIES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQDYVNFIDEFTTILHRQAFGKA 226


>gi|83719386|ref|YP_441922.1| tolQ protein [Burkholderia thailandensis E264]
 gi|167580766|ref|ZP_02373640.1| tolQ protein [Burkholderia thailandensis TXDOH]
 gi|167618869|ref|ZP_02387500.1| tolQ protein [Burkholderia thailandensis Bt4]
 gi|167837691|ref|ZP_02464574.1| tolQ protein [Burkholderia thailandensis MSMB43]
 gi|257138093|ref|ZP_05586355.1| tolQ protein [Burkholderia thailandensis E264]
 gi|83653211|gb|ABC37274.1| tolQ protein [Burkholderia thailandensis E264]
          Length = 225

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 72/222 (32%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLVLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLNDPALLLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLESNLSFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|84501649|ref|ZP_00999821.1| proton transporter TolQ [Oceanicola batsensis HTCC2597]
 gi|84390270|gb|EAQ02829.1| proton transporter TolQ [Oceanicola batsensis HTCC2597]
          Length = 231

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 81/220 (36%), Positives = 125/220 (56%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ALF +  L VK ++ LL   S  SWS+IIQK + + + R +  +F++ FWSG+ 
Sbjct: 12  VDFSMWALFARATLTVKLVMLLLIAASFWSWSIIIQKIITYRSARSEATKFDRSFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+   + +    +     +F + M+EW++S  +  +   G Q RIDR MDVAIA+E E +
Sbjct: 72  LDEFYEQIGPDPSGRAHRVFAAGMTEWRRSHREDGQMIAGAQARIDRSMDVAIAKEAEGL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QAGLPVLATVGSTAPFVGLFGTVWGIMHAFIGIAESQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ I YNK   D+ +     E FA+EFS ILSRQ + 
Sbjct: 192 AAIPAVIFYNKLSTDADRLVGNYEAFADEFSTILSRQLDA 231


>gi|24374292|ref|NP_718335.1| MotA/TolQ/ExbB proton channel family protein [Shewanella oneidensis
           MR-1]
 gi|24348830|gb|AAN55779.1|AE015714_6 MotA/TolQ/ExbB proton channel family protein [Shewanella oneidensis
           MR-1]
          Length = 228

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 115/218 (52%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S   LF+Q  L VK ++  L   SI+SW+VI+Q+       + +  +FE  FWSG  L
Sbjct: 4   DMSFIGLFLQASLLVKFVMFTLLGLSIMSWTVILQRRSLLTGAKNKSAKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + K L    +   L ++F++   E+ +     ++ P  + D   R M V ++RELE++
Sbjct: 64  NRLYKELSARPDNTGLESLFVTGFKEYSRLNKLNSKVPDAVMDGTSRAMRVTLSRELEKL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL 
Sbjct: 124 EANLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGSMENATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F    +K  +    F  EFS+IL RQ 
Sbjct: 184 AAIPAVIAYNRFATQVEKLEIAYANFMEEFSSILHRQA 221


>gi|227327553|ref|ZP_03831577.1| colicin uptake protein TolQ [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 225

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +++F LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNVFDLFLKASLLVKLIMLILICFSIASWAIIIQRTRILNAATREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQTRRDSLTGTEQIFHSGFKEFARLHRVNSHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVGKLEQNYDNFTEEFIAILHRQA 218


>gi|17545451|ref|NP_518853.1| TOLQ-like transport transmembrane protein [Ralstonia solanacearum
           GMI1000]
 gi|17427743|emb|CAD14262.1| probable tolq-related transport transmembrane protein [Ralstonia
           solanacearum GMI1000]
 gi|299067722|emb|CBJ38931.1| Protein tolQ, essential components of the Tol-Pal system [Ralstonia
           solanacearum CMR15]
          Length = 230

 Score =  163 bits (412), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 73/230 (31%), Positives = 118/230 (51%), Gaps = 6/230 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L V+ ++ LL + S+ SW+ I +K+      R Q   FE
Sbjct: 1   MNPVEV-TQDLSIVSLVLHASLLVQFVMGLLLVMSLFSWTYIFRKAFALRAARAQTESFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEW--KKSCDKGARSPIGIQDRIDRM 116
           + FW+G  L+ + +S     HH   L  IF + M E+   +   +G   P  I D   R 
Sbjct: 60  RDFWAGGDLQAMYQSAANNRHHTGALERIFEAGMREYLKTREQQRGVGDPSAILDAARRA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M  A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      + ++   I
Sbjct: 120 MRAAYQREMDSLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLSAVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            E+L++  +GL  +IP+ IAYN++  +  + A + E F  EFS IL RQT
Sbjct: 180 AEALVATAIGLFAAIPAVIAYNRYATEMDRLANRFESFMEEFSNILQRQT 229


>gi|261211903|ref|ZP_05926190.1| MotA/TolQ/ExbB proton channel family protein [Vibrio sp. RC341]
 gi|260839253|gb|EEX65885.1| MotA/TolQ/ExbB proton channel family protein [Vibrio sp. RC341]
          Length = 227

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 107/219 (48%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q    VK ++  L   S+ SW+ II++S       R+   FE  FWSG  L
Sbjct: 4   DISFLDLFLQASFLVKMVMLTLLGMSVASWAAIIKRSKIISAAEREADTFEDRFWSGIDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +    +  IF +  +E+ +       +P  + +   R M VA+ARE++ 
Sbjct: 64  GALYQDVKKRKDDIYGIEEIFYAGFTEFARLRKTNPSAPDFVMEGTGRAMRVAVAREVDS 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF  IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHNYATFSEEFHTILHRQA 222


>gi|304395716|ref|ZP_07377599.1| protein TolQ [Pantoea sp. aB]
 gi|304357010|gb|EFM21374.1| protein TolQ [Pantoea sp. aB]
          Length = 228

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF S   E+ +       +P  + D   R M +++ REL
Sbjct: 61  ELSRLYQESQERREELGGSEQIFYSGFKEFARLHRANNHAPEAVIDGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQGYDNFMEEFTAILHRQA 221


>gi|251793060|ref|YP_003007786.1| protein TolQ [Aggregatibacter aphrophilus NJ8700]
 gi|247534453|gb|ACS97699.1| protein TolQ [Aggregatibacter aphrophilus NJ8700]
          Length = 229

 Score =  163 bits (411), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 115/222 (51%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L IFSI SW++IIQ+S       ++   FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVILILIIFSITSWAIIIQRSRVLTKALKESMAFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++++ RE+E+
Sbjct: 64  NKLYEGLSNRRDGLSGSEQIFYVGFKEFSRLKQANPDAPEAIIKGSTRAMNLSMNREIED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           I  ++ FL +++S    +G+ G V G+M  F S++G     +  +   I E+LI+  +GL
Sbjct: 124 IETRVPFLATVASISPYIGLFGTVWGIMHAFMSLSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G 
Sbjct: 184 FAAIPAVMAYNRLSLRVNKLEQNYGNFIDEFTTILHRQVFGK 225


>gi|86139149|ref|ZP_01057719.1| proton transporter TolQ [Roseobacter sp. MED193]
 gi|85823993|gb|EAQ44198.1| proton transporter TolQ [Roseobacter sp. MED193]
          Length = 231

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 84/219 (38%), Positives = 123/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +    VK ++ +L   SI SW +IIQK +N+   RR+  +F+Q FWSG+ 
Sbjct: 12  IDFSMWGLFARATFTVKLVMLMLTAASIWSWGIIIQKLINYRQARRRAAQFDQAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   L          IF + M+EW++S         G Q RIDR MDVAIA+E E++
Sbjct: 72  LDGLFDQLGPEPTGHSERIFAAGMAEWRRSHRSDGGLIPGAQARIDRSMDVAIAKETEDL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L ++ S    VG+ G V G+M  F  IA   S N+  +   I E+L++  LGL 
Sbjct: 132 QRGLSVLATVGSTAPFVGLFGTVWGIMTAFIEIAEQQSTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVVFYNKLSADSDRILGGYEAFADEFATILSRQLD 230


>gi|53725622|ref|YP_103657.1| tolQ protein [Burkholderia mallei ATCC 23344]
 gi|67643923|ref|ZP_00442666.1| protein TolQ [Burkholderia mallei GB8 horse 4]
 gi|121600116|ref|YP_992170.1| tolQ protein [Burkholderia mallei SAVP1]
 gi|124383938|ref|YP_001028616.1| tolQ protein [Burkholderia mallei NCTC 10229]
 gi|126441853|ref|YP_001060212.1| MotA/TolQ/ExbB proton channel family protein [Burkholderia
           pseudomallei 668]
 gi|126448943|ref|YP_001081483.1| tolQ protein [Burkholderia mallei NCTC 10247]
 gi|126452711|ref|YP_001067476.1| MotA/TolQ/ExbB proton channel family protein [Burkholderia
           pseudomallei 1106a]
 gi|166998273|ref|ZP_02264133.1| protein TolQ [Burkholderia mallei PRL-20]
 gi|167720987|ref|ZP_02404223.1| tolQ protein [Burkholderia pseudomallei DM98]
 gi|167739944|ref|ZP_02412718.1| tolQ protein [Burkholderia pseudomallei 14]
 gi|167817181|ref|ZP_02448861.1| tolQ protein [Burkholderia pseudomallei 91]
 gi|167825594|ref|ZP_02457065.1| tolQ protein [Burkholderia pseudomallei 9]
 gi|167847078|ref|ZP_02472586.1| tolQ protein [Burkholderia pseudomallei B7210]
 gi|167895662|ref|ZP_02483064.1| tolQ protein [Burkholderia pseudomallei 7894]
 gi|167904055|ref|ZP_02491260.1| tolQ protein [Burkholderia pseudomallei NCTC 13177]
 gi|167912312|ref|ZP_02499403.1| tolQ protein [Burkholderia pseudomallei 112]
 gi|167920269|ref|ZP_02507360.1| tolQ protein [Burkholderia pseudomallei BCC215]
 gi|226194311|ref|ZP_03789910.1| protein TolQ [Burkholderia pseudomallei Pakistan 9]
 gi|237813602|ref|YP_002898053.1| protein TolQ [Burkholderia pseudomallei MSHR346]
 gi|242314143|ref|ZP_04813159.1| protein TolQ [Burkholderia pseudomallei 1106b]
 gi|254175704|ref|ZP_04882364.1| tolQ protein [Burkholderia mallei ATCC 10399]
 gi|254180827|ref|ZP_04887425.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 1655]
 gi|254191665|ref|ZP_04898168.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254194925|ref|ZP_04901355.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei S13]
 gi|254202354|ref|ZP_04908717.1| protein TolQ [Burkholderia mallei FMH]
 gi|254207688|ref|ZP_04914038.1| protein TolQ [Burkholderia mallei JHU]
 gi|254260751|ref|ZP_04951805.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 1710a]
 gi|254299062|ref|ZP_04966512.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 406e]
 gi|254356410|ref|ZP_04972686.1| protein TolQ [Burkholderia mallei 2002721280]
 gi|52429045|gb|AAU49638.1| tolQ protein [Burkholderia mallei ATCC 23344]
 gi|121228926|gb|ABM51444.1| tolQ protein [Burkholderia mallei SAVP1]
 gi|124291958|gb|ABN01227.1| protein TolQ [Burkholderia mallei NCTC 10229]
 gi|126221346|gb|ABN84852.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 668]
 gi|126226353|gb|ABN89893.1| protein TolQ [Burkholderia pseudomallei 1106a]
 gi|126241813|gb|ABO04906.1| protein TolQ [Burkholderia mallei NCTC 10247]
 gi|147746601|gb|EDK53678.1| protein TolQ [Burkholderia mallei FMH]
 gi|147751582|gb|EDK58649.1| protein TolQ [Burkholderia mallei JHU]
 gi|148025407|gb|EDK83561.1| protein TolQ [Burkholderia mallei 2002721280]
 gi|157808950|gb|EDO86120.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 406e]
 gi|157939336|gb|EDO95006.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei Pasteur 52237]
 gi|160696748|gb|EDP86718.1| tolQ protein [Burkholderia mallei ATCC 10399]
 gi|169651674|gb|EDS84367.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei S13]
 gi|184211366|gb|EDU08409.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 1655]
 gi|225933776|gb|EEH29764.1| protein TolQ [Burkholderia pseudomallei Pakistan 9]
 gi|237504440|gb|ACQ96758.1| protein TolQ [Burkholderia pseudomallei MSHR346]
 gi|238525392|gb|EEP88820.1| protein TolQ [Burkholderia mallei GB8 horse 4]
 gi|242137382|gb|EES23784.1| protein TolQ [Burkholderia pseudomallei 1106b]
 gi|243065353|gb|EES47539.1| protein TolQ [Burkholderia mallei PRL-20]
 gi|254219440|gb|EET08824.1| transporter, MotA/TolQ/ExbB proton channel family [Burkholderia
           pseudomallei 1710a]
          Length = 225

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 72/222 (32%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLVLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPALLLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLESNLSFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|85710727|ref|ZP_01041791.1| MotA/TolQ/ExbB proton channel family protein [Erythrobacter sp.
           NAP1]
 gi|85687905|gb|EAQ27910.1| MotA/TolQ/ExbB proton channel family protein [Erythrobacter sp.
           NAP1]
          Length = 240

 Score =  163 bits (411), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 59/223 (26%), Positives = 110/223 (49%), Gaps = 2/223 (0%)

Query: 5   GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFW 64
            L    +    LF++  + V+ ++  L + SI +W++I+   +    L    RE+E  FW
Sbjct: 17  SLGPTRLDPIELFLEADIVVQAVMIGLILASIWTWAIIVSFLLRIGKLNSASREYEAEFW 76

Query: 65  SGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             +  E    + +    +  A +  + + EW++S   GA      + RI   M+  +A E
Sbjct: 77  DTRDRE-AVLTKQRRAKVPSARVAGAGLDEWRRSTKGGAPDRPAARQRIGAAMESQVAEE 135

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
            +++  KL+FL +  S    VG+ G V G+M  F  I    S ++  +   I E+L +  
Sbjct: 136 ADDLAGKLNFLATTGSVAPFVGLFGTVWGIMNSFFQIGAQQSASLAVVAPGIAEALFATA 195

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +GL  +IP+ IAYN+F     ++  +++ FA++  A LSR+ +
Sbjct: 196 IGLFAAIPAVIAYNRFSNSVNQYEAKLQRFADKVHAGLSRELD 238


>gi|292898895|ref|YP_003538264.1| TolQ colicin import protein [Erwinia amylovora ATCC 49946]
 gi|291198743|emb|CBJ45852.1| TolQ colicin import protein [Erwinia amylovora ATCC 49946]
          Length = 228

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAVRDADAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  ++  +   G   IF +   E+ +       +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQSRRDELGGSEQIFYAGFKEFARLHRANNHAPEAVVEGATRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLTLRVNKLEQNYDNFMEEFTAILHRQA 221


>gi|317491194|ref|ZP_07949630.1| TolQ protein [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316920741|gb|EFV42064.1| TolQ protein [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 227

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++F LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNMFDLFLKASLLVKLIMLVLVCFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +  G+ +   R M +++ RE+
Sbjct: 61  ELSRLYQESQTRRDSLTGSEQIFHSGFKEFARLHRVNSHAADGVIEGATRAMRISLNREV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F  +       +  +   I E+LI+  +
Sbjct: 121 EGLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIGLGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K       F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYTNFMEEFIAILHRQA 221


>gi|167563916|ref|ZP_02356832.1| tolQ protein [Burkholderia oklahomensis EO147]
 gi|167571051|ref|ZP_02363925.1| tolQ protein [Burkholderia oklahomensis C6786]
          Length = 225

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 73/222 (32%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL I S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLILSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPALLLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLESNLSFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|134280048|ref|ZP_01766759.1| protein TolQ [Burkholderia pseudomallei 305]
 gi|217421193|ref|ZP_03452698.1| protein TolQ [Burkholderia pseudomallei 576]
 gi|134248055|gb|EBA48138.1| protein TolQ [Burkholderia pseudomallei 305]
 gi|217396605|gb|EEC36622.1| protein TolQ [Burkholderia pseudomallei 576]
          Length = 225

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 72/222 (32%), Positives = 117/222 (52%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL   S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLALSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPALLLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLESNLSFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|315634716|ref|ZP_07890000.1| TolQ colicin import protein [Aggregatibacter segnis ATCC 33393]
 gi|315476664|gb|EFU67412.1| TolQ colicin import protein [Aggregatibacter segnis ATCC 33393]
          Length = 229

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/222 (29%), Positives = 115/222 (51%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S       ++   FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVILILVSFSIISWAIIIQRSRVLTKALKESMAFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++++ RE+E+
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFYVGFKEFTRLKQANPDAPEAIIKGSTRAMNLSMNREIED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           I  ++ FL +++S    +G+ G V G+M  F S++G     +  +   I E+LI+  +GL
Sbjct: 124 IETRVPFLATVASISPYIGLFGTVWGIMHAFMSLSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G 
Sbjct: 184 FAAIPAVMAYNRLSLRVNKLEQNYGNFIDEFTTILHRQVFGK 225


>gi|16272333|ref|NP_438546.1| colicin transport protein [Haemophilus influenzae Rd KW20]
 gi|68248988|ref|YP_248100.1| hypothetical protein NTHI0505 [Haemophilus influenzae 86-028NP]
 gi|145628745|ref|ZP_01784545.1| TolQ [Haemophilus influenzae 22.1-21]
 gi|145636347|ref|ZP_01792016.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittHH]
 gi|148825333|ref|YP_001290086.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittEE]
 gi|229844452|ref|ZP_04464592.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae 6P18H1]
 gi|229846472|ref|ZP_04466580.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae 7P49H1]
 gi|260580552|ref|ZP_05848380.1| TolQ protein [Haemophilus influenzae RdAW]
 gi|260582351|ref|ZP_05850144.1| TolQ protein [Haemophilus influenzae NT127]
 gi|319775686|ref|YP_004138174.1| membrane spanning protein in TolA-TolQ-TolR complex [Haemophilus
           influenzae F3047]
 gi|319898093|ref|YP_004136290.1| membrane spanning protein in tola-tolq-tolr complex [Haemophilus
           influenzae F3031]
 gi|329122260|ref|ZP_08250848.1| TolQ colicin import protein [Haemophilus aegyptius ATCC 11116]
 gi|1174730|sp|P43768|TOLQ_HAEIN RecName: Full=Protein tolQ
 gi|1573355|gb|AAC22043.1| colicin transport protein (tolQ) [Haemophilus influenzae Rd KW20]
 gi|68057187|gb|AAX87440.1| TolQ [Haemophilus influenzae 86-028NP]
 gi|144979215|gb|EDJ88901.1| TolQ [Haemophilus influenzae 22.1-21]
 gi|145270512|gb|EDK10446.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittHH]
 gi|148715493|gb|ABQ97703.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittEE]
 gi|229810565|gb|EEP46283.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae 7P49H1]
 gi|229812701|gb|EEP48390.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae 6P18H1]
 gi|260092894|gb|EEW76829.1| TolQ protein [Haemophilus influenzae RdAW]
 gi|260094719|gb|EEW78614.1| TolQ protein [Haemophilus influenzae NT127]
 gi|301169087|emb|CBW28684.1| membrane spanning protein in TolA-TolQ-TolR complex [Haemophilus
           influenzae 10810]
 gi|317433599|emb|CBY81983.1| membrane spanning protein in TolA-TolQ-TolR complex [Haemophilus
           influenzae F3031]
 gi|317450277|emb|CBY86493.1| membrane spanning protein in TolA-TolQ-TolR complex [Haemophilus
           influenzae F3047]
 gi|327473821|gb|EGF19238.1| TolQ colicin import protein [Haemophilus aegyptius ATCC 11116]
          Length = 228

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 114/223 (51%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S       ++ R FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEARTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEAIIKGTMRAMNLAMNREIES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQDYGNFIDEFTTILHRQAFGKA 226


>gi|15641841|ref|NP_231473.1| tolQ protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121727659|ref|ZP_01680762.1| tolQ protein [Vibrio cholerae V52]
 gi|147674417|ref|YP_001217375.1| tolQ protein [Vibrio cholerae O395]
 gi|153820329|ref|ZP_01972996.1| tolQ protein [Vibrio cholerae NCTC 8457]
 gi|227081968|ref|YP_002810519.1| tolQ protein [Vibrio cholerae M66-2]
 gi|254848925|ref|ZP_05238275.1| tolQ protein [Vibrio cholerae MO10]
 gi|255745399|ref|ZP_05419348.1| MotA/TolQ/ExbB proton channel family protein [Vibrio cholera CIRS
           101]
 gi|262169826|ref|ZP_06037517.1| MotA/TolQ/ExbB proton channel family protein [Vibrio cholerae RC27]
 gi|298498122|ref|ZP_07007929.1| TolQ [Vibrio cholerae MAK 757]
 gi|10441437|gb|AAG17039.1|AF187269_1 TolQ [Vibrio cholerae O395]
 gi|9656366|gb|AAF94987.1| tolQ protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121630046|gb|EAX62453.1| tolQ protein [Vibrio cholerae V52]
 gi|126509124|gb|EAZ71718.1| tolQ protein [Vibrio cholerae NCTC 8457]
 gi|146316300|gb|ABQ20839.1| tolQ protein [Vibrio cholerae O395]
 gi|227009856|gb|ACP06068.1| tolQ protein [Vibrio cholerae M66-2]
 gi|227013738|gb|ACP09948.1| tolQ protein [Vibrio cholerae O395]
 gi|254844630|gb|EET23044.1| tolQ protein [Vibrio cholerae MO10]
 gi|255737229|gb|EET92625.1| MotA/TolQ/ExbB proton channel family protein [Vibrio cholera CIRS
           101]
 gi|262022060|gb|EEY40770.1| MotA/TolQ/ExbB proton channel family protein [Vibrio cholerae RC27]
 gi|297542455|gb|EFH78505.1| TolQ [Vibrio cholerae MAK 757]
          Length = 227

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 107/218 (49%), Gaps = 3/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q    VK ++  L   S+ SW+ II++S       R+   FE  FWSG  L
Sbjct: 4   DISFLDLFLQASFLVKMVMLTLLGMSVASWAAIIKRSKVISAAEREADTFEDRFWSGMDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +    +  IF +  +E+ +       +P  + +   R M VA+ARE++ 
Sbjct: 64  GALYQDVKKRKDDIYGIEEIFYAGFTEFARLRKTNPGAPDFVMEGTGRAMRVAVAREVDS 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ +AYN+      K       F+ EF  IL RQ
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHTILHRQ 221


>gi|157374993|ref|YP_001473593.1| MotA/TolQ/ExbB proton channel [Shewanella sediminis HAW-EB3]
 gi|157317367|gb|ABV36465.1| MotA/TolQ/ExbB proton channel [Shewanella sediminis HAW-EB3]
          Length = 229

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 71/219 (32%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q  L VK ++  L   S++SW+VIIQ+     T ++   +FE  FWSG  L
Sbjct: 4   DISFIGLFLQASLLVKFVMLTLLSLSVISWAVIIQRRRLLTTAKQSSIKFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K +    +    L A+F +   E+ +      + P  + D   R M V+++RE+E+
Sbjct: 64  NKLYKEISARQDGNEGLEALFHTGFKEYARLSKLNGKVPAAVMDGSYRAMRVSLSREMEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F        M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFTTQVDSIEMSYANFMEEFSSILHRQA 222


>gi|153827559|ref|ZP_01980226.1| tolQ protein [Vibrio cholerae MZO-2]
 gi|153828554|ref|ZP_01981221.1| tolQ protein [Vibrio cholerae 623-39]
 gi|254292156|ref|ZP_04962927.1| tolQ protein [Vibrio cholerae AM-19226]
 gi|297579358|ref|ZP_06941286.1| tolQ protein [Vibrio cholerae RC385]
 gi|148875949|gb|EDL74084.1| tolQ protein [Vibrio cholerae 623-39]
 gi|149738472|gb|EDM52868.1| tolQ protein [Vibrio cholerae MZO-2]
 gi|150421919|gb|EDN13895.1| tolQ protein [Vibrio cholerae AM-19226]
 gi|297536952|gb|EFH75785.1| tolQ protein [Vibrio cholerae RC385]
 gi|327484393|gb|AEA78800.1| MotA/TolQ/ExbB proton channel family protein [Vibrio cholerae
           LMA3894-4]
          Length = 227

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 107/219 (48%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q    VK ++  L   S+ SW+ II++S       R+   FE  FWSG  L
Sbjct: 4   DISFLDLFLQASFLVKMVMLTLLGMSVASWAAIIKRSKVISAAEREADTFEDRFWSGMDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +K   +    +  IF +  +E+ +       +P  + +   R M VA+ARE++ 
Sbjct: 64  GALYQDVKKRKDDIYGIEEIFYAGFTEFARLRKTNPGAPDFVMEGTGRAMRVAVAREVDS 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F+ EF  IL RQ 
Sbjct: 184 FAAIPAVMAYNRLSNKVSKLEHTYATFSEEFHTILHRQA 222


>gi|94496184|ref|ZP_01302762.1| MotA/TolQ/ExbB proton channel [Sphingomonas sp. SKA58]
 gi|94424363|gb|EAT09386.1| MotA/TolQ/ExbB proton channel [Sphingomonas sp. SKA58]
          Length = 234

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 118/219 (53%), Gaps = 2/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           IS  ALF+Q  + VK ++  L + SI +W++II  SV      ++ R+FE  FW  + ++
Sbjct: 16  ISPLALFLQADIVVKGVMIGLLLASIWTWAMIIGFSVTLRKASKESRKFEADFWKAEDID 75

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
              +  +   +   A +  + ++EW++S  +      G +DR+  +M   IA E++ +++
Sbjct: 76  RFYE-ARGKGSFPAAKVMAAGVTEWRRSTAQKVIDREGTRDRLSTVMSSTIASEVDRLSD 134

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L+ L ++ S    VG+ G V G+M  F SIA   ++++  +   I E+L +  +GL  +
Sbjct: 135 RLNILATIGSVAPFVGLFGTVWGIMRAFTSIAAEQNSSLAVVAPGIAEALFATAIGLFAA 194

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP+ IAYN+F     +    M  FA+ F + LSR+ E  
Sbjct: 195 IPAVIAYNRFSHGINRLEAAMTRFADGFYSTLSRELEAQ 233


>gi|300715886|ref|YP_003740689.1| TolQ colicin import protein [Erwinia billingiae Eb661]
 gi|299061722|emb|CAX58838.1| TolQ colicin import protein [Erwinia billingiae Eb661]
          Length = 225

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGRDADAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +       +P  + +   R M +++ RE+E +
Sbjct: 61  RLYQESQARRDELGGSEQIFYSGFKEFARLHRANNHAPEAVVEGATRAMRISLNREMEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLEQNYDNFMEEFTAILHRQA 218


>gi|84388526|ref|ZP_00991073.1| TolQ protein [Vibrio splendidus 12B01]
 gi|84377075|gb|EAP93946.1| TolQ protein [Vibrio splendidus 12B01]
          Length = 227

 Score =  162 bits (410), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +ISI  L ++  L VK ++ +L   S++SW++II++S       +Q   FE  FWSG  L
Sbjct: 4   EISILGLILEASLLVKMVMLILMGMSVVSWAMIIKRSKVLSQASKQTDVFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +      +   G   IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  AKLYQESNKRKDELSGTEEIFYAGFTEFARLRKSNATSPDFIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHSFIALGEVKQATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F     K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRFSSRVGKLEHNYATFSEEFHSILHRQA 222


>gi|295096557|emb|CBK85647.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 227

 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDNLSGSEQIFYSGFKEFARLHRANSHAPEAVVEGASRAMRISMNRELENL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|255263319|ref|ZP_05342661.1| protein TolQ [Thalassiobium sp. R2A62]
 gi|255105654|gb|EET48328.1| protein TolQ [Thalassiobium sp. R2A62]
          Length = 223

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 79/222 (35%), Positives = 126/222 (56%), Gaps = 1/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +  +D S++ALF +  + VK ++ +L I S+  W VI+ K + +   R++   F++ FWS
Sbjct: 1   MEAVDFSMWALFARATITVKLVMIMLIIASVWCWGVIVDKLIQYRNARKEAGIFDRAFWS 60

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           G+ L+ + + +    +     IF + M EW++S  +      G Q RIDR MDVAIARE 
Sbjct: 61  GEPLDGLFEKIGAEPDGPSEKIFAAGMMEWRRSHRQDGGLIAGAQARIDRAMDVAIARES 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E++ + L  L ++ S    VG+ G V G+M  F  IA  ++ N+  +   I E+L++  L
Sbjct: 121 EKLQKGLPVLATVGSTAPFVGLFGTVWGIMNAFIEIAEQHNTNLAVVAPGIAEALLATGL 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 181 GLLAAIPAVIYYNKLSADSDRIVGGYEAFADEFATILSRQLD 222


>gi|188534423|ref|YP_001908220.1| colicin uptake protein TolQ [Erwinia tasmaniensis Et1/99]
 gi|188029465|emb|CAO97342.1| TolQ colicin import protein [Erwinia tasmaniensis Et1/99]
          Length = 228

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAVRDADAFEDKFWSGM 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF +   E+ +       +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQVRRDELGGSEQIFYAGFKEFARLHRANNHAPEAVVEGATRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLTLRVNKLEQNYDNFMEEFTAILHRQA 221


>gi|87199036|ref|YP_496293.1| MotA/TolQ/ExbB proton channel [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134717|gb|ABD25459.1| Cell division and transport-associated protein TolQ
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 233

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 60/226 (26%), Positives = 116/226 (51%), Gaps = 2/226 (0%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N    A   ++   LF+     V+ ++  L + SI +W++II  S+   +++R    +E+
Sbjct: 8   NGVSFAPTSLNPVQLFLDADYVVQAVMAGLVLASIWTWTIIIGFSLKMGSVQRGCDAYER 67

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW  + ++   K      ++    +  +A++EW++S    A    G + R+   +D A+
Sbjct: 68  EFWEARDIDQFHKD-NKGKDLPSVRVVAAALTEWRRSTSGSAIDRDGTRQRLTTALDGAV 126

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
             E + +  +L+FL ++ S    VG+ G V G+M  F +I    ++++  +   I E+L 
Sbjct: 127 VAETDALASRLNFLATVGSVAPFVGLFGTVWGIMDSFFNIGAQQNSSLAVVAPGISEALF 186

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  +GL  +IP+ IAYN+F     +F  ++  FA+ F A LSR+ E
Sbjct: 187 ATAIGLFAAIPAVIAYNRFSHRVNRFETRLYRFADRFHASLSRELE 232


>gi|86146490|ref|ZP_01064813.1| TolQ protein [Vibrio sp. MED222]
 gi|218709107|ref|YP_002416728.1| TolQ protein [Vibrio splendidus LGP32]
 gi|85835753|gb|EAQ53888.1| TolQ protein [Vibrio sp. MED222]
 gi|218322126|emb|CAV18240.1| TolQ protein [Vibrio splendidus LGP32]
          Length = 227

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +ISI  L ++  L VK ++ +L   S++SW++II++S       +Q   FE  FWSG  L
Sbjct: 4   EISILGLILEASLLVKMVMLILMGMSVVSWAMIIKRSKVLSQATKQTDVFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +      +   G   IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  AKLYQESNKRKDELSGTEEIFYAGFTEFARLRKSNAASPDFIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHSFIALGEVKQATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F     K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRFSSRVGKLEHNYATFSEEFHSILHRQA 222


>gi|283479099|emb|CAY75015.1| Protein tolQ [Erwinia pyrifoliae DSM 12163]
          Length = 228

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAVRDADAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  ++  +   G   IF +   E+ +       +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQSRRDELGGSEQIFFAGFKEFARLHRANNHAPEAVVEGATRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLTLRVNKLEQNYDNFMEEFTAILHRQA 221


>gi|319941768|ref|ZP_08016090.1| TolQ [Sutterella wadsworthensis 3_1_45B]
 gi|319804701|gb|EFW01568.1| TolQ [Sutterella wadsworthensis 3_1_45B]
          Length = 223

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 104/219 (47%), Gaps = 5/219 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  L     L VK ++ +L + S+ SW+VI QK        RQ  +FE  FWSG  L
Sbjct: 6   DLSILTLIANASLVVKAVLAILIVLSLASWTVIFQKFFVVRRAMRQTDDFESRFWSGTEL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +  +     +       IF + M+E+ K             + + R M     RE++ 
Sbjct: 66  TKLLDTANRSRDTSGMEERIFAAGMNEFMKQRQTAG--AADTVNSVSRAMRAVFTREMDR 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   L  L S+ S    +G+ G V G+M  F  ++   + ++  +   I E+L++  +GL
Sbjct: 124 LENGLPMLASIGSTSPYIGLFGTVWGIMNAFTGLSSLENASLAVVAPGIAEALVATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+  AYN +     + + +++GF+ EF  IL RQ+
Sbjct: 184 FAAIPAVAAYNYYNNRVGRLSNRVDGFSEEFLNILERQS 222


>gi|304393327|ref|ZP_07375255.1| protein TolQ [Ahrensia sp. R2A130]
 gi|303294334|gb|EFL88706.1| protein TolQ [Ahrensia sp. R2A130]
          Length = 265

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 104/229 (45%), Positives = 157/229 (68%), Gaps = 3/229 (1%)

Query: 5   GLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           GLA   +D S+  LF++ GL VK ++  L + SI  W++I+ K + F  ++RQ  +FEQ+
Sbjct: 36  GLAAPTVDTSLIGLFLEAGLVVKIVMIGLIVASIWCWAIIVDKMLLFGRVKRQIDQFEQV 95

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
           FWSGQSLE + ++L      G+AA+F++AM EWK+S ++ ARSPIG+Q RID+ +DVA++
Sbjct: 96  FWSGQSLEQLYQTLSMQQQTGMAALFVAAMGEWKRSFERNARSPIGLQTRIDKQLDVAMS 155

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
           +E+E + ++L FL ++ SA   VG+ G V+G+M  FQ+IAG  S N+  +   I E+L++
Sbjct: 156 KEMETLEKRLLFLATLGSAAPFVGLFGTVVGIMTSFQAIAGSKSTNLAVVAPGIAEALLA 215

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             LGL  +IP+ IAYNK   D+ K   +MEGFA+EFSAILSRQ +   +
Sbjct: 216 TALGLLAAIPAVIAYNKLSADAGKIGNRMEGFADEFSAILSRQVDEKSA 264


>gi|149927729|ref|ZP_01915981.1| MotA/TolQ/ExbB proton channel [Limnobacter sp. MED105]
 gi|149823555|gb|EDM82785.1| MotA/TolQ/ExbB proton channel [Limnobacter sp. MED105]
          Length = 219

 Score =  162 bits (409), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 110/218 (50%), Gaps = 4/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S  +L  +  L V+ ++ +L + S++SW+ I +K       ++Q  +FE+ FWSG  L 
Sbjct: 1   MSFISLIAEASLVVQLVMLILVMISLISWATIFKKWAVLKRTKQQADKFEEEFWSGGDLN 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDK-GARSPIGIQDRIDRMMDVAIARELEE 127
           T+ +      N    L  IF + MSE+ ++ DK G      I D   R M  A  RE E 
Sbjct: 61  TLFQRAGMRRNDAGPLERIFEAGMSEFLRARDKKGLTDYSLIIDGARRAMKAAFQRENEI 120

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL S  S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL
Sbjct: 121 LERNLPFLASAGSVSPYIGLFGTVWGIMHAFVGLANVQQATLASVAPGIAEALIATAIGL 180

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ +AYN++  D  + + Q E F  EF  IL RQ
Sbjct: 181 FAAIPAVVAYNRYANDIDRLSTQFESFVEEFLNILQRQ 218


>gi|294013403|ref|YP_003546863.1| biopolymer transport protein TolQ [Sphingobium japonicum UT26S]
 gi|292676733|dbj|BAI98251.1| biopolymer transport protein TolQ [Sphingobium japonicum UT26S]
          Length = 239

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 66/219 (30%), Positives = 115/219 (52%), Gaps = 2/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           IS  ALF+Q  + VK ++  L + SI +W++II  S       RQ R FEQ FW  + ++
Sbjct: 21  ISPLALFLQADIVVKVVMLGLLLASIWTWAMIIGFSFTLRKASRQSRAFEQDFWKAEDID 80

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
              +  +       A +  + ++EW++S  +      G +DR+   M   IA E++ +++
Sbjct: 81  RFYE-ARGKSEFPAARVMAAGVTEWRRSTAQKVIDREGTRDRLSTAMSSTIAAEVDRLSD 139

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L+ L ++ S    VG+ G V G+M  F SIA   ++++  +   I E+L +  +GL  +
Sbjct: 140 RLNILATIGSVAPFVGLFGTVWGIMRAFTSIAAEQNSSLAVVAPGIAEALFATAIGLFAA 199

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP+ IAYN+F     +    +  FA+ F + LSR+ E  
Sbjct: 200 IPAVIAYNRFSHGINRMESGLTRFADGFYSTLSRELEAQ 238


>gi|300722394|ref|YP_003711680.1| inner membrane protein [Xenorhabdus nematophila ATCC 19061]
 gi|297628897|emb|CBJ89480.1| inner membrane protein required for outer membrane integrity,
           uptake of group A colicins and phage DNA [Xenorhabdus
           nematophila ATCC 19061]
          Length = 226

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 112/221 (50%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++ G  V+ I+ +L  FSI+SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKAGFLVQLIMLILIGFSIVSWAIIIQRTKILNAASREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + K  ++  +   G   IF S   E+ +     + +P  +     R M +++ RELE +
Sbjct: 61  RLYKESQSRRDSLSGAEQIFHSGFKEFARLHQANSHAPEAVITGASRAMRISLNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ +AYN+  +   K     + F  EF AIL RQ   +
Sbjct: 181 AAIPAVMAYNRLNQRVNKLEQTYDNFMEEFLAILHRQAFAS 221


>gi|157369519|ref|YP_001477508.1| colicin uptake protein TolQ [Serratia proteamaculans 568]
 gi|270263782|ref|ZP_06192051.1| hypothetical protein SOD_e04120 [Serratia odorifera 4Rx13]
 gi|293397225|ref|ZP_06641498.1| TolQ colicin import protein [Serratia odorifera DSM 4582]
 gi|157321283|gb|ABV40380.1| Tol-Pal system TolQ [Serratia proteamaculans 568]
 gi|270042666|gb|EFA15761.1| hypothetical protein SOD_e04120 [Serratia odorifera 4Rx13]
 gi|291420245|gb|EFE93501.1| TolQ colicin import protein [Serratia odorifera DSM 4582]
          Length = 224

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FS+ SW++IIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILICFSVASWAIIIQRTRILNAATRDAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQARRDSLTGSEQIFHSGFKEFARLHRANNHAPESVIEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLEQNYDNFMEEFTAILHRQA 218


>gi|145638704|ref|ZP_01794313.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittII]
 gi|145272299|gb|EDK12207.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae PittII]
 gi|309750196|gb|ADO80180.1| Outer membrane integrity protein TolQ [Haemophilus influenzae
           R2866]
          Length = 228

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 114/223 (51%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S       ++ R FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEARTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFSVGFKEFSRLKQVNPDAPEAIIKGTMRAMNLAMNREIES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQDYGNFIDEFTTILHRQAFGKA 226


>gi|261341327|ref|ZP_05969185.1| protein TolQ [Enterobacter cancerogenus ATCC 35316]
 gi|288316632|gb|EFC55570.1| protein TolQ [Enterobacter cancerogenus ATCC 35316]
          Length = 227

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAASREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +       IF S   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDNLAGSEQIFYSGFKEFARLHRANNHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|227114772|ref|ZP_03828428.1| colicin uptake protein TolQ [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 225

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +++F LF++  L VK I+ +L  FSI SW++IIQ++    +  R+   FE  FWSG  L 
Sbjct: 1   MNVFDLFLKASLLVKLIMLILICFSIASWAIIIQRTRILNSATREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQTRRDSLTGTEQIFHSGFKEFARLHRANSHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+      K     + F  EF AIL RQ 
Sbjct: 181 AAIPAVMAYNRLSLRVGKLEQNYDNFTEEFIAILHRQA 218


>gi|332993886|gb|AEF03941.1| tolQ protein [Alteromonas sp. SN2]
          Length = 230

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D++   LF+Q    V+ ++ LL   S+ SW+ I Q+S    + R + R+FE  FWSG  L
Sbjct: 4   DLTFIGLFLQASFIVQLVMLLLLGVSVASWTFIFQRSKALSSAREEMRQFEDKFWSGADL 63

Query: 70  ETVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + + L    N  G+  IF +   E+ +   K       I D   R M V ++R++EE+
Sbjct: 64  NRLYQELSARPNLSGIGTIFCAGFKEFVRLR-KSNTGTNAIVDGTYRSMRVTMSRQVEEL 122

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
             +L FL +  S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL 
Sbjct: 123 ESRLPFLATAGSISPYIGLFGTVWGIMNAFIALGEVQQATLAMVAPGIAEALIATAIGLF 182

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ IAYN+F    +K       F  EFSAIL RQ 
Sbjct: 183 AAIPAVIAYNRFSHQVEKLENSYGNFMEEFSAILHRQA 220


>gi|262276106|ref|ZP_06053915.1| MotA/TolQ/ExbB proton channel family protein [Grimontia hollisae
           CIP 101886]
 gi|262219914|gb|EEY71230.1| MotA/TolQ/ExbB proton channel family protein [Grimontia hollisae
           CIP 101886]
          Length = 228

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 111/219 (50%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  LF+Q  L VK ++ +L   SI+SW++II++S        +   FE  FWSG  L
Sbjct: 4   ELSILDLFLQASLLVKAVMLVLLGMSIVSWTMIIKRSQVLSEAFTKAERFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + ++   +   G   IF S   E+ +      + P  + +   R M V++++E+E 
Sbjct: 64  SQLFQEVQARKDKLSGSEQIFYSGFKEFARLHRSNGKVPEAVMEGTSRAMRVSLSKEVES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHAFIALGAVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      K       F  EFS+IL RQ 
Sbjct: 184 FAAIPAVMAYNRLTSKVGKLENNYINFMEEFSSILHRQA 222


>gi|145632632|ref|ZP_01788366.1| TolQ [Haemophilus influenzae 3655]
 gi|144986827|gb|EDJ93379.1| TolQ [Haemophilus influenzae 3655]
 gi|309972456|gb|ADO95657.1| Outer membrane integrity protein TolQ [Haemophilus influenzae
           R2846]
          Length = 228

 Score =  161 bits (408), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 64/223 (28%), Positives = 113/223 (50%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S       ++   FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEAHTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEAIIKGTMRAMNLAMNREIES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQDYGNFIDEFTTILHRQAFGKA 226


>gi|212634654|ref|YP_002311179.1| MotA/TolQ/ExbB proton channel [Shewanella piezotolerans WP3]
 gi|212556138|gb|ACJ28592.1| MotA/TolQ/ExbB proton channel [Shewanella piezotolerans WP3]
          Length = 229

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 74/219 (33%), Positives = 115/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DIS   LF+Q  L VK ++  L   SI SW+VI+Q+       + +  +FE  FWSG  L
Sbjct: 4   DISFIGLFLQASLLVKFVMLTLLSLSIASWAVILQRRKLLTAAKTEALKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L    +   GL A+F++   E+ +      R P  + D   R M V+++RELE+
Sbjct: 64  NKLYQELSARQDRTSGLEALFVTGFKEYARLNKLNGRVPEAVMDGSYRAMRVSLSRELEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F    +K  M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIAYNRFSTQVEKIEMSYANFMEEFSSILHRQA 222


>gi|146310893|ref|YP_001175967.1| colicin uptake protein TolQ [Enterobacter sp. 638]
 gi|145317769|gb|ABP59916.1| Cell division and transport-associated protein TolQ [Enterobacter
           sp. 638]
          Length = 227

 Score =  161 bits (408), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAASREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +       G   IF S   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRENLSGSEQIFYSGFKEFARLHRANNHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|319786282|ref|YP_004145757.1| protein TolQ [Pseudoxanthomonas suwonensis 11-1]
 gi|317464794|gb|ADV26526.1| protein TolQ [Pseudoxanthomonas suwonensis 11-1]
          Length = 258

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 69/222 (31%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  L VK I+ LL   S++SW +I +K  +F    ++  EFE  FWSG  L 
Sbjct: 36  INYLDLMLRASLPVKLIVLLLLAGSLISWVIIFRKLGSFKRADQEADEFENRFWSGADLG 95

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  +  + +    GL AIF +   E+ +  DK         +   R M VA +RE+ ++
Sbjct: 96  KLYAAATDRNRVVGGLEAIFEAGFREFTRLRDKRRHDGRAQLEGAQRAMRVAFSREVGQL 155

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 156 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSQGQQVGIASVAPGISEALFATAIGL 215

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN++     + + + E FA+EFS+IL RQT  +
Sbjct: 216 FVAIPAVWAYNRYTSRVDRLSQRYESFADEFSSILQRQTGAD 257


>gi|126737224|ref|ZP_01752959.1| proton transporter TolQ [Roseobacter sp. SK209-2-6]
 gi|126721809|gb|EBA18512.1| proton transporter TolQ [Roseobacter sp. SK209-2-6]
          Length = 231

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 84/219 (38%), Positives = 125/219 (57%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  L VK ++ +L + SI SW +I QK +N+   R +  EF+Q FWSG+ 
Sbjct: 12  IDFSMWGLFARATLTVKLVMLMLIVASIWSWGIIFQKLINYRLARSEAAEFDQAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   L    +   A IF + M+EW++S         G Q RIDR MDVAIA+E E++
Sbjct: 72  LDGLFDHLGPEPSGRAARIFAAGMAEWRRSHRSDGGLIPGAQARIDRSMDVAIAKETEDL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLSILATVGSTAPFIGLFGTVWGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRILGGYEAFADEFATILSRQLD 230


>gi|152969305|ref|YP_001334414.1| colicin uptake protein TolQ [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|262041203|ref|ZP_06014415.1| TolQ colicin import protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|329998747|ref|ZP_08303201.1| protein TolQ [Klebsiella sp. MS 92-3]
 gi|150954154|gb|ABR76184.1| inner membrane protein [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|259041432|gb|EEW42491.1| TolQ colicin import protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|328538574|gb|EGF64678.1| protein TolQ [Klebsiella sp. MS 92-3]
          Length = 227

 Score =  161 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 113/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++    +  R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNSAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  I +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDNLTGSEQIFYSGFKEFARLHRANSHAPEAIVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|254427665|ref|ZP_05041372.1| protein TolQ [Alcanivorax sp. DG881]
 gi|196193834|gb|EDX88793.1| protein TolQ [Alcanivorax sp. DG881]
          Length = 228

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 68/228 (29%), Positives = 112/228 (49%), Gaps = 4/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+S+ +L     + V+ ++ LL + S+ SW +I+ +        R  R FE+ FWS
Sbjct: 2   VEASDMSVVSLISHATIVVQLVMALLILASLTSWYMIVGRFRVLGRAHRAGRAFEEKFWS 61

Query: 66  GQSLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
              L ++    +   +   G  AIF +   E+ +   K  R    + D   R M VA+ R
Sbjct: 62  SDDLASLYNQSRKDPDVDSGTEAIFRAGFQEFVRLS-KSTRGAEAVMDGAQRAMRVALQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISI 182
           E   +T+ L FL ++ S    VG+ G V G+M  F ++A      +  +   I E+LI+ 
Sbjct: 121 EQTRLTKHLPFLATVGSTSPYVGLFGTVWGIMNSFMALANVKQATLSVVAPGIAEALIAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +GL  +IP+ +AYN+F   S     + E FA EFS++L RQ  G  +
Sbjct: 181 AIGLFAAIPAVMAYNRFSAQSDALLTENEMFAEEFSSVLHRQAHGREA 228


>gi|145630444|ref|ZP_01786225.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae R3021]
 gi|144984179|gb|EDJ91616.1| long-chain-fatty-acid--CoA ligase [Haemophilus influenzae R3021]
          Length = 228

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 114/223 (51%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S       ++ R FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEARTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L N  +   G   IF     E+ +       +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYEGLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEAIIKGTMRAMNLAMNREIES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQDYVNFIDEFTTILHRQAFGKA 226


>gi|254521584|ref|ZP_05133639.1| protein TolQ [Stenotrophomonas sp. SKA14]
 gi|219719175|gb|EED37700.1| protein TolQ [Stenotrophomonas sp. SKA14]
          Length = 259

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 69/222 (31%), Positives = 109/222 (49%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L  +  L VK I+ LL + S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYLELMAKASLPVKIIVLLLLVGSFVSWVIIFRKARVFKQATREADEFENRFWSGADLG 96

Query: 71  TVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +       L AIF +   E+ +  DK         +   R M     RE++++
Sbjct: 97  KLYSSATDRSRNVGGLEAIFEAGFREYTRLRDKRRLDGRAQLEGAQRAMRTTYTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +    +        PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGAQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA EFS+IL RQ+ G+
Sbjct: 217 FVAIPAVWAYNRFTTRVERMSVRFETFAEEFSSILQRQSAGD 258


>gi|148262289|ref|YP_001228995.1| MotA/TolQ/ExbB proton channel [Geobacter uraniireducens Rf4]
 gi|146395789|gb|ABQ24422.1| Cell division and transport-associated protein TolQ [Geobacter
           uraniireducens Rf4]
          Length = 224

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 59/219 (26%), Positives = 100/219 (45%), Gaps = 9/219 (4%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
             +F   GL VK ++ +L  FS++SW++I  K +       +   F + FW  +  + + 
Sbjct: 1   MEIFATTGLVVKLVLFILLYFSVVSWAIIFYKLLQVHRANSESERFLEFFWKAKRFDAIN 60

Query: 74  KSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPI--------GIQDRIDRMMDVAIAREL 125
             L    N  L  +F     E KK  +KG             G  D I R +  A   E+
Sbjct: 61  AQLDRFANSPLTVLFNEGYGEMKKLMEKGEEKQDPTIISTELGGIDNISRALRRATTSEI 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             + + L+FL +  S    +G+ G V G+M  F+ I    S ++  +   I E+LI+  +
Sbjct: 121 TRLEKYLTFLATTGSTAPFIGLFGTVWGIMTAFKGIGETGSASLAVVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           GL  +IP+ + YN F +  +    +M+ F+ EF  I+ R
Sbjct: 181 GLVAAIPAVMGYNHFQQKIRVLIAEMDSFSTEFLNIVQR 219


>gi|283833966|ref|ZP_06353707.1| protein TolQ [Citrobacter youngae ATCC 29220]
 gi|291070097|gb|EFE08206.1| protein TolQ [Citrobacter youngae ATCC 29220]
          Length = 227

 Score =  161 bits (407), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAASREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +       IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDNLAGSEQIFYSGFKEFARLHRANSHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|291616737|ref|YP_003519479.1| TolQ [Pantoea ananatis LMG 20103]
 gi|291151767|gb|ADD76351.1| TolQ [Pantoea ananatis LMG 20103]
          Length = 228

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNVLDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREADAFEDKFWSGV 60

Query: 68  SLETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +           IF +   E+ +       +P    +   R M +++ REL
Sbjct: 61  ELSRLYQESQARREELAGSEQIFYAGFKEFARLHRVNNHAPEAAVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQGYDNFMEEFTAILHRQA 221


>gi|163751260|ref|ZP_02158488.1| MotA/TolQ/ExbB proton channel family protein [Shewanella benthica
           KT99]
 gi|161328974|gb|EDQ00048.1| MotA/TolQ/ExbB proton channel family protein [Shewanella benthica
           KT99]
          Length = 229

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           DISI  LF+Q  + VK ++  L   S++SW+VIIQ+S      ++   +FE  FWSG  L
Sbjct: 4   DISIIGLFLQASILVKFVMLTLLGLSVMSWAVIIQRSRLLSAAKKNVLKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L    +    L  +F +   E+ +     ++ P  + +   R M V+++RE+E+
Sbjct: 64  NKLYKELSVRQDSNTGLETLFHTGFKEYARLSKLNSKVPDAVMNGSYRAMRVSLSREMEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F +I    +  + +  PGI E+LI+  +GL
Sbjct: 124 LETHLPLLATIGSTSPYIGLFGTVWGIMNSFIAIGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ I YN+F        M    F  EFS+IL RQ 
Sbjct: 184 FAAIPAVIGYNRFTTLVDSVEMSYANFMEEFSSILHRQA 222


>gi|74318227|ref|YP_315967.1| MotA/TolQ/ExbB proton channel family protein [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057722|gb|AAZ98162.1| MotA/TolQ/ExbB proton channel family [Thiobacillus denitrificans
           ATCC 25259]
          Length = 231

 Score =  161 bits (406), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 69/233 (29%), Positives = 105/233 (45%), Gaps = 5/233 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN       D+S+  L +   L V+ ++ LL   S++SW  I  K        R    FE
Sbjct: 1   MNPD--ISQDLSLLHLILNASLPVQIVMLLLLGASLMSWWYIFIKMFALKRALRVTDRFE 58

Query: 61  QLFWSGQSLETVCKS--LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
             FW G  +  + +           +  IF +   E+ K   +   S   I D   R M 
Sbjct: 59  HEFWGGGDIHAMYERVAAGREEASEMERIFEAGFREFMKLRQQAGLSLNVIIDGTRRAMR 118

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            +  REL+ +   L+FL ++ S    VG+ G V G+M  FQ +A      +    PGI E
Sbjct: 119 ASYQRELDALESHLAFLATVGSVSPYVGLFGTVWGIMLAFQGLATVAQATLAQVAPGIAE 178

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +LI+  +GL  +IP+ + YN++  D  + A +ME F  EFS IL RQ     +
Sbjct: 179 ALIATAMGLFAAIPAVVGYNRYTHDVDRLANRMESFMEEFSNILQRQVTQRPA 231


>gi|295688120|ref|YP_003591813.1| protein TolQ [Caulobacter segnis ATCC 21756]
 gi|295430023|gb|ADG09195.1| protein TolQ [Caulobacter segnis ATCC 21756]
          Length = 231

 Score =  161 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 77/226 (34%), Positives = 121/226 (53%), Gaps = 3/226 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  + S FALFMQ    VK ++  L + S+ SW+VI+ K   F  L R    FE+    G
Sbjct: 6   AAPNFSFFALFMQADWVVKGVMIGLILASLGSWAVILDKLFRFTNLNRAADRFEEQVSGG 65

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWK--KSCDKGARSPIGIQDRIDRMMDVAIARE 124
           +SLE V      +    L  +  +A+ EW+  K+          +  RIDR++D  IARE
Sbjct: 66  RSLEDVAGEAGANPPHALPRMLQAALKEWREAKTRAMTENQTAFLVARIDRILDTMIARE 125

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISIL 183
             ++ E L  L  +++A   +G+ G V G+M  FQ+IA   + ++  + P I E+L +  
Sbjct: 126 TAKVEEGLGSLAIVATASPFIGLFGTVWGIMHAFQNIALSKNTSLAVVAPSIAEALFATA 185

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           +GL  +IP+ IAYNKF  D+ K+A ++EGFA++ S  + R+     
Sbjct: 186 VGLIAAIPAYIAYNKFSTDAGKYAGRLEGFADDLSTAIQRRLTERA 231


>gi|327480559|gb|AEA83869.1| tolQ protein [Pseudomonas stutzeri DSM 4166]
          Length = 237

 Score =  161 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 59/220 (26%), Positives = 108/220 (49%), Gaps = 4/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S++ L  +  L V+ ++ +L + S+ SW +II++S       R  R F+Q F  G  L 
Sbjct: 8   MSVWGLISEASLVVQAVMVILVLASVSSWYLIIRRSAALHRSERLLRSFQQRFRQGGDLA 67

Query: 71  TVCKSLKNHH---NIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            + +  +         L  IF++   E+ +   +   +P  + + ++R + VAIA + E 
Sbjct: 68  QLYREGQQQPLPEEAALQRIFLAGYGEFAQLQREAGIAPDAVAEGVERSLYVAIAEQEER 127

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL
Sbjct: 128 LEKGLQFLATVGSVSPYIGLFGTVWGIMNSFLGLSQVQQATLSTVAPGIAEALIATAIGL 187

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ +AYN+F    +    +   F NE  A L R+  
Sbjct: 188 FAAIPAVMAYNRFAARGQTLVGRYYAFGNELQARLHRRLH 227


>gi|190575565|ref|YP_001973410.1| putative TolQ transport transmembrane protein [Stenotrophomonas
           maltophilia K279a]
 gi|190013487|emb|CAQ47122.1| putative TolQ transport transmembrane protein [Stenotrophomonas
           maltophilia K279a]
          Length = 259

 Score =  161 bits (406), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 109/222 (49%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L  +  L VK I+ LL + S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYLELMAKASLPVKIIVLLLLVGSFVSWVIIFRKARVFKQATREADEFENRFWSGADLG 96

Query: 71  TVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  +  +       L AIF +   E+ +  DK         +   R M     RE++++
Sbjct: 97  KLYSAATDRSRSVTGLEAIFEAGFREYTRLRDKRRLDGRAQLEGAQRAMRTTYTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +    +        PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGAQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA EFS+IL RQ+ G+
Sbjct: 217 FVAIPAVWAYNRFTTRVERMSVRFETFAEEFSSILQRQSAGD 258


>gi|308050001|ref|YP_003913567.1| Cell division and transport-associated protein TolQ [Ferrimonas
           balearica DSM 9799]
 gi|307632191|gb|ADN76493.1| Cell division and transport-associated protein TolQ [Ferrimonas
           balearica DSM 9799]
          Length = 230

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 114/221 (51%), Gaps = 4/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             +IS   LF++  L VK ++  L + S+ +W+VI Q+       +R+ + FE  FWSG 
Sbjct: 2   PAEISFIGLFLEASLLVKLVMIFLLLMSVAAWTVIFQRQKALKEAQRRAQRFEDRFWSGV 61

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + + L  +   N GL  +F +   E+ +   K +RS   + D   R M V+++RE+
Sbjct: 62  DLNRLYQELSARGDQNSGLELMFTNGFKEYARLS-KSSRSAEAVMDGSYRAMRVSLSREV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           +++ + L  L ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 DKLEQHLPMLATIGSTSPYIGLFGTVWGIMNSFIALGSVQHATLNMVAPGIAEALIATAM 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ I +N+F    +K       F +EFSAIL RQ 
Sbjct: 181 GLFAAIPAVIFFNRFSTRVEKLENSYANFMDEFSAILHRQA 221


>gi|320539142|ref|ZP_08038813.1| membrane spanning protein in TolA-TolQ-TolR complex [Serratia
           symbiotica str. Tucson]
 gi|320030780|gb|EFW12788.1| membrane spanning protein in TolA-TolQ-TolR complex [Serratia
           symbiotica str. Tucson]
          Length = 227

 Score =  161 bits (406), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 111/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FS+ SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILICFSVASWAIIIQRTRILNAATRDAEAFEDKFWSGV 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF +   E+ +       +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQARRDSLTGSEQIFYAGFKEFARLHRANKHAPESVIEGALRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   +SFLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 EALENHISFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLHMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K       F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKIEQNYGNFMEEFTAILHRQA 221


>gi|284007873|emb|CBA73790.1| biopolymer transport protein [Arsenophonus nasoniae]
          Length = 224

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++    V+ I+ +L  FSI SW++IIQ+S       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASFLVQLIMLILIGFSIASWAIIIQRSKILNAATRETEAFEDRFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + K  +   +   G   IF S   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYKECQARRDSLTGSEQIFYSGFKEFARLRQANLHTPEAVMNGASRAMRISMNRELESL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 EAHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGSVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ +AYN+  +   K     + F  EF AIL RQ   +
Sbjct: 181 AAIPAVMAYNRLNQRVNKLEQSYDNFMEEFLAILHRQAFAS 221


>gi|148261884|ref|YP_001236011.1| MotA/TolQ/ExbB proton channel [Acidiphilium cryptum JF-5]
 gi|326405388|ref|YP_004285470.1| protein TolQ [Acidiphilium multivorum AIU301]
 gi|146403565|gb|ABQ32092.1| Cell division and transport-associated protein TolQ [Acidiphilium
           cryptum JF-5]
 gi|325052250|dbj|BAJ82588.1| protein TolQ [Acidiphilium multivorum AIU301]
          Length = 238

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 81/233 (34%), Positives = 128/233 (54%), Gaps = 5/233 (2%)

Query: 1   MNNYGLAI--MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           +N  GLA    ++S+  +F+  G  V+ +I LL   S+  W++II+KS++   + R+   
Sbjct: 5   VNTAGLAAPGTNLSLLGMFLHAGFVVQVVIVLLLAASVWVWAIIIEKSLSIRRVNREANA 64

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRM 116
           FE  FWSG+SL+ +           +AA+F +AM EW++S            + +RIDR 
Sbjct: 65  FEDKFWSGRSLDELYDQEGAEPGHPMAAVFGAAMGEWRRSSRIAGADVVRSSVAERIDRA 124

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           M V   RE+E +   + FL S+ +    VG+ G V G+M  F +IA  ++ N+  +   I
Sbjct: 125 MGVTTMREMERLERYMVFLASIGAVAPFVGLFGTVWGIMHSFSAIAAMHNTNLAVVAPGI 184

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            E+L +  +GL  +IP+ +AYNK   D  + A ++E F  EFSAILSRQ E  
Sbjct: 185 AEALFATAIGLVAAIPAVLAYNKLSTDLARLAARLEAFGAEFSAILSRQAEER 237


>gi|160872695|ref|ZP_02062827.1| protein TolQ [Rickettsiella grylli]
 gi|159121494|gb|EDP46832.1| protein TolQ [Rickettsiella grylli]
          Length = 233

 Score =  160 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 68/228 (29%), Positives = 114/228 (50%), Gaps = 4/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           ++ +D S+++ F      VKC++ +L + SILSWS+I Q        R++  +FE  FWS
Sbjct: 1   MSTIDPSLWSYFSAASGIVKCVMFILLVASILSWSMIFQYGFILRRSRKRLAQFENKFWS 60

Query: 66  GQSLETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G  L  +   L        GLA+IF +   E+ +     +  P  I + + R M +A + 
Sbjct: 61  GIELSKLYTELNREQEQQNGLASIFHAGFREFVRLDQHVSDVPAVIMEGVQRAMRIAYSE 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLIS 181
           + + + + L FL ++ S    +G+ G V G+M  F +++         +  PGI E+L++
Sbjct: 121 QHQLLEKHLDFLATLGSTSPYIGLFGTVWGIMTAFHALSASQQTATIAMVAPGIAEALVA 180

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +GL V+IP+ I YN++    +        F  EFS IL RQ  GN 
Sbjct: 181 TAMGLFVAIPAVIFYNRYAHQIQHLLHHYHRFQEEFSTILYRQIHGNA 228


>gi|26246706|ref|NP_752746.1| colicin uptake protein TolQ [Escherichia coli CFT073]
 gi|91209771|ref|YP_539757.1| colicin uptake protein TolQ [Escherichia coli UTI89]
 gi|117622928|ref|YP_851841.1| colicin uptake protein TolQ [Escherichia coli APEC O1]
 gi|191174066|ref|ZP_03035582.1| protein TolQ [Escherichia coli F11]
 gi|215485759|ref|YP_002328190.1| colicin uptake protein TolQ [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218557650|ref|YP_002390563.1| colicin uptake protein TolQ [Escherichia coli S88]
 gi|218688528|ref|YP_002396740.1| colicin uptake protein TolQ [Escherichia coli ED1a]
 gi|227884296|ref|ZP_04002101.1| colicin uptake protein TolQ [Escherichia coli 83972]
 gi|237707300|ref|ZP_04537781.1| colicin uptake protein TolQ [Escherichia sp. 3_2_53FAA]
 gi|300992348|ref|ZP_07179871.1| protein TolQ [Escherichia coli MS 200-1]
 gi|300993163|ref|ZP_07180246.1| protein TolQ [Escherichia coli MS 45-1]
 gi|301051343|ref|ZP_07198166.1| protein TolQ [Escherichia coli MS 185-1]
 gi|306812856|ref|ZP_07447049.1| colicin uptake protein TolQ [Escherichia coli NC101]
 gi|331645888|ref|ZP_08346991.1| protein TolQ [Escherichia coli M605]
 gi|331656755|ref|ZP_08357717.1| protein TolQ [Escherichia coli TA206]
 gi|331682167|ref|ZP_08382789.1| protein TolQ [Escherichia coli H299]
 gi|26107105|gb|AAN79289.1|AE016757_193 TolQ protein [Escherichia coli CFT073]
 gi|91071345|gb|ABE06226.1| TolQ protein [Escherichia coli UTI89]
 gi|115512052|gb|ABJ00127.1| TolQ protein [Escherichia coli APEC O1]
 gi|190905674|gb|EDV65297.1| protein TolQ [Escherichia coli F11]
 gi|215263831|emb|CAS08169.1| membrane spanning protein TolQ in TolA-TolQ-TolR complex
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218364419|emb|CAR02099.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli S88]
 gi|218426092|emb|CAR06910.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli ED1a]
 gi|222032473|emb|CAP75212.1| Protein tolQ [Escherichia coli LF82]
 gi|226898510|gb|EEH84769.1| colicin uptake protein TolQ [Escherichia sp. 3_2_53FAA]
 gi|227839048|gb|EEJ49514.1| colicin uptake protein TolQ [Escherichia coli 83972]
 gi|281177880|dbj|BAI54210.1| TolQ protein [Escherichia coli SE15]
 gi|294489766|gb|ADE88522.1| protein TolQ [Escherichia coli IHE3034]
 gi|300297005|gb|EFJ53390.1| protein TolQ [Escherichia coli MS 185-1]
 gi|300305365|gb|EFJ59885.1| protein TolQ [Escherichia coli MS 200-1]
 gi|300406693|gb|EFJ90231.1| protein TolQ [Escherichia coli MS 45-1]
 gi|305853619|gb|EFM54058.1| colicin uptake protein TolQ [Escherichia coli NC101]
 gi|312945261|gb|ADR26088.1| colicin uptake protein TolQ [Escherichia coli O83:H1 str. NRG 857C]
 gi|315287148|gb|EFU46560.1| protein TolQ [Escherichia coli MS 110-3]
 gi|315292651|gb|EFU52003.1| protein TolQ [Escherichia coli MS 153-1]
 gi|315299260|gb|EFU58512.1| protein TolQ [Escherichia coli MS 16-3]
 gi|323953137|gb|EGB49004.1| TolQ protein [Escherichia coli H252]
 gi|323958481|gb|EGB54187.1| TolQ protein [Escherichia coli H263]
 gi|324009569|gb|EGB78788.1| protein TolQ [Escherichia coli MS 57-2]
 gi|324010460|gb|EGB79679.1| protein TolQ [Escherichia coli MS 60-1]
 gi|331044640|gb|EGI16767.1| protein TolQ [Escherichia coli M605]
 gi|331055003|gb|EGI27012.1| protein TolQ [Escherichia coli TA206]
 gi|331080591|gb|EGI51767.1| protein TolQ [Escherichia coli H299]
          Length = 230

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGKRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|290474102|ref|YP_003466978.1| inner membrane protein required for outer membrane integrity,
           uptake of group A colicins and phage DNA [Xenorhabdus
           bovienii SS-2004]
 gi|289173411|emb|CBJ80188.1| inner membrane protein required for outer membrane integrity,
           uptake of group A colicins and phage DNA [Xenorhabdus
           bovienii SS-2004]
          Length = 226

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++ G  V+ I+ +L  FSI+SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKAGFLVQLIMLILIGFSIVSWAIIIQRTRILNAATREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + K  ++  +   G   IF S   E+ +     +  P  +     R M +++ RELE +
Sbjct: 61  RLYKESQSRRDSLNGTEQIFHSGFKEFARLHQVNSHVPEAVITGASRAMRISMNRELETV 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 AAIPAVMAYNRLSQRVNKLEQIYDNFMEEFLAILHRQA 218


>gi|238752124|ref|ZP_04613607.1| hypothetical protein yrohd0001_520 [Yersinia rohdei ATCC 43380]
 gi|238785866|ref|ZP_04629834.1| hypothetical protein yberc0001_38220 [Yersinia bercovieri ATCC
           43970]
 gi|238797733|ref|ZP_04641227.1| hypothetical protein ymoll0001_12410 [Yersinia mollaretii ATCC
           43969]
 gi|238709701|gb|EEQ01936.1| hypothetical protein yrohd0001_520 [Yersinia rohdei ATCC 43380]
 gi|238713236|gb|EEQ05280.1| hypothetical protein yberc0001_38220 [Yersinia bercovieri ATCC
           43970]
 gi|238718374|gb|EEQ10196.1| hypothetical protein ymoll0001_12410 [Yersinia mollaretii ATCC
           43969]
          Length = 228

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 70/225 (31%), Positives = 112/225 (49%), Gaps = 3/225 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MADMNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + D   R M +++ REL
Sbjct: 61  ELSRLYQESQARRDTLGGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +
Sbjct: 121 EALETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ   + 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFIAILHRQAFASA 225


>gi|15800453|ref|NP_286465.1| colicin uptake protein TolQ [Escherichia coli O157:H7 EDL933]
 gi|15830026|ref|NP_308799.1| colicin uptake protein TolQ [Escherichia coli O157:H7 str. Sakai]
 gi|16128712|ref|NP_415265.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli str. K-12 substr. MG1655]
 gi|24111987|ref|NP_706497.1| colicin uptake protein TolQ [Shigella flexneri 2a str. 301]
 gi|30062100|ref|NP_836271.1| colicin uptake protein TolQ [Shigella flexneri 2a str. 2457T]
 gi|74311261|ref|YP_309680.1| colicin uptake protein TolQ [Shigella sonnei Ss046]
 gi|82543164|ref|YP_407111.1| colicin uptake protein TolQ [Shigella boydii Sb227]
 gi|89107595|ref|AP_001375.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli str. K-12 substr. W3110]
 gi|157156530|ref|YP_001461898.1| colicin uptake protein TolQ [Escherichia coli E24377A]
 gi|157160220|ref|YP_001457538.1| colicin uptake protein TolQ [Escherichia coli HS]
 gi|168757202|ref|ZP_02782209.1| protein TolQ [Escherichia coli O157:H7 str. EC4401]
 gi|168765423|ref|ZP_02790430.1| protein TolQ [Escherichia coli O157:H7 str. EC4501]
 gi|168779232|ref|ZP_02804239.1| protein TolQ [Escherichia coli O157:H7 str. EC4076]
 gi|168786903|ref|ZP_02811910.1| protein TolQ [Escherichia coli O157:H7 str. EC869]
 gi|170080404|ref|YP_001729724.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170681028|ref|YP_001742848.1| colicin uptake protein TolQ [Escherichia coli SMS-3-5]
 gi|187733296|ref|YP_001879394.1| colicin uptake protein TolQ [Shigella boydii CDC 3083-94]
 gi|188025332|ref|ZP_02777768.2| protein TolQ [Escherichia coli O157:H7 str. EC4113]
 gi|188492595|ref|ZP_02999865.1| protein TolQ [Escherichia coli 53638]
 gi|189402927|ref|ZP_02792196.2| protein TolQ [Escherichia coli O157:H7 str. EC4486]
 gi|191169780|ref|ZP_03031423.1| protein TolQ [Escherichia coli B7A]
 gi|194429041|ref|ZP_03061572.1| protein TolQ [Escherichia coli B171]
 gi|194439232|ref|ZP_03071312.1| protein TolQ [Escherichia coli 101-1]
 gi|195939089|ref|ZP_03084471.1| colicin uptake protein TolQ [Escherichia coli O157:H7 str. EC4024]
 gi|208805902|ref|ZP_03248239.1| protein TolQ [Escherichia coli O157:H7 str. EC4206]
 gi|208815454|ref|ZP_03256633.1| protein TolQ [Escherichia coli O157:H7 str. EC4045]
 gi|208823284|ref|ZP_03263602.1| protein TolQ [Escherichia coli O157:H7 str. EC4042]
 gi|209398857|ref|YP_002269371.1| protein TolQ [Escherichia coli O157:H7 str. EC4115]
 gi|209917988|ref|YP_002292072.1| colicin uptake protein TolQ [Escherichia coli SE11]
 gi|217326027|ref|ZP_03442111.1| protein TolQ [Escherichia coli O157:H7 str. TW14588]
 gi|218553264|ref|YP_002386177.1| colicin uptake protein TolQ [Escherichia coli IAI1]
 gi|218694161|ref|YP_002401828.1| colicin uptake protein TolQ [Escherichia coli 55989]
 gi|218699109|ref|YP_002406738.1| colicin uptake protein TolQ [Escherichia coli IAI39]
 gi|218704064|ref|YP_002411583.1| colicin uptake protein TolQ [Escherichia coli UMN026]
 gi|238900002|ref|YP_002925798.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli BW2952]
 gi|253774292|ref|YP_003037123.1| colicin uptake protein TolQ [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254160807|ref|YP_003043915.1| colicin uptake protein TolQ [Escherichia coli B str. REL606]
 gi|254791894|ref|YP_003076731.1| colicin uptake protein TolQ [Escherichia coli O157:H7 str. TW14359]
 gi|256023660|ref|ZP_05437525.1| colicin uptake protein TolQ [Escherichia sp. 4_1_40B]
 gi|260842943|ref|YP_003220721.1| membrane spanning protein TolQ [Escherichia coli O103:H2 str.
           12009]
 gi|260853972|ref|YP_003227863.1| membrane spanning protein TolQ [Escherichia coli O26:H11 str.
           11368]
 gi|260866868|ref|YP_003233270.1| membrane spanning protein TolQ [Escherichia coli O111:H- str.
           11128]
 gi|261224448|ref|ZP_05938729.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261254561|ref|ZP_05947094.1| membrane spanning protein TolQ [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281680|ref|YP_003498498.1| Inner membrane protein [Escherichia coli O55:H7 str. CB9615]
 gi|300816386|ref|ZP_07096608.1| protein TolQ [Escherichia coli MS 107-1]
 gi|300822974|ref|ZP_07103109.1| protein TolQ [Escherichia coli MS 119-7]
 gi|300900744|ref|ZP_07118893.1| protein TolQ [Escherichia coli MS 198-1]
 gi|300906996|ref|ZP_07124665.1| protein TolQ [Escherichia coli MS 84-1]
 gi|300918398|ref|ZP_07134998.1| protein TolQ [Escherichia coli MS 115-1]
 gi|300926141|ref|ZP_07141954.1| protein TolQ [Escherichia coli MS 182-1]
 gi|300929457|ref|ZP_07144925.1| protein TolQ [Escherichia coli MS 187-1]
 gi|300937792|ref|ZP_07152588.1| protein TolQ [Escherichia coli MS 21-1]
 gi|300947182|ref|ZP_07161392.1| protein TolQ [Escherichia coli MS 116-1]
 gi|300957686|ref|ZP_07169875.1| protein TolQ [Escherichia coli MS 175-1]
 gi|301020791|ref|ZP_07184855.1| protein TolQ [Escherichia coli MS 69-1]
 gi|301027081|ref|ZP_07190453.1| protein TolQ [Escherichia coli MS 196-1]
 gi|301305225|ref|ZP_07211323.1| protein TolQ [Escherichia coli MS 124-1]
 gi|301327930|ref|ZP_07221101.1| protein TolQ [Escherichia coli MS 78-1]
 gi|301648042|ref|ZP_07247809.1| protein TolQ [Escherichia coli MS 146-1]
 gi|307137350|ref|ZP_07496706.1| colicin uptake protein TolQ [Escherichia coli H736]
 gi|307314798|ref|ZP_07594392.1| protein TolQ [Escherichia coli W]
 gi|309797452|ref|ZP_07691844.1| protein TolQ [Escherichia coli MS 145-7]
 gi|331641238|ref|ZP_08342373.1| protein TolQ [Escherichia coli H736]
 gi|331651745|ref|ZP_08352764.1| protein TolQ [Escherichia coli M718]
 gi|331662097|ref|ZP_08363020.1| protein TolQ [Escherichia coli TA143]
 gi|331667104|ref|ZP_08367969.1| protein TolQ [Escherichia coli TA271]
 gi|331672259|ref|ZP_08373050.1| protein TolQ [Escherichia coli TA280]
 gi|331676419|ref|ZP_08377116.1| protein TolQ [Escherichia coli H591]
 gi|332282414|ref|ZP_08394827.1| membrane-spanning inner membrane protein [Shigella sp. D9]
 gi|78103355|sp|P0ABV0|TOLQ_ECO57 RecName: Full=Protein tolQ
 gi|78103356|sp|P0ABU9|TOLQ_ECOLI RecName: Full=Protein tolQ
 gi|78103357|sp|P0ABV1|TOLQ_SHIFL RecName: Full=Protein tolQ
 gi|12513670|gb|AAG55073.1|AE005252_9 inner membrane protein, membrane-spanning, maintains integrity of
           cell envelope; tolerance to group A colicins
           [Escherichia coli O157:H7 str. EDL933]
 gi|1128978|gb|AAA83919.1| ORF 2; putative [Escherichia coli]
 gi|1651329|dbj|BAA35403.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli str. K12 substr. W3110]
 gi|1786958|gb|AAC73831.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13360231|dbj|BAB34195.1| inner membrane protein TolQ [Escherichia coli O157:H7 str. Sakai]
 gi|24050800|gb|AAN42204.1| inner membrane protein TolQ [Shigella flexneri 2a str. 301]
 gi|30040344|gb|AAP16077.1| inner membrane protein TolQ [Shigella flexneri 2a str. 2457T]
 gi|73854738|gb|AAZ87445.1| membrane-spanning inner membrane protein [Shigella sonnei Ss046]
 gi|81244575|gb|ABB65283.1| TolQ [Shigella boydii Sb227]
 gi|157065900|gb|ABV05155.1| protein TolQ [Escherichia coli HS]
 gi|157078560|gb|ABV18268.1| protein TolQ [Escherichia coli E24377A]
 gi|169888239|gb|ACB01946.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170518746|gb|ACB16924.1| protein TolQ [Escherichia coli SMS-3-5]
 gi|187430288|gb|ACD09562.1| protein TolQ [Shigella boydii CDC 3083-94]
 gi|188013541|gb|EDU51663.1| protein TolQ [Escherichia coli O157:H7 str. EC4113]
 gi|188487794|gb|EDU62897.1| protein TolQ [Escherichia coli 53638]
 gi|189002913|gb|EDU71899.1| protein TolQ [Escherichia coli O157:H7 str. EC4076]
 gi|189355762|gb|EDU74181.1| protein TolQ [Escherichia coli O157:H7 str. EC4401]
 gi|189363406|gb|EDU81825.1| protein TolQ [Escherichia coli O157:H7 str. EC4486]
 gi|189364863|gb|EDU83279.1| protein TolQ [Escherichia coli O157:H7 str. EC4501]
 gi|189373046|gb|EDU91462.1| protein TolQ [Escherichia coli O157:H7 str. EC869]
 gi|190900178|gb|EDV60084.1| protein TolQ [Escherichia coli B7A]
 gi|194412872|gb|EDX29163.1| protein TolQ [Escherichia coli B171]
 gi|194421817|gb|EDX37824.1| protein TolQ [Escherichia coli 101-1]
 gi|208725703|gb|EDZ75304.1| protein TolQ [Escherichia coli O157:H7 str. EC4206]
 gi|208732102|gb|EDZ80790.1| protein TolQ [Escherichia coli O157:H7 str. EC4045]
 gi|208737477|gb|EDZ85161.1| protein TolQ [Escherichia coli O157:H7 str. EC4042]
 gi|209160257|gb|ACI37690.1| protein TolQ [Escherichia coli O157:H7 str. EC4115]
 gi|209776408|gb|ACI86516.1| inner membrane protein TolQ [Escherichia coli]
 gi|209776410|gb|ACI86517.1| inner membrane protein TolQ [Escherichia coli]
 gi|209776412|gb|ACI86518.1| inner membrane protein TolQ [Escherichia coli]
 gi|209776414|gb|ACI86519.1| inner membrane protein TolQ [Escherichia coli]
 gi|209776416|gb|ACI86520.1| inner membrane protein TolQ [Escherichia coli]
 gi|209911247|dbj|BAG76321.1| TolQ protein [Escherichia coli SE11]
 gi|217322248|gb|EEC30672.1| protein TolQ [Escherichia coli O157:H7 str. TW14588]
 gi|218350893|emb|CAU96591.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli 55989]
 gi|218360032|emb|CAQ97579.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli IAI1]
 gi|218369095|emb|CAR16849.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli IAI39]
 gi|218431161|emb|CAR12037.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli UMN026]
 gi|238861744|gb|ACR63742.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli BW2952]
 gi|242376499|emb|CAQ31203.1| tolQ, subunit of The Tol-Pal Cell Envelope Complex, Colicin S4
           Transport System and The Colicin A Import System
           [Escherichia coli BL21(DE3)]
 gi|253325336|gb|ACT29938.1| protein TolQ [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972708|gb|ACT38379.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli B str. REL606]
 gi|253976902|gb|ACT42572.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli BL21(DE3)]
 gi|254591294|gb|ACT70655.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli O157:H7 str. TW14359]
 gi|257752621|dbj|BAI24123.1| membrane spanning protein TolQ [Escherichia coli O26:H11 str.
           11368]
 gi|257758090|dbj|BAI29587.1| membrane spanning protein TolQ [Escherichia coli O103:H2 str.
           12009]
 gi|257763224|dbj|BAI34719.1| membrane spanning protein TolQ [Escherichia coli O111:H- str.
           11128]
 gi|260450109|gb|ACX40531.1| protein TolQ [Escherichia coli DH1]
 gi|281599947|gb|ADA72931.1| Inner membrane protein [Shigella flexneri 2002017]
 gi|284920524|emb|CBG33586.1| colicin import protein [Escherichia coli 042]
 gi|290761553|gb|ADD55514.1| Inner membrane protein [Escherichia coli O55:H7 str. CB9615]
 gi|299879415|gb|EFI87626.1| protein TolQ [Escherichia coli MS 196-1]
 gi|300315604|gb|EFJ65388.1| protein TolQ [Escherichia coli MS 175-1]
 gi|300355803|gb|EFJ71673.1| protein TolQ [Escherichia coli MS 198-1]
 gi|300398437|gb|EFJ81975.1| protein TolQ [Escherichia coli MS 69-1]
 gi|300401217|gb|EFJ84755.1| protein TolQ [Escherichia coli MS 84-1]
 gi|300414461|gb|EFJ97771.1| protein TolQ [Escherichia coli MS 115-1]
 gi|300417840|gb|EFK01151.1| protein TolQ [Escherichia coli MS 182-1]
 gi|300453168|gb|EFK16788.1| protein TolQ [Escherichia coli MS 116-1]
 gi|300457157|gb|EFK20650.1| protein TolQ [Escherichia coli MS 21-1]
 gi|300462566|gb|EFK26059.1| protein TolQ [Escherichia coli MS 187-1]
 gi|300524515|gb|EFK45584.1| protein TolQ [Escherichia coli MS 119-7]
 gi|300531076|gb|EFK52138.1| protein TolQ [Escherichia coli MS 107-1]
 gi|300839537|gb|EFK67297.1| protein TolQ [Escherichia coli MS 124-1]
 gi|300845573|gb|EFK73333.1| protein TolQ [Escherichia coli MS 78-1]
 gi|301073868|gb|EFK88674.1| protein TolQ [Escherichia coli MS 146-1]
 gi|306905696|gb|EFN36224.1| protein TolQ [Escherichia coli W]
 gi|308118976|gb|EFO56238.1| protein TolQ [Escherichia coli MS 145-7]
 gi|309700959|emb|CBJ00256.1| colicin import protein [Escherichia coli ETEC H10407]
 gi|315059980|gb|ADT74307.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli W]
 gi|315257656|gb|EFU37624.1| protein TolQ [Escherichia coli MS 85-1]
 gi|320193142|gb|EFW67782.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           O157:H7 str. EC1212]
 gi|320637995|gb|EFX07764.1| colicin uptake protein TolQ [Escherichia coli O157:H7 str. G5101]
 gi|320643390|gb|EFX12570.1| colicin uptake protein TolQ [Escherichia coli O157:H- str. 493-89]
 gi|320648739|gb|EFX17372.1| colicin uptake protein TolQ [Escherichia coli O157:H- str. H 2687]
 gi|320654323|gb|EFX22376.1| colicin uptake protein TolQ [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
 gi|320659955|gb|EFX27497.1| colicin uptake protein TolQ [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320664780|gb|EFX31918.1| colicin uptake protein TolQ [Escherichia coli O157:H7 str. LSU-61]
 gi|323379460|gb|ADX51728.1| protein TolQ [Escherichia coli KO11]
 gi|323942960|gb|EGB39124.1| TolQ protein [Escherichia coli E482]
 gi|323963118|gb|EGB58688.1| TolQ protein [Escherichia coli H489]
 gi|323967340|gb|EGB62761.1| TolQ protein [Escherichia coli M863]
 gi|324020355|gb|EGB89574.1| protein TolQ [Escherichia coli MS 117-3]
 gi|324116279|gb|EGC10200.1| TolQ protein [Escherichia coli E1167]
 gi|326341514|gb|EGD65304.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           O157:H7 str. 1044]
 gi|331038036|gb|EGI10256.1| protein TolQ [Escherichia coli H736]
 gi|331050023|gb|EGI22081.1| protein TolQ [Escherichia coli M718]
 gi|331060519|gb|EGI32483.1| protein TolQ [Escherichia coli TA143]
 gi|331065460|gb|EGI37353.1| protein TolQ [Escherichia coli TA271]
 gi|331070454|gb|EGI41818.1| protein TolQ [Escherichia coli TA280]
 gi|331075912|gb|EGI47209.1| protein TolQ [Escherichia coli H591]
 gi|332096457|gb|EGJ01453.1| protein TolQ [Shigella dysenteriae 155-74]
 gi|332104766|gb|EGJ08112.1| membrane-spanning inner membrane protein [Shigella sp. D9]
          Length = 230

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|254482599|ref|ZP_05095838.1| protein TolQ [marine gamma proteobacterium HTCC2148]
 gi|214037290|gb|EEB77958.1| protein TolQ [marine gamma proteobacterium HTCC2148]
          Length = 236

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 65/227 (28%), Positives = 112/227 (49%), Gaps = 6/227 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
            +S+  L +     V+ ++ +L   SILSW +I+Q+ +     R +   FE+ FWSG  L
Sbjct: 4   QLSLIDLVINASFTVQMVMLILVGASILSWYMIVQRFLYLHNAREEMYGFEERFWSGIDL 63

Query: 70  ETVCKSLKNHHNIG-----LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             + +      + G     + +IF +   E+ +   +       I +   R M VA+ RE
Sbjct: 64  SQLYREGNEKASDGQAILGMESIFRAGFKEFSRLAQQSEMDSEAILEGSRRAMRVAVMRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
            E +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  
Sbjct: 124 EERLERHLAFLASVGSTSPYIGLFGTVWGIMHSFRGLANSTQATLATVAPGISEALVATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +GL  +IP+ +AYN+F    + F  + + F +EFS+IL RQ     +
Sbjct: 184 MGLFAAIPAVLAYNRFSAKVEVFGNRYDTFVDEFSSILYRQAYALRA 230


>gi|226942654|ref|YP_002797727.1| TolQ-like protein [Azotobacter vinelandii DJ]
 gi|226717581|gb|ACO76752.1| TolQ-like protein [Azotobacter vinelandii DJ]
          Length = 234

 Score =  160 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 55/219 (25%), Positives = 107/219 (48%), Gaps = 2/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S++ L  +    VK ++  L + S+ SW +I+++S+      R  R+F + F     L 
Sbjct: 8   MSVWGLIEEASPLVKLVMLTLVLASLASWYLIVRRSLLLGASERLCRDFLRRFRGSAELA 67

Query: 71  TVCKSLKNHH-NIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
            + +       + GL  +F +   E+++   +   +P  + + ++R + VAI+ E E + 
Sbjct: 68  PLYREAAELPADAGLERLFRAGYGEFQQLGGEPGVAPEAVIEGVERSLLVAISEEEERLG 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L+ L S+ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL  
Sbjct: 128 KGLALLASIGSVSPYIGLFGTVWGIMNSFIGLSQVRQATLSTVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           +IP+ +AYN+F       + +   F NE    L R+ + 
Sbjct: 188 AIPAVLAYNRFSARVASLSSRYYAFGNELQGRLHRRLQA 226


>gi|88861317|ref|ZP_01135948.1| inner membrane protein [Pseudoalteromonas tunicata D2]
 gi|88816696|gb|EAR26520.1| inner membrane protein [Pseudoalteromonas tunicata D2]
          Length = 230

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/224 (28%), Positives = 108/224 (48%), Gaps = 3/224 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             ++S   L ++    V+ ++ +L   S++SW++I Q+       + Q ++FE  FWSG 
Sbjct: 2   TTELSFIDLILKASFLVQLVMLMLVGLSVISWTMIFQRQKALHNAQIQAKKFEDKFWSGT 61

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  +   L        GL ++F +   E+ +       +   I D   R M VA++RE+
Sbjct: 62  DLSKIYTELSARQQGLDGLESLFTAGFKEFARLSKSNLTAAGTIMDGTHRAMRVALSREM 121

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E++   LSFL ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 122 EKLESSLSFLATVGSISPYIGLFGTVWGIMNAFIALGQVKQATLQMVAPGIAEALIATAM 181

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           GL  +IP+ IAYN+F    +K       F  EFS IL RQ    
Sbjct: 182 GLFAAIPAVIAYNRFAHKVEKIESSYGNFMEEFSNILHRQAVAQ 225


>gi|294637424|ref|ZP_06715715.1| protein TolQ [Edwardsiella tarda ATCC 23685]
 gi|291089417|gb|EFE21978.1| protein TolQ [Edwardsiella tarda ATCC 23685]
          Length = 224

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 107/218 (49%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  + VK I+ +L  FS+ SW++IIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLKASVLVKLIMLVLICFSVASWAIIIQRTRILNAATRDAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF +   E+ +     + +  G+ +   R M +++ RE+E +
Sbjct: 61  RLYQESQTRRDTLNGSEQIFYAGFKEFARLHRMNSHATEGVIEGASRAMRISLNREVEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F  +       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIGLGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+      K     E F  EF AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNLRVNKLEQNYENFMEEFIAILHRQA 218


>gi|254511091|ref|ZP_05123158.1| protein TolQ [Rhodobacteraceae bacterium KLH11]
 gi|221534802|gb|EEE37790.1| protein TolQ [Rhodobacteraceae bacterium KLH11]
          Length = 231

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 78/219 (35%), Positives = 122/219 (55%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ L+ +    VK ++ +L   SI SW++IIQK +N+   RR+ + F++ FWSG  
Sbjct: 12  IDFSMWGLYARATFIVKLVMLMLIGASIWSWAIIIQKLINYRAARREAQVFDESFWSGNP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    +     IF + M EW++S         G   RIDR MDVAIA+E E +
Sbjct: 72  LDELFERIGTQPDGSSEKIFAAGMIEWRRSHRTDGGLIAGATARIDRSMDVAIAKEAEAL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L  L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QKGLPILATVGSTAPFIGLFGTVWGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRIVGGYEAFADEFATILSRQLD 230


>gi|149202849|ref|ZP_01879820.1| MotA/TolQ/ExbB proton channel [Roseovarius sp. TM1035]
 gi|149143395|gb|EDM31431.1| MotA/TolQ/ExbB proton channel [Roseovarius sp. TM1035]
          Length = 231

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 76/219 (34%), Positives = 120/219 (54%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ALF +  L VK ++ +L + S  +WS+IIQK + +   + +   F++ FWSG+ 
Sbjct: 12  IDFSMWALFARATLTVKLVMFMLIVSSFWAWSIIIQKIIIYRKAQLEAEIFDRRFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +          IF + M+EW++S         G   RIDR MDVAIA+E E +
Sbjct: 72  LDGLFDEIGPEPAGQSERIFAAGMTEWRRSHRNDGNLIAGATARIDRSMDVAIAKESEGL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLQVLATVGSTAPFIGLFGTVWGIMHAFVEIAEQQNTNLAVVAPGIAEALLATGLGLI 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   D+ +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADADRIVAGYEAFADEFATILSRQLD 230


>gi|123443149|ref|YP_001007123.1| colicin uptake protein TolQ [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238757965|ref|ZP_04619146.1| hypothetical protein yaldo0001_8410 [Yersinia aldovae ATCC 35236]
 gi|238765248|ref|ZP_04626177.1| hypothetical protein ykris0001_32630 [Yersinia kristensenii ATCC
           33638]
 gi|238790495|ref|ZP_04634264.1| hypothetical protein yfred0001_12250 [Yersinia frederiksenii ATCC
           33641]
 gi|332160926|ref|YP_004297503.1| colicin uptake protein TolQ [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|122090110|emb|CAL12973.1| TolQ colicin import protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|238696520|gb|EEP89308.1| hypothetical protein ykris0001_32630 [Yersinia kristensenii ATCC
           33638]
 gi|238703719|gb|EEP96255.1| hypothetical protein yaldo0001_8410 [Yersinia aldovae ATCC 35236]
 gi|238721439|gb|EEQ13110.1| hypothetical protein yfred0001_12250 [Yersinia frederiksenii ATCC
           33641]
 gi|318604833|emb|CBY26331.1| mota/TolQ/ExbB proton channel family protein [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325665156|gb|ADZ41800.1| colicin uptake protein TolQ [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330864062|emb|CBX74139.1| protein tolQ [Yersinia enterocolitica W22703]
          Length = 228

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 70/225 (31%), Positives = 112/225 (49%), Gaps = 3/225 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MADMNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + D   R M +++ REL
Sbjct: 61  ELSRLYQESQARRDTLGGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +
Sbjct: 121 EALETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ   + 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFIAILHRQAFASA 225


>gi|218549690|ref|YP_002383481.1| colicin uptake protein TolQ [Escherichia fergusonii ATCC 35469]
 gi|218357231|emb|CAQ89866.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           fergusonii ATCC 35469]
 gi|324114856|gb|EGC08824.1| TolQ protein [Escherichia fergusonii B253]
          Length = 230

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|82776015|ref|YP_402362.1| colicin uptake protein TolQ [Shigella dysenteriae Sd197]
 gi|81240163|gb|ABB60873.1| inner membrane protein [Shigella dysenteriae Sd197]
          Length = 230

 Score =  160 bits (404), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|134095581|ref|YP_001100656.1| inner membrane protein [Herminiimonas arsenicoxydans]
 gi|133739484|emb|CAL62535.1| Protein TolQ [Herminiimonas arsenicoxydans]
          Length = 230

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 73/226 (32%), Positives = 113/226 (50%), Gaps = 8/226 (3%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   L     + V+ ++ LL   S++SW+ I +K       R Q  EFE+ FWSG 
Sbjct: 4   TQDLSFVHLIANASVLVQLVMALLVGVSVMSWTYIFRKMFAIKNARTQTEEFERAFWSGG 63

Query: 68  SLETVCKSLKNHHN------IGLAAIFMSAMSEWKKSCDKGARSPIGIQ-DRIDRMMDVA 120
            L  + +   ++          L  IF + MSE+ KS      S   ++ D   R M  A
Sbjct: 64  DLNALYQDATSNRRKSSGSTGALERIFEAGMSEFNKSRASHDPSQASVRLDGARRAMRAA 123

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
             RE++ +   L+FL S+ S    VG+ G V G+M  F+ +A      + ++   I E+L
Sbjct: 124 YQREMDGLESHLAFLASVGSVSPYVGLFGTVWGIMNSFRGLANVQQATLAAVAPGIAEAL 183

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           I+  +GL  +IP+ +AYN++  D  + AM+ E F  EFS IL RQT
Sbjct: 184 IATAIGLFAAIPAVVAYNRYSHDIDRLAMRFESFVEEFSNILQRQT 229


>gi|187479382|ref|YP_787407.1| TolQ protein [Bordetella avium 197N]
 gi|115423969|emb|CAJ50522.1| TolQ protein [Bordetella avium 197N]
          Length = 224

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 4/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+ +L     + V+ I+ LL   S++SW+ I  K +      +Q R FE  FWSG  L
Sbjct: 6   DMSLSSLLFNASVPVQLIMLLLLGISVVSWTYIFAKRMAIKRANQQTRRFEDDFWSGGDL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +++ +  +    LA IF + M+E+ K+   G      + D   R M  A  RE++ 
Sbjct: 66  AMLQQAVSSRRDEQGALARIFDAGMTEFLKARRSGG-DSSSLLDGPRRAMRAAYQREMDS 124

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L+FL S  S    +G+LG V G+M  F  ++      +    PGI E+LI+  +GL
Sbjct: 125 LESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNMQQATLASVAPGIAEALIATAIGL 184

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ +AYN+F  D  + +++ + F +EF  IL RQ
Sbjct: 185 FAAIPAVVAYNRFTNDIDRISIRFDSFVDEFLNILQRQ 222


>gi|84687708|ref|ZP_01015581.1| proton transporter TolQ [Maritimibacter alkaliphilus HTCC2654]
 gi|84664291|gb|EAQ10782.1| proton transporter TolQ [Rhodobacterales bacterium HTCC2654]
          Length = 231

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 82/221 (37%), Positives = 121/221 (54%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
             MD S +ALF +  L VK ++ LL   S  SW++I+ K + F   + +   F+Q FWSG
Sbjct: 10  GEMDFSFWALFFRATLIVKLVMVLLVAMSFYSWAIIVTKFMQFRRAKAEAAMFDQAFWSG 69

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           + L+ + + +          +F + M EW++S         G Q RIDR MDVAIA+E E
Sbjct: 70  EPLDELYEQIGPSPTGSSEKVFAAGMLEWRRSHRADGGLIAGAQSRIDRSMDVAIAKEAE 129

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +  +L FL + +S+   +G+ G V G+M  F  IA   + N+  +   I E+L++  LG
Sbjct: 130 GLNARLGFLATTASSAPFIGLFGTVWGIMHAFTEIAQQQNTNLAVVAPGIAEALLATGLG 189

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I YNK   DS   A   E FA+EFS ILSRQ +
Sbjct: 190 LLAAIPALIFYNKLTADSDNVAAGWESFADEFSTILSRQLD 230


>gi|161504093|ref|YP_001571205.1| colicin uptake protein TolQ [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160865440|gb|ABX22063.1| hypothetical protein SARI_02191 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 230

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|90417113|ref|ZP_01225041.1| tolQ protein [marine gamma proteobacterium HTCC2207]
 gi|90331129|gb|EAS46385.1| tolQ protein [marine gamma proteobacterium HTCC2207]
          Length = 232

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 75/229 (32%), Positives = 121/229 (52%), Gaps = 6/229 (2%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   ++SI+ L     + V+ ++ LLF+ SI+SW +I+Q+ +     +R FR+FE  FWS
Sbjct: 4   LIEENMSIWHLISNASVLVQLVMGLLFVASIMSWVMIVQRGIFLNAAQRGFRQFEDAFWS 63

Query: 66  GQSLETVCKSL-----KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
           G  L  +   L     ++    G+  +F +   E+ +    G+     I +  DR M VA
Sbjct: 64  GVDLNKLYGELTQEAKEHGGRDGVENVFRAGFREFNRLAQVGSADSDTIMEGTDRAMRVA 123

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESL 179
           ++RE E++   L FL S++S    +G+ G V G+M  F+ +A      +    PGI E+L
Sbjct: 124 LSREDEKLNISLPFLASVASVSPYIGLFGTVWGIMNSFRGLAMVQQATLATVAPGISEAL 183

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           I+  +GL  +IP+ IAYN++    +      E FA EFS+IL RQ   N
Sbjct: 184 IATAMGLFAAIPALIAYNRYAAIVETMNSSYETFAEEFSSILHRQIRAN 232


>gi|119477232|ref|ZP_01617468.1| TolQ protein [marine gamma proteobacterium HTCC2143]
 gi|119449595|gb|EAW30833.1| TolQ protein [marine gamma proteobacterium HTCC2143]
          Length = 240

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/223 (30%), Positives = 111/223 (49%), Gaps = 6/223 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++S++ L     L V+ ++ LLFIFS +SW +I+Q+   F    R  + FE  FWSG  L
Sbjct: 4   ELSVWQLVANASLTVQAVMALLFIFSAISWFMIVQRGFYFRACNRAMQNFEHQFWSGMDL 63

Query: 70  ETVCKSLKNHHNIG-----LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             + +        G     + +IF +   E+ +   +       +     R M VA +RE
Sbjct: 64  SQLFRQGSADIESGASFVGMESIFRAGFKEFSRLRQQPGVDADAVMQGAQRSMRVATSRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
            E++   L FL ++ S    VG+ G V G+M  FQS+A      +    PGI E+L++  
Sbjct: 124 EEQMDTHLPFLATVGSISPYVGLFGTVWGIMTSFQSLATMNQATLATVAPGISEALVATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +GL  +IP+ +AYN++    +    + + F++EF  IL RQ  
Sbjct: 184 MGLFAAIPAVMAYNRYSSRVEILLNKYDSFSDEFYGILHRQAH 226


>gi|269139921|ref|YP_003296622.1| Tol-Pal system [Edwardsiella tarda EIB202]
 gi|267985582|gb|ACY85411.1| Tol-Pal system [Edwardsiella tarda EIB202]
 gi|304559756|gb|ADM42420.1| MotA/TolQ/ExbB proton channel family protein [Edwardsiella tarda
           FL6-60]
          Length = 224

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLVLICFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P G+ +   R M +++ RE+E +
Sbjct: 61  RLYQESQTRRDALSGSEQIFYSGFKEFARLHRMNSHAPEGVIEGASRAMRISLNREIEAM 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F  +       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIGLGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+      K     E F  EF AIL RQ 
Sbjct: 181 AAIPAVMAYNRLSLRVNKLEQNYENFMEEFIAILHRQA 218


>gi|145297811|ref|YP_001140652.1| MotA/TolQ/ExbB proton channel [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142850583|gb|ABO88904.1| MotA/TolQ/ExbB proton channel [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 229

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 106/222 (47%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS   LF Q  L VK ++  L   S++SW++I Q+S           +FE  FWSG  L
Sbjct: 4   EISFIGLFWQASLLVKLVMMTLMGMSVVSWALIFQRSKVIKAANLASEQFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +   +  +    +  IF S   E+ +    GAR    + D   R M V+++R ++E
Sbjct: 64  NRLYQESSSRRDDIEGMEDIFYSGFKEYARLLKAGARGQDAVMDGTYRAMRVSLSRAVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL
Sbjct: 124 LESNLPVLATVGSISPYIGLFGTVWGIMNAFIALGQVQQATLQMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ I YN+F    +K       F +EF+ IL+RQ    
Sbjct: 184 FAAIPAVIFYNRFTNKVEKLENAYANFMDEFTTILNRQIAQQ 225


>gi|308186080|ref|YP_003930211.1| Protein tolQ [Pantoea vagans C9-1]
 gi|308056590|gb|ADO08762.1| Protein tolQ [Pantoea vagans C9-1]
          Length = 225

 Score =  159 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +       G   IF S   E+ +       +P  + D   R M +++ RELE +
Sbjct: 61  RLYQESQERREELGGSEQIFYSGFKEFARLHRANNHAPEAVIDGASRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLEQGYDNFMEEFTAILHRQA 218


>gi|326388394|ref|ZP_08209990.1| MotA/TolQ/ExbB proton channel [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207126|gb|EGD57947.1| MotA/TolQ/ExbB proton channel [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 233

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 57/221 (25%), Positives = 115/221 (52%), Gaps = 2/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   ++   LF+   + V+ ++  L + S+  W++I+   V    +R + R++E  FWS 
Sbjct: 13  APTRLNPVELFLHADIVVQIVMGGLVLASVWVWTIIVGFMVRMTLVRSRCRKYEDGFWSA 72

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           + ++   +      +I  A +  +A++EW++S    +    G + R+   M+ A+ +E +
Sbjct: 73  RDID-AYQKSHEDQDIPSARVVSAALAEWRRSTSGKSIDREGTRQRLSMAMESAVTQETD 131

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            ++ +L+FL ++ +    VG+ G V G+M  F +I    ++++  +   I E+L +  +G
Sbjct: 132 RLSNRLNFLATVGTVAPFVGLFGTVWGVMDSFFNIGAQQNSSLAVVAPGISEALFATAIG 191

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IPS +AYN+F      F   +  FA+ F   LSR+ E
Sbjct: 192 LFAAIPSVVAYNRFSHRVNGFETGLFRFADRFHTTLSRELE 232


>gi|302879784|ref|YP_003848348.1| protein TolQ [Gallionella capsiferriformans ES-2]
 gi|302582573|gb|ADL56584.1| protein TolQ [Gallionella capsiferriformans ES-2]
          Length = 225

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 64/221 (28%), Positives = 105/221 (47%), Gaps = 4/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   L     + V+ ++ LL   S++SW  I  K       +R   EFE+ FW   
Sbjct: 4   TQDLSFIHLISNASVLVQLVMGLLLFVSMMSWWYIFMKMFAIRREKRLTAEFEETFWRNP 63

Query: 68  SLETVCKSLKNHHNIG---LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
           +L  V K++ N        L  IF +   E+ K   +       + +   R M     RE
Sbjct: 64  NLNEVYKTVSNTSRSDQGALERIFAAGFVEFVKLKKQHGVDAAAVMEGTRRAMRATYQRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           ++ +   L+FL S+ S    VG+ G V G+M  F+ +A      +    PGI E+L++  
Sbjct: 124 MDHLESHLAFLASVGSVSPYVGLFGTVWGIMNAFRGLANVGQATLAHVAPGIAEALVATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           +GL  +IP+ +AYN++  D ++ + + E F  EFS +L RQ
Sbjct: 184 MGLFAAIPAVVAYNRYAHDIERLSTRFESFTEEFSNVLQRQ 224


>gi|16759684|ref|NP_455301.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16764115|ref|NP_459730.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142543|ref|NP_805885.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56414138|ref|YP_151213.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62179319|ref|YP_215736.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161615021|ref|YP_001588986.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|194446660|ref|YP_002039986.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448001|ref|YP_002044779.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472247|ref|ZP_03078231.1| protein TolQ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194737848|ref|YP_002113853.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195874283|ref|ZP_02701529.2| protein TolQ [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197251691|ref|YP_002145706.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197264867|ref|ZP_03164941.1| protein TolQ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197301124|ref|ZP_02663953.2| protein TolQ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197363060|ref|YP_002142697.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198242904|ref|YP_002214715.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200389466|ref|ZP_03216077.1| protein TolQ [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204929841|ref|ZP_03220862.1| protein TolQ [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205352009|ref|YP_002225810.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205357295|ref|ZP_02346581.2| protein TolQ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205357903|ref|ZP_02574124.2| protein TolQ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205358370|ref|ZP_02655688.2| protein TolQ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205358899|ref|ZP_02665535.2| protein TolQ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205359761|ref|ZP_02832120.2| protein TolQ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205360773|ref|ZP_02686328.2| protein TolQ [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|207856189|ref|YP_002242840.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|25301390|pir||AE0592 TolQ protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16419255|gb|AAL19689.1| tol protein, membrane-spanning inner membrane protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16501977|emb|CAD05207.1| TolQ protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138174|gb|AAO69745.1| tolQ protein [Salmonella enterica subsp. enterica serovar Typhi
           str. Ty2]
 gi|56128395|gb|AAV77901.1| TolQ protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|62126952|gb|AAX64655.1| tol protein, membrane-spanning inner membrane proteins, required
           for outer membrane integrity, uptake of group A
           colicins, and translocation of phage DNA to cytoplasm
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|161364385|gb|ABX68153.1| hypothetical protein SPAB_02781 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405323|gb|ACF65545.1| protein TolQ [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194406305|gb|ACF66524.1| protein TolQ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|194458611|gb|EDX47450.1| protein TolQ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|194713350|gb|ACF92571.1| protein TolQ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195629230|gb|EDX48598.1| protein TolQ [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197094537|emb|CAR60057.1| TolQ protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
 gi|197215394|gb|ACH52791.1| protein TolQ [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|197243122|gb|EDY25742.1| protein TolQ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197288339|gb|EDY27720.1| protein TolQ [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197937420|gb|ACH74753.1| protein TolQ [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|199601911|gb|EDZ00457.1| protein TolQ [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|204320835|gb|EDZ06036.1| protein TolQ [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205271790|emb|CAR36624.1| TolQ protein [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205322565|gb|EDZ10404.1| protein TolQ [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205328903|gb|EDZ15667.1| protein TolQ [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205334681|gb|EDZ21445.1| protein TolQ [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205340129|gb|EDZ26893.1| protein TolQ [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|205343116|gb|EDZ29880.1| protein TolQ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205347188|gb|EDZ33819.1| protein TolQ [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|206707992|emb|CAR32281.1| TolQ protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|261246008|emb|CBG23810.1| TolQ protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267992486|gb|ACY87371.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157336|emb|CBW16825.1| TolQ protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|322623637|gb|EFY20475.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322670514|gb|EFY66647.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322713790|gb|EFZ05361.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323129057|gb|ADX16487.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323231002|gb|EGA15118.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323260627|gb|EGA44236.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264698|gb|EGA48200.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|326627050|gb|EGE33393.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332987682|gb|AEF06665.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 230

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDSLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|156934769|ref|YP_001438685.1| colicin uptake protein TolQ [Cronobacter sakazakii ATCC BAA-894]
 gi|156533023|gb|ABU77849.1| hypothetical protein ESA_02609 [Cronobacter sakazakii ATCC BAA-894]
          Length = 231

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 111/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAASREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +       G   IF +   E+ +     + +P  I +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRENLSGSEQIFYAGFKEFARLHRANSHAPEAIVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|259417777|ref|ZP_05741696.1| protein TolQ [Silicibacter sp. TrichCH4B]
 gi|259346683|gb|EEW58497.1| protein TolQ [Silicibacter sp. TrichCH4B]
          Length = 231

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 79/219 (36%), Positives = 122/219 (55%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  L VK ++ +L   SI SWS+I QK + + + RR+ + FE+ FWSG  
Sbjct: 12  IDFSMWGLFARATLTVKLVMIMLIGASIWSWSIIAQKLITYRSARREAQVFERAFWSGNP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    +     IF + M+EW++S         G Q RIDR MDVAI++E E +
Sbjct: 72  LDELYEDIGADPSGHSERIFAAGMTEWRRSHRTDGALIPGAQARIDRSMDVAISKESEGL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QGGLQILATIGSTAPFIGLFGTVWGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ I SRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRIIGGYEAFADEFATIFSRQLD 230


>gi|292487658|ref|YP_003530531.1| protein TolQ [Erwinia amylovora CFBP1430]
 gi|291553078|emb|CBA20123.1| Protein tolQ [Erwinia amylovora CFBP1430]
 gi|312171766|emb|CBX80024.1| Protein tolQ [Erwinia amylovora ATCC BAA-2158]
          Length = 225

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAVRDADAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  ++  +   G   IF +   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQSRRDELGGSEQIFYAGFKEFARLHRANNHAPEAVVEGATRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+      K     + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLTLRVNKLEQNYDNFMEEFTAILHRQA 218


>gi|78485240|ref|YP_391165.1| MotA/TolQ/ExbB proton channel [Thiomicrospira crunogena XCL-2]
 gi|78363526|gb|ABB41491.1| TolQ protein [Thiomicrospira crunogena XCL-2]
          Length = 229

 Score =  159 bits (402), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 62/228 (27%), Positives = 112/228 (49%), Gaps = 9/228 (3%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MNN+       S+  L +     V+ ++ +L + SI++W++   KS      +R+ R+F+
Sbjct: 1   MNNH-------SLMELILDASPVVQAVMVILLLMSIMAWAITFAKSYQLRKAQREARDFD 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDV 119
           +LFWS   L  +   +    +    A IF +   E+     +G      + +   R M V
Sbjct: 54  ELFWSTPELTGLYNQVTRDEDNTGNAQIFEAGFKEFMSLKSQGVIDSADLINGTQRAMRV 113

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIES 178
           A ++++E +  +   L ++ S+   +G+ G V G+M  F S+    +  +    PGI E+
Sbjct: 114 AFSKQIERLENQTPLLATVGSSAPYIGLFGTVWGVMHAFSSLGDIQNATLASVAPGISEA 173

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           LI+  +GL  +IP+ IAYN+   ++ K   Q E FA  F  I+ RQ+ 
Sbjct: 174 LIATAMGLFAAIPAVIAYNRLSVNTDKVIGQYENFAEGFLTIIQRQSH 221


>gi|325579036|ref|ZP_08148992.1| TolQ colicin import protein [Haemophilus parainfluenzae ATCC 33392]
 gi|325159271|gb|EGC71405.1| TolQ colicin import protein [Haemophilus parainfluenzae ATCC 33392]
          Length = 228

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 113/223 (50%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S    +  ++   FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTSALKEANTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   L N      G   IF     E+ +     A +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYDGLSNRREVLTGSEQIFFVGFKEFSRLKQVNADAPEAIIKGTTRAMNLAMNREVEA 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LESRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQNYGNFIDEFTTILHRQAFGKA 226


>gi|283784490|ref|YP_003364355.1| colicin import protein [Citrobacter rodentium ICC168]
 gi|282947944|emb|CBG87508.1| colicin import protein [Citrobacter rodentium ICC168]
          Length = 230

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +       IF S   E+ +     + +P  I +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRDSLAGTEQIFYSGFKEFARLHRANSHAPEAIVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ENLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|33152787|ref|NP_874140.1| colicin transport protein, TolQ [Haemophilus ducreyi 35000HP]
 gi|33149011|gb|AAP96529.1| colicin transport protein, TolQ [Haemophilus ducreyi 35000HP]
          Length = 226

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 109/219 (49%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
             ++ +LFMQ  + VK +I +L  FSILSW++IIQ+S      ++    FE  FWSG  L
Sbjct: 4   QFNLVSLFMQASIVVKIVILILICFSILSWAIIIQRSQVLAKAKKAVVAFENKFWSGDDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + L+N      G   IF +   E+ +       +P        R M +A+ RE+E 
Sbjct: 64  HRLHERLENRREGLSGSEQIFYAGFKEFLRLQQVNPEAPEATMKGTSRAMHLALNREVES 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   + FLG++ S    +G+ G V G+M  F  ++G     + S+   I E+LI+  +GL
Sbjct: 124 LESYIPFLGTVGSISPYIGLFGTVWGIMHSFMGLSGVKQATLQSVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+      +       F +EF  IL RQ 
Sbjct: 184 FAAIPAVMAYNRLNLAMNRLEQDYLNFIDEFITILHRQA 222


>gi|301155735|emb|CBW15203.1| membrane spanning protein in TolA-TolQ-TolR complex [Haemophilus
           parainfluenzae T3T1]
          Length = 228

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 113/223 (50%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +++   LF++  + V+ +I +L  FSI+SW++IIQ+S    T  ++   FE  FWSG+ L
Sbjct: 4   ELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTTALKEANTFEDRFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   L N      G   IF     E+ +     A +P  I     R M++A+ RE+E 
Sbjct: 64  NKLYDGLSNRREVLTGSEQIFFVGFKEFSRLKQVNANAPEAIIKGTTRAMNLAMNREVEA 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LESRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ +AYN+              F +EF+ IL RQ  G  
Sbjct: 184 FAAIPAVMAYNRLSLRVNAIEQNYGNFIDEFTTILHRQAFGKA 226


>gi|194366894|ref|YP_002029504.1| protein TolQ [Stenotrophomonas maltophilia R551-3]
 gi|194349698|gb|ACF52821.1| protein TolQ [Stenotrophomonas maltophilia R551-3]
          Length = 259

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 108/222 (48%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L  +  L VK I+  L + S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYLELMAKASLPVKIIVLALLVGSFVSWVIIFRKARIFKQATREADEFENRFWSGADLG 96

Query: 71  TVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +       L AIF +   E+ +  DK         +   R M     RE++++
Sbjct: 97  KLYSSATDRSRNVGGLEAIFEAGFREYSRLRDKRRLDGRAQLEGAQRAMRTTYTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +    +        PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGAQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA EFS+IL RQ+ G+
Sbjct: 217 FVAIPAVWAYNRFTTRVERMSVRFETFAEEFSSILQRQSAGD 258


>gi|238793894|ref|ZP_04637514.1| hypothetical protein yinte0001_25090 [Yersinia intermedia ATCC
           29909]
 gi|238726797|gb|EEQ18331.1| hypothetical protein yinte0001_25090 [Yersinia intermedia ATCC
           29909]
          Length = 228

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 70/225 (31%), Positives = 111/225 (49%), Gaps = 3/225 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MADMNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF S   E+ +     + +P  + D   R M +++ REL
Sbjct: 61  ELSRLYQESQARRETLGGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +
Sbjct: 121 EALETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ   + 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQNYDNFMEEFIAILHRQAFASA 225


>gi|29654865|ref|NP_820557.1| TolQ [Coxiella burnetii RSA 493]
 gi|29542134|gb|AAO91071.1| TolQ [Coxiella burnetii RSA 493]
          Length = 237

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 117/218 (53%), Gaps = 3/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + ++++      L VK +I LLF+ SI SWS+IIQ+       RR+ ++FE LFWSG  L
Sbjct: 4   EPTLWSFVAHASLIVKMVIFLLFLASIASWSIIIQRVFFVKRTRREMKKFEHLFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            T+   L    +  IG+++IF +  +E+ +   +   +P  I +   R M +A +RE + 
Sbjct: 64  TTLYNRLSKKKDKLIGMSSIFYAGFNEFTRLRQELGSNPKAILEGTHRAMRIAQSREADL 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   LSFL ++ S    VG+ G V G+M  F+++       + +  PGI E+LI+  +GL
Sbjct: 124 LERNLSFLATVGSTSPYVGLFGTVWGIMTSFRALGAVQQVTIAMVAPGISEALIATAVGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ IAYN+F  +        + F  E   IL R+
Sbjct: 184 FAAIPAVIAYNRFSNELNAITQNYDTFQEEILNILHRR 221


>gi|165918701|ref|ZP_02218787.1| TolQ protein [Coxiella burnetii RSA 334]
 gi|165917636|gb|EDR36240.1| TolQ protein [Coxiella burnetii RSA 334]
          Length = 237

 Score =  159 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 117/218 (53%), Gaps = 3/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + ++++      L VK +I LLF+ SI SWS+IIQ+       RR+ ++FE LFWSG  L
Sbjct: 4   EPTLWSFVAHASLIVKMVIFLLFLASIASWSIIIQRVFFVKRTRREMKKFEHLFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            T+   L    +  IG+++IF +  +E+ +   +   +P  I +   R M +A +RE + 
Sbjct: 64  TTLYNQLSEKKDKLIGMSSIFYAGFNEFTRLRQELGSNPKAILEGTHRAMRIAQSREADL 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   LSFL ++ S    VG+ G V G+M  F+++       + +  PGI E+LI+  +GL
Sbjct: 124 LERNLSFLATVGSTSPYVGLFGTVWGIMTSFRALGAVQQVTIAMVAPGISEALIATAVGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ IAYN+F  +        + F  E   IL R+
Sbjct: 184 FAAIPAVIAYNRFSNELNAITQNYDTFQEEILNILHRR 221


>gi|148977422|ref|ZP_01814022.1| tol biopolymer transport system, TolQ protein [Vibrionales
           bacterium SWAT-3]
 gi|145963374|gb|EDK28639.1| tol biopolymer transport system, TolQ protein [Vibrionales
           bacterium SWAT-3]
          Length = 227

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 112/219 (51%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +ISI  L ++  L VK ++  L   S++SW++II++S       +Q   FE  FWSG  L
Sbjct: 4   EISILGLILEASLLVKMVMLTLMGMSVVSWAMIIKRSKVLSQASKQAEVFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +      +   G   IF +  +E+ +     A SP  I +   R M VA+ARE++E
Sbjct: 64  AKLYQESNKRKDELSGTEEIFYAGFTEFARLRKSNATSPDFIMEGTGRAMRVAVAREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVWGIMHSFIALGEVKQATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F     K       F+ EF +IL RQ 
Sbjct: 184 FAAIPAVMAYNRFSSSVGKLEHNYATFSEEFHSILHRQA 222


>gi|119944495|ref|YP_942175.1| MotA/TolQ/ExbB proton channel [Psychromonas ingrahamii 37]
 gi|119863099|gb|ABM02576.1| MotA/TolQ/ExbB proton channel [Psychromonas ingrahamii 37]
          Length = 227

 Score =  159 bits (401), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 108/219 (49%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S   LF+Q    VK ++ LL   SI SW++I  ++ N  +  +  + FE+ FWSG  L
Sbjct: 4   DMSFLGLFLQASWLVKFVLILLLGMSIYSWTLIFSRTKNLKSSEKALKLFEERFWSGHDL 63

Query: 70  ETVCKS--LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K    ++    G   IF     E+ +      R+     +   R+M V ++RE++E
Sbjct: 64  SRLYKESAARSERITGGEKIFHGGFKEFSRLHRIPGRTVDSTTEGAHRIMRVTLSREIDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LETGLPVLATIGSISPYIGLFGTVWGIMNSFIALGEVQQATLTMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F     K          EF++IL RQ+
Sbjct: 184 FAAIPAVMAYNRFSTQVGKLETAYINLMEEFTSILHRQS 222


>gi|153208745|ref|ZP_01946983.1| TolQ protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154706732|ref|YP_001423834.1| TolQ [Coxiella burnetii Dugway 5J108-111]
 gi|161830814|ref|YP_001597409.1| TolQ protein [Coxiella burnetii RSA 331]
 gi|212212075|ref|YP_002303011.1| TolQ [Coxiella burnetii CbuG_Q212]
 gi|212219286|ref|YP_002306073.1| TolQ [Coxiella burnetii CbuK_Q154]
 gi|120575777|gb|EAX32401.1| TolQ protein [Coxiella burnetii 'MSU Goat Q177']
 gi|154356018|gb|ABS77480.1| TolQ [Coxiella burnetii Dugway 5J108-111]
 gi|161762681|gb|ABX78323.1| TolQ protein [Coxiella burnetii RSA 331]
 gi|212010485|gb|ACJ17866.1| TolQ [Coxiella burnetii CbuG_Q212]
 gi|212013548|gb|ACJ20928.1| TolQ [Coxiella burnetii CbuK_Q154]
          Length = 237

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 71/218 (32%), Positives = 117/218 (53%), Gaps = 3/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + ++++      L VK +I LLF+ SI SWS+IIQ+       RR+ ++FE LFWSG  L
Sbjct: 4   EPTLWSFVAHASLIVKMVIFLLFLASIASWSIIIQRVFFVKRTRREMKKFEHLFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            T+   L    +  IG+++IF +  +E+ +   +   +P  I +   R M +A +RE + 
Sbjct: 64  TTLYNRLSEKKDKLIGMSSIFYAGFNEFTRLRQELGSNPKAILEGTHRAMRIAQSREADL 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   LSFL ++ S    VG+ G V G+M  F+++       + +  PGI E+LI+  +GL
Sbjct: 124 LERNLSFLATVGSTSPYVGLFGTVWGIMTSFRALGAVQQVTIAMVAPGISEALIATAVGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ IAYN+F  +        + F  E   IL R+
Sbjct: 184 FAAIPAVIAYNRFSNELNAITQNYDTFQEEILNILHRR 221


>gi|259909073|ref|YP_002649429.1| colicin uptake protein TolQ [Erwinia pyrifoliae Ep1/96]
 gi|224964695|emb|CAX56212.1| TolQ colicin import protein [Erwinia pyrifoliae Ep1/96]
 gi|310767027|gb|ADP11977.1| Protein tolQ [Erwinia sp. Ejp617]
          Length = 225

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 109/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAVRDADAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  ++  +   G   IF +   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQSRRDELGGSEQIFFAGFKEFARLHRANNHAPEAVVEGATRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+      K     + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLTLRVNKLEQNYDNFMEEFTAILHRQA 218


>gi|114776331|ref|ZP_01451376.1| MotA/TolQ/ExbB proton channel family protein [Mariprofundus
           ferrooxydans PV-1]
 gi|114553161|gb|EAU55559.1| MotA/TolQ/ExbB proton channel family protein [Mariprofundus
           ferrooxydans PV-1]
          Length = 229

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 69/224 (30%), Positives = 122/224 (54%), Gaps = 8/224 (3%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SI  L +  G+ V+ ++ +L + S++SW++I  K   +   RR+   F Q FW G  
Sbjct: 3   QDLSILHLILNAGVIVQGVLIMLIMLSLMSWAIIFNKWRLYRKTRREAELFSQSFWGGTD 62

Query: 69  LETVCKSL-KNHHNIGLAAIFMSAMSEWKKSCDKGARS------PIGIQDRIDRMMDVAI 121
           ++TV   + + + +  L  IF +   E+ +     ++S        G  D + R +D A 
Sbjct: 63  MDTVLAGIPQQYPDSSLPNIFQAGYREFLRLRRDASQSHTAKITAGGGIDGVRRSLDAAF 122

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           +RE+E+++  L+FL ++ S    +G+ G V G++  FQSIA   +  + S+   I E+L+
Sbjct: 123 SREIEKLSRHLAFLATVGSTSPFIGLFGTVWGIVNAFQSIAMTKNTALTSVAPGIAEALV 182

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           +   GL  +IP+ +AYNKF  D K+    ME F++EF  I++R 
Sbjct: 183 ATAFGLVAAIPAVVAYNKFTADLKRMGANMEQFSSEFLNIIARH 226


>gi|311280383|ref|YP_003942614.1| protein TolQ [Enterobacter cloacae SCF1]
 gi|308749578|gb|ADO49330.1| protein TolQ [Enterobacter cloacae SCF1]
          Length = 230

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 113/221 (51%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +       G   IF S   E+ +     + +P  I +   R M +++ REL
Sbjct: 61  ELSRLYQESQGRRESLNGSEQIFYSGFKEFARLHRANSHAPEAIVEGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ETLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 221


>gi|159043657|ref|YP_001532451.1| Tol-Pal system TolQ [Dinoroseobacter shibae DFL 12]
 gi|157911417|gb|ABV92850.1| Tol-Pal system TolQ [Dinoroseobacter shibae DFL 12]
          Length = 224

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 77/220 (35%), Positives = 119/220 (54%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S  ALF +  L V+ ++ LL   S  SWS+IIQK + F   R +   F+  FWSG  
Sbjct: 5   IDFSFLALFARATLTVQLVMILLIGMSFWSWSIIIQKWITFRKARAEAEAFDAAFWSGDP 64

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +    +     +F S M+EW++S         G Q RIDR MDVAIA++ E +
Sbjct: 65  LDDLFDEIGPTPDGAAQRVFASGMTEWRRSHRDTGDLIPGAQQRIDRSMDVAIAKQSERL 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L+FL +  +    +G+ G V G+   F+ IA   + N+  +   I E+L++  LGL 
Sbjct: 125 QNGLNFLATTGATAPFIGLFGTVWGIKHSFEQIAIQQNTNLAVVAPGIAEALLATGLGLL 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ +AYNK   D+ +     E FA+EF+ +LSRQ + 
Sbjct: 185 AAIPAVVAYNKLSADADRIVGGYEAFADEFATLLSRQLDA 224


>gi|22126934|ref|NP_670357.1| colicin uptake protein TolQ [Yersinia pestis KIM 10]
 gi|45440869|ref|NP_992408.1| colicin uptake protein TolQ [Yersinia pestis biovar Microtus str.
           91001]
 gi|51595500|ref|YP_069691.1| colicin uptake protein TolQ [Yersinia pseudotuberculosis IP 32953]
 gi|108806596|ref|YP_650512.1| colicin uptake protein TolQ [Yersinia pestis Antiqua]
 gi|108813037|ref|YP_648804.1| colicin uptake protein TolQ [Yersinia pestis Nepal516]
 gi|145599840|ref|YP_001163916.1| colicin uptake protein TolQ [Yersinia pestis Pestoides F]
 gi|149366879|ref|ZP_01888913.1| TolQ colicin import protein [Yersinia pestis CA88-4125]
 gi|153950907|ref|YP_001401834.1| colicin uptake protein TolQ [Yersinia pseudotuberculosis IP 31758]
 gi|162420513|ref|YP_001605919.1| colicin uptake protein TolQ [Yersinia pestis Angola]
 gi|165924350|ref|ZP_02220182.1| protein TolQ [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165938371|ref|ZP_02226929.1| protein TolQ [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011568|ref|ZP_02232466.1| protein TolQ [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211429|ref|ZP_02237464.1| protein TolQ [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167399737|ref|ZP_02305255.1| protein TolQ [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419441|ref|ZP_02311194.1| protein TolQ [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167423896|ref|ZP_02315649.1| protein TolQ [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|218928289|ref|YP_002346164.1| colicin uptake protein TolQ [Yersinia pestis CO92]
 gi|229841058|ref|ZP_04461217.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229843162|ref|ZP_04463308.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229893999|ref|ZP_04509185.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis Pestoides A]
 gi|229903477|ref|ZP_04518590.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis Nepal516]
 gi|270487258|ref|ZP_06204332.1| protein TolQ [Yersinia pestis KIM D27]
 gi|294503126|ref|YP_003567188.1| TolQ colicin import protein [Yersinia pestis Z176003]
 gi|21959974|gb|AAM86608.1|AE013907_2 inner membrane protein [Yersinia pestis KIM 10]
 gi|45435727|gb|AAS61285.1| TolQ colicin import protein [Yersinia pestis biovar Microtus str.
           91001]
 gi|51588782|emb|CAH20396.1| TolQ colicin import protein [Yersinia pseudotuberculosis IP 32953]
 gi|108776685|gb|ABG19204.1| TolQ colicin import protein [Yersinia pestis Nepal516]
 gi|108778509|gb|ABG12567.1| TolQ colicin import protein [Yersinia pestis Antiqua]
 gi|115346900|emb|CAL19787.1| TolQ colicin import protein [Yersinia pestis CO92]
 gi|145211536|gb|ABP40943.1| TolQ colicin import protein [Yersinia pestis Pestoides F]
 gi|149291253|gb|EDM41328.1| TolQ colicin import protein [Yersinia pestis CA88-4125]
 gi|152962402|gb|ABS49863.1| protein TolQ [Yersinia pseudotuberculosis IP 31758]
 gi|162353328|gb|ABX87276.1| protein TolQ [Yersinia pestis Angola]
 gi|165913749|gb|EDR32368.1| protein TolQ [Yersinia pestis biovar Orientalis str. IP275]
 gi|165923410|gb|EDR40542.1| protein TolQ [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989516|gb|EDR41817.1| protein TolQ [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207200|gb|EDR51680.1| protein TolQ [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962182|gb|EDR58203.1| protein TolQ [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050445|gb|EDR61853.1| protein TolQ [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167056745|gb|EDR66508.1| protein TolQ [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229679247|gb|EEO75350.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis Nepal516]
 gi|229689509|gb|EEO81570.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229697424|gb|EEO87471.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229703884|gb|EEO90897.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis Pestoides A]
 gi|262361162|gb|ACY57883.1| TolQ colicin import protein [Yersinia pestis D106004]
 gi|262365282|gb|ACY61839.1| TolQ colicin import protein [Yersinia pestis D182038]
 gi|270335762|gb|EFA46539.1| protein TolQ [Yersinia pestis KIM D27]
 gi|294353585|gb|ADE63926.1| TolQ colicin import protein [Yersinia pestis Z176003]
 gi|320014261|gb|ADV97832.1| membrane spanning protein in TolA-TolQ-TolR complex [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 228

 Score =  158 bits (400), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 70/224 (31%), Positives = 112/224 (50%), Gaps = 3/224 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG 
Sbjct: 1   MADMNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  +   +   G   IF S   E+ +     + +P  + D   R M +++ REL
Sbjct: 61  ELSRLYQESQARRDTLSGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +
Sbjct: 121 EALETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ   +
Sbjct: 181 GLFAAIPAVMAYNRLNQHVNKLEQNYDNFMEEFIAILHRQAFAS 224


>gi|75676230|ref|YP_318651.1| MotA/TolQ/ExbB proton channel [Nitrobacter winogradskyi Nb-255]
 gi|74421100|gb|ABA05299.1| outer membrane transport energization protein ExbB [Nitrobacter
           winogradskyi Nb-255]
          Length = 421

 Score =  158 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 55/222 (24%), Positives = 101/222 (45%), Gaps = 6/222 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FMQ  + VK ++  L   S+++W+V + K +     RR+ +   +      
Sbjct: 182 PQDLSPWGMFMQADIVVKAVMIGLAFASLVTWTVWLAKGIELAASRRRAQSCVRKLERAD 241

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           SL+     +         +A +  +A  E ++S   G  S  GI++R+   +    A+  
Sbjct: 242 SLDAARSEIAEGWTCEGTVADLMGAAERELQRS---GDLSSEGIKERLAIALSRIEAKAG 298

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISILL 184
            +I      L ++ +    VG+ G V G+M  F  I+   + N+  + PGI E+L++  L
Sbjct: 299 RDIARGTGLLATIGATAPFVGLFGTVWGIMNAFIGISQTKTTNLAVVAPGIAEALLATAL 358

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ I YN F      +   +   + E    +SR  E
Sbjct: 359 GLVAAIPAVIIYNVFARALSSYRALLSDASGEIIQHISRDLE 400


>gi|15887516|ref|NP_353197.1| biopolymer transport protein [Agrobacterium tumefaciens str. C58]
 gi|15155043|gb|AAK85982.1| biopolymer transport protein [Agrobacterium tumefaciens str. C58]
          Length = 340

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 91/221 (41%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
              ++S + +FM     VK ++  L   S+++W+V + KS+     R +     ++    
Sbjct: 101 IPHNLSPWGMFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGSTLKVIRRA 160

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           ++L     +++N        + M+                 GI++R+   +         
Sbjct: 161 KTLAEATDAVENKGGPAALMLRMATHEMQLSDAVVEHTDGGGIKERVSSALSRIETHAGR 220

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            ++     L ++ S    VG+ G V G+M  F SI+   + N+  +   I E+L++  +G
Sbjct: 221 RMSRGTGALATIGSTAPFVGLFGTVWGIMNSFISISESQTTNLAVVAPGIAEALLATAIG 280

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ + YN F      +   +   A     ++SR  +
Sbjct: 281 LVAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSRDLD 321


>gi|1685077|gb|AAC44594.1| TolQ [Haemophilus influenzae]
          Length = 220

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 15  ALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCK 74
            LF++  + V+ +I +L  FSI+SW++IIQ+S       ++   FE  FWSG+ L  + +
Sbjct: 1   DLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTNALKEAHTFEDRFWSGEDLNKLYE 60

Query: 75  SLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKL 132
            L N  +   G   IF     E+ +       +P  I     R M++A+ RE+E +  ++
Sbjct: 61  GLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEAIIKGTTRAMNLAMNREIESLENRV 120

Query: 133 SFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIP 191
            FL +++S    +G+ G V G+M  F +++G     +  +   I E+L++  +GL  +IP
Sbjct: 121 PFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALVATAIGLFAAIP 180

Query: 192 SSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           + +AYN+              F +EF+ IL RQ  G  
Sbjct: 181 AVMAYNRLSLRVNAIEQDYVNFIDEFTTILHRQAFGKA 218


>gi|114562636|ref|YP_750149.1| MotA/TolQ/ExbB proton channel [Shewanella frigidimarina NCIMB 400]
 gi|114333929|gb|ABI71311.1| MotA/TolQ/ExbB proton channel [Shewanella frigidimarina NCIMB 400]
          Length = 229

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 70/219 (31%), Positives = 116/219 (52%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS   LF++  + VK ++  L   SI SW+VIIQ++    + R +   FE+ FWSG  L
Sbjct: 4   EISFIGLFLEASVLVKLVMLTLLALSIASWAVIIQRNKLLGSARVKSLRFEETFWSGVDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L    +   GL ++F++   E+ +     +++P  + D   R M V+++RE+E+
Sbjct: 64  NRLYKELIARGSAISGLESMFVAGFKEYTRLSKVNSKAPEAVMDGTSRAMRVSLSREMEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++    +  + +  PGI E+LI+  +GL
Sbjct: 124 LENHLPLLATIGSTSPYIGLFGTVWGIMNSFIALGAVENATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ I YN+F     K  M    F  EFS IL RQ 
Sbjct: 184 FAAIPAVIGYNRFTTQVDKIEMTYANFMEEFSNILQRQA 222


>gi|117618590|ref|YP_858097.1| protein TolQ [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117559997|gb|ABK36945.1| protein TolQ [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 229

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 107/222 (48%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS   LF Q  L VK ++  L   S++SW++IIQ+S           +FE  FWSG  L
Sbjct: 4   EISFIGLFWQASLLVKLVMMTLMGMSVVSWALIIQRSKAIKAANLASEQFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +   +  +    +  IF S   E+ +    GAR    + D   R M V+++R ++E
Sbjct: 64  NRLYQESSSRRDDIEGMEDIFYSGFKEYARLLKAGARGQDAVMDGTYRAMRVSLSRAVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL
Sbjct: 124 LESNLPVLATIGSISPYIGLFGTVWGIMNAFIALGQVQQATLQMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ I YN+F    ++       F +EF+ IL+RQ    
Sbjct: 184 FAAIPAVIFYNRFSNKVERLENAYANFMDEFTTILNRQIAQQ 225


>gi|90412126|ref|ZP_01220132.1| Putative TolQ protein [Photobacterium profundum 3TCK]
 gi|90326850|gb|EAS43235.1| Putative TolQ protein [Photobacterium profundum 3TCK]
          Length = 228

 Score =  158 bits (399), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 109/219 (49%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  LF+Q  L VK ++ +L   S+ SW++II++S        +   FE  FWSG  L
Sbjct: 4   ELSILDLFLQASLLVKIVMLILLGMSVASWAMIIKRSQILSNAASKAERFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K ++   +  +    IF +   E+ +      + P  + +   R M V++ RE++E
Sbjct: 64  SQLYKEVEARKDDLMGSEQIFYTGFKEYARLHRSNGQVPDAVMEGTSRAMRVSLLREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGAVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ + YNK      K       F  EFS+IL RQ 
Sbjct: 184 FAAIPAVMFYNKLTNQVSKLEHTYATFMEEFSSILHRQA 222


>gi|254229967|ref|ZP_04923369.1| protein TolQ [Vibrio sp. Ex25]
 gi|151937536|gb|EDN56392.1| protein TolQ [Vibrio sp. Ex25]
          Length = 221

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 65/211 (30%), Positives = 107/211 (50%), Gaps = 3/211 (1%)

Query: 18  MQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLK 77
           +Q  L VK ++  L   SI+SW++II++S       +   +FE  FWSG  L  + + +K
Sbjct: 1   LQASLLVKLVMLTLLGMSIVSWAMIIKRSKVLSQASKNAEQFEDKFWSGTDLSQLYQKVK 60

Query: 78  NHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFL 135
              +       IF +  +E+ +     A SP  I +   R M VA++RE++E+   L FL
Sbjct: 61  ARKDEIEGTEEIFYAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVSREVDELETSLPFL 120

Query: 136 GSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVSIPSSI 194
            ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL  +IP+ +
Sbjct: 121 ATVGSISPYIGLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGLFAAIPAVM 180

Query: 195 AYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           AYN+      K       F+ EF +IL RQ 
Sbjct: 181 AYNRLSNKVSKLEHTYATFSEEFHSILHRQA 211


>gi|254448719|ref|ZP_05062177.1| protein TolQ [gamma proteobacterium HTCC5015]
 gi|198261727|gb|EDY86014.1| protein TolQ [gamma proteobacterium HTCC5015]
          Length = 239

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 67/223 (30%), Positives = 119/223 (53%), Gaps = 4/223 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  L  +    V+ ++ LLF  S+ SW VI  K   +     +   FE  FWSG  L 
Sbjct: 7   LSIVGLIWEASFIVQLVMLLLFAASVTSWWVIYLKVKGYKQANEEADRFEDQFWSGGDLR 66

Query: 71  TVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + ++L+N      G+  IF +   E+ +    G   P  + +   R+M VA++RE++E+
Sbjct: 67  DIYEALQNRRVPRQGMEHIFEAGYREYARQVRLGVV-PGQVVEAAQRVMRVALSREIDEL 125

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
             +LSFL ++ S    VG+ G V+G+M  F+++       + +  PGI E+LI+  +GL 
Sbjct: 126 ETRLSFLATVGSTSPYVGLFGTVVGIMNSFRALGQVQQATLSMVAPGIAEALIATAIGLL 185

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ +AYN+F    ++  ++ + F  EF+A++ RQ   + +
Sbjct: 186 AAIPAVVAYNRFANQVERLELRYDNFKEEFAALIHRQASASHA 228


>gi|118594341|ref|ZP_01551688.1| MotA/TolQ/ExbB proton channel [Methylophilales bacterium HTCC2181]
 gi|118440119|gb|EAV46746.1| MotA/TolQ/ExbB proton channel [Methylophilales bacterium HTCC2181]
          Length = 223

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 109/218 (50%), Gaps = 4/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S F+L     L V+ ++ +L   S++SW  I  K           +EFE+ FWSG  L
Sbjct: 6   DLSFFSLIFGASLPVQLVMLILIAASVISWKFIYLKVKFLKESEENAQEFEKFFWSGGDL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +S+ N+     GLA IF S   E+    +  A     I + + R M  +  RE++ 
Sbjct: 66  AKLYESVSNNSRGINGLAEIFRSGYKEYMGQKEHQAFDKKSI-ESVRRAMRASYNREIDT 124

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + + L FL S+ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL
Sbjct: 125 LDQHLPFLASVGSVSPYIGLFGTVWGIMNAFIGLSNVAQATLSQVAPGIAEALIATAIGL 184

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
             +IP+ IAYN+F     + +++ E F  EF  I+ R+
Sbjct: 185 FAAIPAVIAYNRFATKVDRLSLRFESFIEEFINIVDRK 222


>gi|73540496|ref|YP_295016.1| MotA/TolQ/ExbB proton channel [Ralstonia eutropha JMP134]
 gi|72117909|gb|AAZ60172.1| MotA/TolQ/ExbB proton channel [Ralstonia eutropha JMP134]
          Length = 227

 Score =  158 bits (398), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 72/228 (31%), Positives = 118/228 (51%), Gaps = 5/228 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L  + ++ LL + S+ SW+ I +K +   + R Q   FE
Sbjct: 1   MNPVTV-TQDLSIISLVLHASLLAQAVMALLLVMSLFSWTYIFRKHLALRSARTQTEGFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           + FW+G  L+ +  S     H+   L  IF S M E+ K+ ++G      + D   R M 
Sbjct: 60  RDFWAGGDLQALYNSAVNNRHNTGALERIFESGMGEFLKARERGNE-ASALLDAARRAMR 118

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E
Sbjct: 119 AAYQREMDVLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLASVAPGIAE 178

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +L++  +GL  +IP+ IAYN++  +  + A++ E F  EF  IL RQT
Sbjct: 179 ALVATAIGLFAAIPAVIAYNRYATEIDRLAIRFESFMEEFLNILQRQT 226


>gi|325291602|ref|YP_004277466.1| biopolymer transport protein [Agrobacterium sp. H13-3]
 gi|325059455|gb|ADY63146.1| biopolymer transport protein [Agrobacterium sp. H13-3]
          Length = 387

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 42/221 (19%), Positives = 91/221 (41%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
              ++S + +FM     VK ++  L   S+++W+V + KS+     R +     ++    
Sbjct: 148 IPHNLSPWGMFMAADWVVKGVMIGLAFASLVTWTVWVAKSIELAGARVRAGATLKVIRRA 207

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           ++L    ++++         + M+                 GI++R+   +         
Sbjct: 208 KTLNEATEAVEKKGGPAALMLRMATHEMQLSDAVVEHTDGGGIKERVSSALSRIETHAGR 267

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            ++     L ++ S    VG+ G V G+M  F SI+   + N+  +   I E+L++  +G
Sbjct: 268 RMSRGTGALATIGSTAPFVGLFGTVWGIMNSFISISESQTTNLAVVAPGIAEALLATAIG 327

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ + YN F      +   +   A     ++SR  +
Sbjct: 328 LVAAIPAVVIYNVFARSITGYRHLLADAAAGVERLVSRDLD 368


>gi|297539679|ref|YP_003675448.1| protein TolQ [Methylotenera sp. 301]
 gi|297259026|gb|ADI30871.1| protein TolQ [Methylotenera sp. 301]
          Length = 226

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 109/222 (49%), Gaps = 3/222 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+SIF+L     L V+ ++ +L   S+ SW  I  K            +FE+ FWSG
Sbjct: 5   AANDMSIFSLVAGASLPVQMVLLVLIGTSLFSWWYIFIKLATIKKAETNAEDFEKAFWSG 64

Query: 67  QSLETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             L  + + L        G+A+IF +   E+ +   +       + +   R M  A  RE
Sbjct: 65  GDLNKLFEGLASSRRKPQGMASIFEAGFREYVRHKQQTTMDVSDVMEGSRRAMRAAYNRE 124

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           L+++   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E+L++  
Sbjct: 125 LDDLDAHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVAQATLSQVAPGIAEALVATA 184

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +GL  +IP+ IAYN+F     + +++ E F  EF+ IL R++
Sbjct: 185 IGLFAAIPAVIAYNRFASSVDRLSVRYESFMEEFTNILQRKS 226


>gi|327393163|dbj|BAK10585.1| protein TolQ [Pantoea ananatis AJ13355]
          Length = 225

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 107/218 (49%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +++  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNVLDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAGREADAFEDKFWSGVELS 60

Query: 71  TVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +           IF +   E+ +       +P    +   R M +++ RELE +
Sbjct: 61  RLYQESQARREELAGSEQIFYAGFKEFARLHRVNNHAPEAAVEGASRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K     + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLEQGYDNFMEEFTAILHRQA 218


>gi|94311610|ref|YP_584820.1| MotA/TolQ/ExbB proton channel [Cupriavidus metallidurans CH34]
 gi|93355462|gb|ABF09551.1| membrane spanning protein in TolA-TolQ-TolR complex [Cupriavidus
           metallidurans CH34]
 gi|222874295|gb|EEF11426.1| predicted protein [Populus trichocarpa]
          Length = 227

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 72/228 (31%), Positives = 117/228 (51%), Gaps = 5/228 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI +L +   L  + ++ LL + S+ SW+ I +K +     R Q   FE
Sbjct: 1   MNPVTV-TQDLSIISLVLHASLLAQAVMALLLVMSLFSWTYIFRKHLALRAARTQTEGFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           + FW+G  L+ +  S     H+   L  IF S M E+ K+ ++G      + D   R M 
Sbjct: 60  RDFWAGGDLQALYNSAVNNRHNTGALERIFESGMGEFLKARERGNE-AGALLDAARRAMR 118

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E
Sbjct: 119 AAYQREMDVLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLASVAPGIAE 178

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +L++  +GL  +IP+ IAYN++  +  + A++ E F  EF  IL RQT
Sbjct: 179 ALVATAIGLFAAIPAVIAYNRYATEIDRLAIRFESFMEEFLNILQRQT 226


>gi|212712436|ref|ZP_03320564.1| hypothetical protein PROVALCAL_03530 [Providencia alcalifaciens DSM
           30120]
 gi|212684893|gb|EEB44421.1| hypothetical protein PROVALCAL_03530 [Providencia alcalifaciens DSM
           30120]
          Length = 227

 Score =  158 bits (398), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 67/221 (30%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L V+ I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVQIIMFVLIGFSIASWAIIIQRTKILNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  +   +   G   IF S   E+ +       +P  +     R M +++ REL
Sbjct: 61  ELSRLYKESQARRDALGGAEQIFYSGFKEFVRLHQANIHAPDAVVTGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESVESHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+      K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNLRVNKLEQSYDNFMEEFLAILHRQA 221


>gi|119504261|ref|ZP_01626341.1| Biopolymer transport protein [marine gamma proteobacterium
           HTCC2080]
 gi|119459769|gb|EAW40864.1| Biopolymer transport protein [marine gamma proteobacterium
           HTCC2080]
          Length = 235

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 63/227 (27%), Positives = 108/227 (47%), Gaps = 6/227 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++ I  L +     V+ ++ +L + S+ SW +I+Q+ + +  +  +   FE  FWSG  L
Sbjct: 4   ELGILELIIGASGTVQVVMLILLLASVSSWYLIVQRVMLYRRMTEELGGFEAHFWSGVDL 63

Query: 70  ETVCKS-----LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             + +            IG+ +IF +   E+ +   +       + +   R M VA  RE
Sbjct: 64  AQIYREGNEALADGATPIGVESIFRAGFKEFSRLSQQSDIEADAVLEGARRAMRVATLRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
            + +   L FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  
Sbjct: 124 SDRLESNLPFLASVGSTSPYIGLFGTVWGIMHSFRGLANATQATLATVAPGISEALIATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +GL  +IP+ +AYN+F   S       + F +EFS IL RQT    +
Sbjct: 184 MGLFAAIPAVLAYNRFAARSDSLINHYDTFVDEFSGILQRQTYAQRA 230


>gi|54309714|ref|YP_130734.1| putative TolQ protein [Photobacterium profundum SS9]
 gi|46914152|emb|CAG20932.1| Putative TolQ protein [Photobacterium profundum SS9]
          Length = 228

 Score =  157 bits (397), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 109/219 (49%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  LF+Q  L VK ++ +L   S+ SW++II++S        +   FE  FWSG  L
Sbjct: 4   ELSILDLFLQASLLVKIVMLILLGMSVASWAMIIKRSQILSNAASKAGRFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K ++   +  +    IF +   E+ +      + P  + +   R M V++ RE++E
Sbjct: 64  SQLYKEVEARKDDLMGSEQIFYTGFKEYARLHRSNGQVPDAVMEGTSRAMRVSLLREVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETSLPFLATVGSISPYIGLFGTVWGIMHAFIALGAVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ + YNK      K       F  EFS+IL RQ 
Sbjct: 184 FAAIPAVMFYNKLTNQVSKLEHTYATFMEEFSSILHRQA 222


>gi|149910562|ref|ZP_01899201.1| Putative TolQ protein [Moritella sp. PE36]
 gi|149806405|gb|EDM66378.1| Putative TolQ protein [Moritella sp. PE36]
          Length = 230

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 68/223 (30%), Positives = 110/223 (49%), Gaps = 3/223 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   DIS F LF +  + VK ++ +L   S+ SW++I  +S          + FE  FWS
Sbjct: 1   MEAADISFFELFWEASILVKAVMLILLSMSVASWAMIFHRSKALTQANEASKRFEDRFWS 60

Query: 66  GQSLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G  L  + K      N    +  IF +   E+ +  +    +   I D   R M VA++R
Sbjct: 61  GIDLSKLYKESDARKNNIQGMELIFHAGFKEYVRIHNADQDNTDAIMDGSYRTMRVALSR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++E+   L+ L ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+ 
Sbjct: 121 EVDELEVHLNNLATIGSISPYIGLFGTVWGIMSSFIALGAVQQATLAMVAPGIAEALIAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +GL  +IP+ IAYN+F +   +       F  EFS+IL RQT
Sbjct: 181 AMGLFAAIPAVIAYNRFSDQVMRIENNYANFMEEFSSILHRQT 223


>gi|59711565|ref|YP_204341.1| membrane spanning protein in TolA-TolQ-TolR complex [Vibrio
           fischeri ES114]
 gi|197334878|ref|YP_002155720.1| protein TolQ [Vibrio fischeri MJ11]
 gi|59479666|gb|AAW85453.1| membrane spanning protein in TolA-TolQ-TolR complex [Vibrio
           fischeri ES114]
 gi|197316368|gb|ACH65815.1| protein TolQ [Vibrio fischeri MJ11]
          Length = 228

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 111/222 (50%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  LF+Q  L VK ++ +L   S++SW++I ++S      R     FE  FWSG  L
Sbjct: 4   ELSILDLFLQASLLVKIVMLILLSLSVISWAMIFKRSKVLSVARSDAERFEDKFWSGMDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   +K   +   G   IF S  +E+ +     + S   + D   R M V ++RE++ 
Sbjct: 64  SQLFNEVKVRKDRISGTEKIFYSGFNEFARLSRVNSSSSEAVMDGTARAMRVTVSREVDN 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSITPYIGLFGTVWGIMHAFIALGAVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ IAYN+      K       F +EFS+IL RQ   +
Sbjct: 184 FAAIPAVIAYNRLSVKVGKLEHNYAAFMDEFSSILHRQAMAS 225


>gi|146282309|ref|YP_001172462.1| tolQ protein [Pseudomonas stutzeri A1501]
 gi|145570514|gb|ABP79620.1| tolQ protein [Pseudomonas stutzeri A1501]
          Length = 237

 Score =  157 bits (397), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 58/220 (26%), Positives = 108/220 (49%), Gaps = 4/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S++ L  +  L V+ ++ +L + S+ SW +II++S       R    F+Q F  G  L 
Sbjct: 8   MSVWGLISEASLVVQAVMVILVLASVSSWYLIIRRSAALHRSERLLHSFQQRFRQGGDLA 67

Query: 71  TVCKSLKNHH---NIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            + +  +         L  IF++   ++ +   +   +P  + + ++R + VAIA + E 
Sbjct: 68  QLYREGQQQPLPEEAALQRIFLAGYGDFAQLQREAGIAPDAVAEGVERSLYVAIAEQEER 127

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL
Sbjct: 128 LEKGLQFLATVGSVSPYIGLFGTVWGIMNSFLGLSQVQQATLSTVAPGIAEALIATAIGL 187

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ +AYN+F    +K   +   F NE  A L R+  
Sbjct: 188 FAAIPAVMAYNRFAAHGQKLVGRYYAFGNELQARLHRRLH 227


>gi|110833616|ref|YP_692475.1| biopolymer transport protein TolQ [Alcanivorax borkumensis SK2]
 gi|110646727|emb|CAL16203.1| biopolymer transport protein TolQ [Alcanivorax borkumensis SK2]
          Length = 228

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 68/223 (30%), Positives = 111/223 (49%), Gaps = 4/223 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+ +L     + V+ ++ LL + S+ SW +I+ +       +R  R FE  FWS   L 
Sbjct: 7   MSVVSLISNATVVVQLVMALLILASLTSWYMIVGRFRVLGRAQRAGRAFEGKFWSSDDLA 66

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           ++    +   +   G  AIF +   E+ +   K AR    + D   R M VA+ RE   +
Sbjct: 67  SLYNQSRKEPDLDSGSEAIFRAGFQEFVRLS-KSARGGEAVMDGAQRAMRVALQREQTRL 125

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
           T+ L FL ++ S    VG+ G V G+M  F ++A      +  +   I E+LI+  +GL 
Sbjct: 126 TKHLPFLATVGSTSPYVGLFGTVWGIMNSFMALANVKQATLSVVAPGIAEALIATAIGLF 185

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ +AYN+F   S     + E FA EFS++L RQ  G  +
Sbjct: 186 AAIPAVMAYNRFSAQSDALLTENEMFAEEFSSVLHRQAHGRGA 228


>gi|84516655|ref|ZP_01004014.1| proton transporter TolQ [Loktanella vestfoldensis SKA53]
 gi|84509691|gb|EAQ06149.1| proton transporter TolQ [Loktanella vestfoldensis SKA53]
          Length = 224

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 73/220 (33%), Positives = 122/220 (55%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             + +++ALF +  + VK ++ +L + SI  W++I+ K++ +   R +   F++ FWSG+
Sbjct: 4   AHEFTMWALFARATIIVKLVMIMLILASIWCWAIIVDKTIQYRRARTEAEIFDRAFWSGE 63

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+ +   +    +     IF + M EW++S  +      G   RIDR MDVAIA+E   
Sbjct: 64  PLDQLFDQIGPDPDGASEKIFAAGMLEWRRSHRQDGGLIAGATARIDRSMDVAIAKETAR 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + + L+ L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL
Sbjct: 124 LQKSLAVLATVGSTAPFVGLFGTVWGIMNAFIEIAEAQNTNLAVVAPGIAEALLATGLGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ I YNK   DS++     E FA+EF+ ILSRQ +
Sbjct: 184 LAAIPAVIYYNKLSADSERIVAGYEAFADEFATILSRQLD 223


>gi|254000103|ref|YP_003052166.1| protein TolQ [Methylovorus sp. SIP3-4]
 gi|313202062|ref|YP_004040720.1| protein tolq [Methylovorus sp. MP688]
 gi|253986782|gb|ACT51639.1| protein TolQ [Methylovorus sp. SIP3-4]
 gi|312441378|gb|ADQ85484.1| protein TolQ [Methylovorus sp. MP688]
          Length = 224

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 107/217 (49%), Gaps = 3/217 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S++ L     + V+ ++ +L + S++SW  I  K  +  +  R    FE+ FW G  L
Sbjct: 6   DMSLYTLIAGASVPVQIVMAILLLTSLVSWWYIFIKVFSIRSAERDALAFEEEFWRGGDL 65

Query: 70  ETVCK--SLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +    +       G+A+IF +   E+ K   +G      +     R M  +  RE+++
Sbjct: 66  NKLYDSVNAGRRRAQGMASIFEAGFKEYAKLKRQGGLEISDVTQSAQRAMRASYNREMDD 125

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E+L++  +GL
Sbjct: 126 LDSHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNMAQATLSHVAPGIAEALVATAIGL 185

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
             +IP+ IAYN+F     + A++ E F  EF+ IL R
Sbjct: 186 FAAIPAVIAYNRFASAVDRLAVRYESFMEEFTNILQR 222


>gi|15604178|ref|NP_220693.1| TOLQ protein (tolQ) [Rickettsia prowazekii str. Madrid E]
 gi|3860870|emb|CAA14770.1| TOLQ PROTEIN (tolQ) [Rickettsia prowazekii]
 gi|292571910|gb|ADE29825.1| TolQ [Rickettsia prowazekii Rp22]
          Length = 241

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 72/220 (32%), Positives = 122/220 (55%), Gaps = 3/220 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI +L     +  K ++ +L   SI SWS+I+ K      ++R+ + FE +FWSG  L
Sbjct: 18  NLSILSLISSADIIGKSVMLMLLFASIWSWSIILHKIFRLAQVQRRIQSFENVFWSGCVL 77

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKG--ARSPIGIQDRIDRMMDVAIARELEE 127
           E + +S+K   N  LA IF+SAM+E      KG         ++RI   M +A  RE+E+
Sbjct: 78  EQLYESIKKSVNNPLALIFVSAMNECNSLNTKGFSEALKNNHKERIMSAMYLAQNREIEK 137

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + + L+ L ++ S+   +G+ G V G+M  FQSIA   + ++  +   I E+L++  +GL
Sbjct: 138 LEQNLNVLATIGSSAPFIGLFGTVWGIMHSFQSIASSKNTSLAVVAPGIAEALLATAIGL 197

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            V+IP+ I YN  I        ++E F +E ++ILS+  +
Sbjct: 198 FVAIPAVIFYNYLISRITLINNKIEDFISELNSILSKAID 237


>gi|33594235|ref|NP_881879.1| putative TolQ-like translocation protein [Bordetella pertussis
           Tohama I]
 gi|33603209|ref|NP_890769.1| putative TolQ-like translocation protein [Bordetella bronchiseptica
           RB50]
 gi|33564310|emb|CAE43611.1| putative TolQ-like translocation protein [Bordetella pertussis
           Tohama I]
 gi|33568840|emb|CAE34598.1| putative TolQ-like translocation protein [Bordetella bronchiseptica
           RB50]
 gi|332383649|gb|AEE68496.1| putative TolQ-like translocation protein [Bordetella pertussis CS]
          Length = 226

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 113/219 (51%), Gaps = 4/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+ +L     + V+ I+ LL   SI+SW+ I  K +      +Q R FE  FWSG  L
Sbjct: 6   DMSLLSLISHASVPVQLIMLLLLGISIMSWTYIFAKRLAIKRAHQQTRRFEDDFWSGGDL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGAR-SPIGIQDRIDRMMDVAIARELE 126
             + +++    +    LA IF + M+E+ K+    A      + D   R M  A  RE++
Sbjct: 66  AMLQQAVATRRDEQGALARIFDAGMTEFLKARRTSAAGDVNAVLDGPRRAMRAAYQREMD 125

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L+FL S  S    +G+LG V G+M  F  ++      + ++   I E+LI+  +G
Sbjct: 126 SLESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNMQQATLAAVAPGIAEALIATAIG 185

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           L  +IP+ +AYN+F  D  + +++ + F +EF  IL RQ
Sbjct: 186 LFAAIPAVVAYNRFTNDIDRLSIRFDSFVDEFLNILQRQ 224


>gi|152980246|ref|YP_001354154.1| biopolymer transport protein [Janthinobacterium sp. Marseille]
 gi|151280323|gb|ABR88733.1| biopolymer transport protein [Janthinobacterium sp. Marseille]
          Length = 230

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 71/226 (31%), Positives = 110/226 (48%), Gaps = 8/226 (3%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   L     + V+ ++ LL   S++SW+ I +K       R Q  EFE+ FWSG 
Sbjct: 4   TQDLSFVHLITNASVLVQLVMALLLGVSVMSWTYIFRKMFAIKNARAQTEEFERAFWSGG 63

Query: 68  SLETVCKSLKNHHN------IGLAAIFMSAMSEWKKSCDKGAR-SPIGIQDRIDRMMDVA 120
            L T+     ++          L  IF + MSE+ K+             D   R M  A
Sbjct: 64  DLNTLYLEASSNRRKNNGSTGALERIFEAGMSEFNKAKGSNDSFHVSARLDGARRAMRAA 123

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
             RE++ +   L+FL S+ S    VG+ G V G+M  F+ +A      + ++   I E+L
Sbjct: 124 YQREMDALESHLAFLASVGSVSPYVGLFGTVWGIMNAFRGLANVQQATLAAVAPGIAEAL 183

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           I+  +GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQT
Sbjct: 184 IATAIGLFAAIPAVVAYNRYSHDIDRLAIRFESFVEEFSNILQRQT 229


>gi|99082208|ref|YP_614362.1| MotA/TolQ/ExbB proton channel [Ruegeria sp. TM1040]
 gi|99038488|gb|ABF65100.1| MotA/TolQ/ExbB proton channel [Ruegeria sp. TM1040]
          Length = 231

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 81/219 (36%), Positives = 123/219 (56%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +  L VK ++ +L + SI SWS+IIQK + + T RR+ + FE+ FWSG  
Sbjct: 12  IDFSMWGLFARATLTVKLVMIMLIVASIWSWSIIIQKVITYRTARREAQVFERAFWSGNP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    +     IF + M EW++S         G Q RIDR MDVAI++E E +
Sbjct: 72  LDELFEEIGAEPSGRSERIFAAGMIEWRRSHRTDGALIPGAQARIDRSMDVAISKESEGL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLQVLATIGSTTPFIGLFGTVWGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ I SRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDRIIGGYEAFADEFATIFSRQLD 230


>gi|119896711|ref|YP_931924.1| translocation protein TolQ [Azoarcus sp. BH72]
 gi|119669124|emb|CAL93037.1| translocation protein TolQ [Azoarcus sp. BH72]
          Length = 224

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 111/221 (50%), Gaps = 4/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L  Q  + V+ ++ +L   S++SW  I +K       R +  EFE+ FWSG 
Sbjct: 4   SHDLSIISLITQASVLVQLVMAMLAGLSVMSWYWIFRKWFQIRAARSKTTEFERDFWSGG 63

Query: 68  SLETVCK--SLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +  S   HH  G+  IF S   E+ K   K +       D   R M     RE+
Sbjct: 64  DLNALFQSASAARHHTGGMERIFESGYREYNKLRAK-SHDHGATIDGARRAMRATFQREV 122

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           +++   L+FL S+ S    +G+ G V G+M  F+ ++   +  +    PGI E+L++  +
Sbjct: 123 DDLEAHLAFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVGTATLTQVAPGIAEALVATAI 182

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+F  D  +  ++ E F  EFS IL R  
Sbjct: 183 GLFAAIPAVVAYNRFAHDIDRIGIRFESFMEEFSNILQRNL 223


>gi|254516706|ref|ZP_05128765.1| protein TolQ [gamma proteobacterium NOR5-3]
 gi|219675129|gb|EED31496.1| protein TolQ [gamma proteobacterium NOR5-3]
          Length = 236

 Score =  157 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 110/222 (49%), Gaps = 6/222 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  L M  G+ VK ++ LL   S+ SW +I Q+   F +   +  +FE+ FWSG  L
Sbjct: 3   ELSIIDLVMDAGVTVKLVMALLMAASVSSWYMIFQRFFYFRSAGAEMLDFEEHFWSGVDL 62

Query: 70  ETVCKSLKNHHNI-----GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             + +             G+  +F +   E+ +   +       + +   R M VA+ RE
Sbjct: 63  AQLYREGNERAADGEIIIGVEGVFRAGFKEFSRLAQQSDMDAEAMLEGARRAMRVAMMRE 122

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
            E + + L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+L++  
Sbjct: 123 EERLEQHLPFLATVGSTSPYVGLFGTVWGIMNSFRGLANTSQATLATVAPGISEALVATA 182

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +GL  +IP+ +AYN+F      +  + + F +EFS+IL RQ 
Sbjct: 183 MGLFAAIPAVMAYNRFASKVDVYGKRYDTFVDEFSSILGRQA 224


>gi|110640945|ref|YP_668673.1| colicin uptake protein TolQ [Escherichia coli 536]
 gi|312965173|ref|ZP_07779410.1| protein TolQ [Escherichia coli 2362-75]
 gi|110342537|gb|ABG68774.1| TolQ protein [Escherichia coli 536]
 gi|307552588|gb|ADN45363.1| membrane spanning protein in TolA-TolQ-TolR complex [Escherichia
           coli ABU 83972]
 gi|307627849|gb|ADN72153.1| colicin uptake protein TolQ [Escherichia coli UM146]
 gi|312290264|gb|EFR18147.1| protein TolQ [Escherichia coli 2362-75]
 gi|320194084|gb|EFW68716.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           WV_060327]
 gi|330910488|gb|EGH38998.1| motA/TolQ/ExbB proton channel family protein [Escherichia coli
           AA86]
          Length = 227

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGKRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNRELENL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|82703830|ref|YP_413396.1| MotA/TolQ/ExbB proton channel [Nitrosospira multiformis ATCC 25196]
 gi|82411895|gb|ABB76004.1| Cell division and transport-associated protein TolQ [Nitrosospira
           multiformis ATCC 25196]
          Length = 228

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/223 (30%), Positives = 105/223 (47%), Gaps = 3/223 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S+F L     L V+ ++ LL I S++SW  I +K        RQ  EFE +FW G 
Sbjct: 6   SQDMSLFQLVGSASLPVQLVMLLLVIASLMSWWYIFRKLFVIREAERQCDEFENVFWKGT 65

Query: 68  SLETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + +S     H    +  IF +   E+ K   +         D   R M     RE+
Sbjct: 66  DLNALFQSAAASRHTAGSMERIFEAGFREFMKHRRQPGMDTGTAMDSTRRAMRATYQREM 125

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL ++ S    VG+ G V G+M  F+ ++      +    PGI E+LI+  +
Sbjct: 126 DRLESHLSFLATVGSVSPYVGLFGTVWGIMNSFRGLSNVAQATIAHVAPGIAEALIATAM 185

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           GL  +IP+ IAYN++     + A + E F  E S +L RQ  G
Sbjct: 186 GLFAAIPAVIAYNRYASSMDRLATRFESFMEEMSNVLQRQAGG 228


>gi|110804637|ref|YP_688157.1| colicin uptake protein TolQ [Shigella flexneri 5 str. 8401]
 gi|170020918|ref|YP_001725872.1| colicin uptake protein TolQ [Escherichia coli ATCC 8739]
 gi|170768990|ref|ZP_02903443.1| protein TolQ [Escherichia albertii TW07627]
 gi|256021188|ref|ZP_05435053.1| colicin uptake protein TolQ [Shigella sp. D9]
 gi|293403992|ref|ZP_06647986.1| colicin uptake protein TolQ [Escherichia coli FVEC1412]
 gi|293409121|ref|ZP_06652697.1| TolQ protein [Escherichia coli B354]
 gi|293414022|ref|ZP_06656671.1| TolQ protein [Escherichia coli B185]
 gi|293433005|ref|ZP_06661433.1| TolQ [Escherichia coli B088]
 gi|298379772|ref|ZP_06989377.1| biopolymer transporter TolQ [Escherichia coli FVEC1302]
 gi|110614185|gb|ABF02852.1| TolQ protein [Shigella flexneri 5 str. 8401]
 gi|169755846|gb|ACA78545.1| protein TolQ [Escherichia coli ATCC 8739]
 gi|170122062|gb|EDS90993.1| protein TolQ [Escherichia albertii TW07627]
 gi|291323824|gb|EFE63246.1| TolQ [Escherichia coli B088]
 gi|291428578|gb|EFF01603.1| colicin uptake protein TolQ [Escherichia coli FVEC1412]
 gi|291434080|gb|EFF07053.1| TolQ protein [Escherichia coli B185]
 gi|291469589|gb|EFF12073.1| TolQ protein [Escherichia coli B354]
 gi|298279470|gb|EFI20978.1| biopolymer transporter TolQ [Escherichia coli FVEC1302]
 gi|315135394|dbj|BAJ42553.1| inner membrane protein [Escherichia coli DH1]
 gi|323153747|gb|EFZ39994.1| protein TolQ [Escherichia coli EPECa14]
 gi|323938276|gb|EGB34534.1| TolQ protein [Escherichia coli E1520]
 gi|323946997|gb|EGB43011.1| TolQ protein [Escherichia coli H120]
 gi|323972023|gb|EGB67243.1| TolQ protein [Escherichia coli TA007]
 gi|323976282|gb|EGB71372.1| TolQ protein [Escherichia coli TW10509]
 gi|326345733|gb|EGD69472.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           O157:H7 str. 1125]
 gi|327254426|gb|EGE66048.1| protein TolQ [Escherichia coli STEC_7v]
 gi|332097657|gb|EGJ02632.1| protein TolQ [Shigella boydii 3594-74]
 gi|332342074|gb|AEE55408.1| colicin uptake protein TolQ [Escherichia coli UMNK88]
 gi|332763943|gb|EGJ94181.1| protein TolQ [Shigella flexneri K-671]
 gi|333007352|gb|EGK26832.1| protein TolQ [Shigella flexneri VA-6]
          Length = 227

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNRELENL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|33598299|ref|NP_885942.1| putative TolQ-like translocation protein [Bordetella parapertussis
           12822]
 gi|33566857|emb|CAE39072.1| putative TolQ-like translocation protein [Bordetella parapertussis]
          Length = 226

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 113/219 (51%), Gaps = 4/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+ +L     + V+ I+ LL   SI+SW+ I  K +      +Q R FE  FWSG  L
Sbjct: 6   DMSLLSLVSHASVPVQLIMLLLLGISIMSWTYIFAKRLAIKRAHQQTRRFEDDFWSGGDL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGAR-SPIGIQDRIDRMMDVAIARELE 126
             + +++    +    LA IF + M+E+ K+    A      + D   R M  A  RE++
Sbjct: 66  AMLQQAVATRRDEQGALARIFDAGMTEFLKARRTSAAGDVNAVLDGPRRAMRAAYQREMD 125

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L+FL S  S    +G+LG V G+M  F  ++      + ++   I E+LI+  +G
Sbjct: 126 SLESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNMQQATLAAVAPGIAEALIATAIG 185

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           L  +IP+ +AYN+F  D  + +++ + F +EF  IL RQ
Sbjct: 186 LFAAIPAVVAYNRFTNDIDRLSIRFDSFVDEFLNILQRQ 224


>gi|330828304|ref|YP_004391256.1| protein TolQ [Aeromonas veronii B565]
 gi|328803440|gb|AEB48639.1| Protein TolQ [Aeromonas veronii B565]
          Length = 229

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 107/222 (48%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +IS   LF Q  L VK ++  L   SI+SW++IIQ+S           +FE  FWSG  L
Sbjct: 4   EISFIGLFWQASLLVKLVMMTLMSMSIVSWALIIQRSKAIKAANLASEQFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +   +  +    +  IF S   E+ +    GAR    + D   R M V+++R +++
Sbjct: 64  NRLYQESSSRRDDIEGMEDIFYSGFKEYARLLKAGARGQDAVMDGTYRAMRVSLSRAVDD 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL
Sbjct: 124 LESNLPVLATIGSISPYIGLFGTVWGIMNAFIALGQVQQATLQMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ I YN+F    ++       F +EF+ IL+RQ    
Sbjct: 184 FAAIPAVIFYNRFSNKVERLENAYANFMDEFTTILNRQIAQQ 225


>gi|309786416|ref|ZP_07681042.1| protein TolQ [Shigella dysenteriae 1617]
 gi|308925810|gb|EFP71291.1| protein TolQ [Shigella dysenteriae 1617]
          Length = 227

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW+VIIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAVIIQRTRILNAAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNRELENL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|325498080|gb|EGC95939.1| colicin uptake protein TolQ [Escherichia fergusonii ECD227]
          Length = 227

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDNLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNRELENL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|119383479|ref|YP_914535.1| MotA/TolQ/ExbB proton channel [Paracoccus denitrificans PD1222]
 gi|119373246|gb|ABL68839.1| outer membrane transport energization protein ExbB [Paracoccus
           denitrificans PD1222]
          Length = 431

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 99/226 (43%), Gaps = 3/226 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +F+     VK ++  L   S+++W+V++ K +  +    + +   +      
Sbjct: 202 PHDLSPWGMFLAADWVVKAVMIGLAFASVVTWTVLVAKVLELLGATNRAQSGIRRIEHAA 261

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SL     S  +  +     I  +A    + +         GI++R+D  +D   A     
Sbjct: 262 SLPAALASAGSRRDPVSRMIRAAAAEYDRSAPALDQAGDSGIKERVDSHLDRIEAIAGRR 321

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           ++     L ++ S    VG+ G V G+M  F  I+   + N+  +   I E+L++  +GL
Sbjct: 322 MSRGTGVLATIGSTAPFVGLFGTVWGIMNSFIGISQAQTTNLAVVAPGIAEALLATAIGL 381

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE--GNIS 230
             +IP+ + YN F      + +++   A     ++SR  +  G++S
Sbjct: 382 VAAIPAVVIYNVFARAITGYRLRLANAAAGVKRLVSRDLDFRGSVS 427


>gi|85374733|ref|YP_458795.1| TolQ, tolQ protein [Erythrobacter litoralis HTCC2594]
 gi|84787816|gb|ABC63998.1| TolQ, tolQ protein [Erythrobacter litoralis HTCC2594]
          Length = 234

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 110/217 (50%), Gaps = 2/217 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +    LF+   + V+ ++  L + SI SW +I+  S+     R +   FE+  W     +
Sbjct: 17  LDPLQLFLDADIVVQAVMIGLILASIWSWMIIVSFSMRLSGARSRSARFEKDLWQADDFD 76

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
           ++    +N  ++  A I   AM+EWK+S  KG +      +RI   M   +A E + +  
Sbjct: 77  SIMGKYQN-KDVPSARIAGVAMTEWKRSTSKGLKDREAASNRIAAAMGGQVAEEADTLAA 135

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           +L+FL +  S    VG+ G V G+M  F  I    S+++  +   I E+L +  +GL  +
Sbjct: 136 RLNFLATTGSVAPFVGLFGTVWGIMNSFFQIGVQESSSLAVVAPGISEALFATAIGLFAA 195

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           IP+ IAYN+F      F  +++ FA++F A LSR+ E
Sbjct: 196 IPAVIAYNRFSSKVNIFEARLQRFADKFHANLSRELE 232


>gi|126733596|ref|ZP_01749343.1| proton transporter TolQ [Roseobacter sp. CCS2]
 gi|126716462|gb|EBA13326.1| proton transporter TolQ [Roseobacter sp. CCS2]
          Length = 224

 Score =  156 bits (395), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 76/221 (34%), Positives = 121/221 (54%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  + +++ALF +  + VK ++ +L   S+  W+VII K++ +   R +   F++ FWSG
Sbjct: 3   AAQEFTMWALFARATITVKIVMIMLVAASVWCWAVIIDKTIQYRKARAEADVFDRSFWSG 62

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           + L+ +   +    +     IF S M EW++S  +      G   RIDR MDVAIA++  
Sbjct: 63  EPLDALFDQIGADPDGQSEKIFASGMLEWRRSHRQDGGLIAGATARIDRSMDVAIAKQAS 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            + + L  L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LG
Sbjct: 123 SLQKGLPILATVGSTAPFVGLFGTVWGIMNAFIEIAEAQTTNLAVVAPGIAEALLATGLG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I YNKF  DS +     E FA+EF+ ILSRQ +
Sbjct: 183 LLAAIPAVIYYNKFSADSDQIVSGYEAFADEFATILSRQLD 223


>gi|170025181|ref|YP_001721686.1| colicin uptake protein TolQ [Yersinia pseudotuberculosis YPIII]
 gi|186894553|ref|YP_001871665.1| colicin uptake protein TolQ [Yersinia pseudotuberculosis PB1/+]
 gi|169751715|gb|ACA69233.1| protein TolQ [Yersinia pseudotuberculosis YPIII]
 gi|186697579|gb|ACC88208.1| protein TolQ [Yersinia pseudotuberculosis PB1/+]
          Length = 225

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAATRDAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + D   R M +++ RELE +
Sbjct: 61  RLYQESQARRDTLSGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ +AYN+  +   K     + F  EF AIL RQ   +
Sbjct: 181 AAIPAVMAYNRLNQHVNKLEQNYDNFMEEFIAILHRQAFAS 221


>gi|56460191|ref|YP_155472.1| TonB system biopolymer transport component [Idiomarina loihiensis
           L2TR]
 gi|56179201|gb|AAV81923.1| TonB system biopolymer transport component [Idiomarina loihiensis
           L2TR]
          Length = 236

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/223 (29%), Positives = 107/223 (47%), Gaps = 3/223 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++S   LFMQ  L VK ++ +L   S+  W +I Q+       R    +FE  FWSG  L
Sbjct: 4   ELSFIDLFMQASLLVKLVMVMLLAMSVWGWVLIFQRKKVLKQARNDALKFEDRFWSGVDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +        G+  +F +   E+ +  +    +   + +   R M VA ARE E+
Sbjct: 64  ARLYQEISARAKNARGMELLFHAGFKEYARLRNHSTTNTQTMLEGAFRAMRVAHARETEK 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L  L ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL
Sbjct: 124 LDNNLGILATIGSISPYIGLFGTVWGIMNAFIALGAVQQATLAMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +IP+ IAYN+F    +K   Q   F +EF +IL RQ+    
Sbjct: 184 FAAIPAVIAYNRFTTSVEKVDNQYMNFIDEFISILQRQSSAQA 226


>gi|157146638|ref|YP_001453957.1| colicin uptake protein TolQ [Citrobacter koseri ATCC BAA-895]
 gi|157083843|gb|ABV13521.1| hypothetical protein CKO_02404 [Citrobacter koseri ATCC BAA-895]
          Length = 227

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNIGL--AAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +       IF S   E+ +       +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDSLAGSEQIFYSGFKEFVRLHRANNHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|149185614|ref|ZP_01863930.1| TolQ, tolQ protein [Erythrobacter sp. SD-21]
 gi|148830834|gb|EDL49269.1| TolQ, tolQ protein [Erythrobacter sp. SD-21]
          Length = 232

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 65/233 (27%), Positives = 116/233 (49%), Gaps = 6/233 (2%)

Query: 1   MNNYGL----AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQF 56
           MN+  L    A   +    LF+   + V+ ++  L + SI  W++I+  S+    L+   
Sbjct: 1   MNHLSLIAVGAPTRLDPVQLFLDADIVVQAVMAGLILASIWVWAIIVSFSLRMNKLKSVQ 60

Query: 57  REFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRM 116
           R +E  FW     +       N  +I  A +  + ++EW++S     R    ++ RI   
Sbjct: 61  RNYETEFWQADQFDRFMAERGN-RDIPSARVAQAGVAEWRRSTKGEVRDREALRGRIATA 119

Query: 117 MDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-I 175
           MD  IA+E +++ E+L+FL ++ +    VG+ G V G+M  F  I    S+++  +   I
Sbjct: 120 MDSQIAQEADDVAERLNFLATVGAVAPFVGLFGTVWGIMNSFFQIGAQESSSLAVVAPGI 179

Query: 176 IESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            E+L +  +GL  +IP+ IAYN+F    ++F  ++  FA++  A  SRQ E  
Sbjct: 180 SEALFATAIGLFAAIPAVIAYNRFSHTVERFESRLHRFADKLHASFSRQLEQR 232


>gi|293603407|ref|ZP_06685834.1| TolQ colicin import protein [Achromobacter piechaudii ATCC 43553]
 gi|292818180|gb|EFF77234.1| TolQ colicin import protein [Achromobacter piechaudii ATCC 43553]
          Length = 226

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 113/219 (51%), Gaps = 4/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+ +L     + V+ I+ +L   SI+SW+ I  K +       Q R FE  FWSG  L
Sbjct: 6   DMSLLSLISHASVPVQLIMLMLLGISIMSWTYIFAKRLAIKRAHTQTRRFEDDFWSGGDL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGAR-SPIGIQDRIDRMMDVAIARELE 126
             + +++ +  +    LA IF + M+E+ K+    A      + D   R M  A  RE++
Sbjct: 66  SMLQQAVASRRDEQGALARIFDAGMTEFLKARRGNASGDATALLDGPRRAMRAAYQREMD 125

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   L+FL S  S    +G+LG V G+M  F  ++      +    PGI E+LI+  +G
Sbjct: 126 ALESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNMQQATLASVAPGIAEALIATAIG 185

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           L  +IP+ +AYN+F  D  + +++ + F +EF  IL RQ
Sbjct: 186 LFAAIPAVVAYNRFTNDIDRISIRFDSFVDEFLNILQRQ 224


>gi|146309076|ref|YP_001189541.1| MotA/TolQ/ExbB proton channel [Pseudomonas mendocina ymp]
 gi|145577277|gb|ABP86809.1| Cell division and transport-associated protein TolQ [Pseudomonas
           mendocina ymp]
          Length = 236

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 105/220 (47%), Gaps = 3/220 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
            ++++ L  +  L V+ ++  L + S++SW +I+Q+S       R+ + F Q F     L
Sbjct: 7   QMTVWGLVSEASLLVQAVMLSLVLASLVSWYLIVQRSAVLRRSEREAKAFLQRFRGSAEL 66

Query: 70  ETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +    +   + G+  +F +   E+ +   +   +   + + ++R + VAIA + E 
Sbjct: 67  AQLQRECAAEADQDAGVQQLFQAGYGEYLQLQREPGIAADAVIEGVERSLLVAIAEQEER 126

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + + L  L ++ S    VG+ G V G+M  F  ++      +    PGI E+LI+  +GL
Sbjct: 127 LEKGLPLLATVGSVSPYVGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGL 186

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ IAYN+F         +   FANE    L R+  
Sbjct: 187 FAAIPAVIAYNRFSARVAGLGARYYSFANELQGRLQRRLH 226


>gi|54294382|ref|YP_126797.1| hypothetical protein lpl1451 [Legionella pneumophila str. Lens]
 gi|54297487|ref|YP_123856.1| hypothetical protein lpp1532 [Legionella pneumophila str. Paris]
 gi|53751272|emb|CAH12683.1| hypothetical protein lpp1532 [Legionella pneumophila str. Paris]
 gi|53754214|emb|CAH15691.1| hypothetical protein lpl1451 [Legionella pneumophila str. Lens]
          Length = 224

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 117/220 (53%), Gaps = 7/220 (3%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           ++   FMQ GL VK ++ +L I SI+SW++I Q++  F   ++    F + FW    L  
Sbjct: 6   NVLMYFMQAGLVVKSVMLILLIASIISWTLIFQRAWFFNRRKQMTETFTRRFWDCGDLSK 65

Query: 72  VCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +   + ++ +    +AAIF +   E+ +   +G  S     + I R+M ++ A+E E++ 
Sbjct: 66  LYADVDSNSDERQGVAAIFHAGFKEFVRCRKQGKVS----IEPIQRVMQISHAKEAEKLE 121

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L F  S+ S    VG+ G V G+M  FQ++       + +  PGI E+L++  LGL  
Sbjct: 122 QHLPFFASVGSISPYVGLFGTVWGIMTSFQALGHAQQATIAMVAPGISEALVATALGLFT 181

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ IAYN++   +     + + F  E  +++ +QT G+
Sbjct: 182 AIPAVIAYNRYTTRANTLLNKYDLFQEELISLIEQQTSGS 221


>gi|51473504|ref|YP_067261.1| TolQ protein [Rickettsia typhi str. Wilmington]
 gi|13235454|emb|CAC33747.1| TolQ protein [Rickettsia typhi]
 gi|51459816|gb|AAU03779.1| TolQ protein [Rickettsia typhi str. Wilmington]
          Length = 241

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 73/219 (33%), Positives = 120/219 (54%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
            SI +L        K ++ +L I SI SWS+I+ K  +   ++R+ + FE +FWSG  LE
Sbjct: 19  FSILSLIGSSDFIGKSVMLMLLIASIWSWSIILHKIFSLAQVQRRIQSFENVFWSGCVLE 78

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKG--ARSPIGIQDRIDRMMDVAIARELEEI 128
            + +S+K   N  LA IF+SAM E      KG         ++RI   M +A  RE+E++
Sbjct: 79  QLYESIKKSVNNPLALIFVSAMDECNSLNTKGFSEALKNNHKERIMSAMYLAQNREIEKL 138

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L+ L ++ S+   VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL 
Sbjct: 139 EKYLNVLATVGSSAPFVGLFGTVWGIMHSFQSIALSKNTSLAVVAPGIAEALLATAIGLF 198

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           V+IP+ I YN  +        ++E F +E ++ILS+  +
Sbjct: 199 VAIPAVIFYNYLMSRITLINNKIEDFISELNSILSKAID 237


>gi|148359110|ref|YP_001250317.1| biopolymer transport protein TolQ [Legionella pneumophila str.
           Corby]
 gi|296107158|ref|YP_003618858.1| biopolymer transport protein TolQ [Legionella pneumophila 2300/99
           Alcoy]
 gi|148280883|gb|ABQ54971.1| biopolymer transport protein TolQ [Legionella pneumophila str.
           Corby]
 gi|295649059|gb|ADG24906.1| biopolymer transport protein TolQ [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610272|emb|CBW99836.1| hypothetical protein LPW_15971 [Legionella pneumophila 130b]
          Length = 225

 Score =  156 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 117/220 (53%), Gaps = 7/220 (3%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           ++   FMQ GL VK ++ +L I SI+SW++I Q++  F   ++    F + FW    L  
Sbjct: 7   NVLMYFMQAGLVVKSVMLILLIASIISWTLIFQRAWFFNRRKQMTETFTRRFWDCGDLSK 66

Query: 72  VCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +   + ++ +    +AAIF +   E+ +   +G  S     + I R+M ++ A+E E++ 
Sbjct: 67  LYADVDSNSDERQGVAAIFHAGFKEFVRCRKQGKVS----IEPIQRVMQISHAKEAEKLE 122

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L F  S+ S    VG+ G V G+M  FQ++       + +  PGI E+L++  LGL  
Sbjct: 123 QHLPFFASVGSISPYVGLFGTVWGIMTSFQALGHAQQATIAMVAPGISEALVATALGLFT 182

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ IAYN++   +     + + F  E  +++ +QT G+
Sbjct: 183 AIPAVIAYNRYTTRANTLLNKYDLFQEELISLIEQQTSGS 222


>gi|213028045|ref|ZP_03342492.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213051764|ref|ZP_03344642.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213425395|ref|ZP_03358145.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213649141|ref|ZP_03379194.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213857295|ref|ZP_03384266.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224582564|ref|YP_002636362.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238911678|ref|ZP_04655515.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289824365|ref|ZP_06543958.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|291084643|ref|ZP_06540569.2| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|224467091|gb|ACN44921.1| tolQ protein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|312911772|dbj|BAJ35746.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320085016|emb|CBY94805.1| Protein tolQ [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226324|gb|EFX51375.1| MotA/TolQ/ExbB proton channel family protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322615821|gb|EFY12739.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322621380|gb|EFY18236.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322628910|gb|EFY25690.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322634889|gb|EFY31619.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322636583|gb|EFY33287.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322641767|gb|EFY38401.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647824|gb|EFY44304.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322651846|gb|EFY48215.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652657|gb|EFY49006.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322658464|gb|EFY54727.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664933|gb|EFY61124.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322668398|gb|EFY64554.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322675254|gb|EFY71330.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679680|gb|EFY75721.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684844|gb|EFY80843.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323193162|gb|EFZ78381.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200613|gb|EFZ85688.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202284|gb|EFZ87332.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323205448|gb|EFZ90414.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323213512|gb|EFZ98305.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323215347|gb|EGA00092.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221779|gb|EGA06186.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323228091|gb|EGA12227.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323234165|gb|EGA18254.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238140|gb|EGA22198.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323243575|gb|EGA27593.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323247400|gb|EGA31359.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251389|gb|EGA35261.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323258473|gb|EGA42145.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323270962|gb|EGA54397.1| colicin uptake protein TolQ [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 227

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 66/218 (30%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L 
Sbjct: 1   MNILDLFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +
Sbjct: 61  RLYQESQGRRDSLSGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNRELETL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 AAIPAVMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 218


>gi|289207748|ref|YP_003459814.1| protein TolQ [Thioalkalivibrio sp. K90mix]
 gi|288943379|gb|ADC71078.1| protein TolQ [Thioalkalivibrio sp. K90mix]
          Length = 230

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 74/225 (32%), Positives = 123/225 (54%), Gaps = 6/225 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            +D S++ L M+  L V+ ++ +L + S+LSW  II K+ +     R   +FE+ FWSG 
Sbjct: 2   AVDFSMYQLVMEATLVVQLVMVILVLASVLSWLAIIVKARSLNAAHRACDDFEERFWSGA 61

Query: 68  SLETVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            L  + + ++      G+  +F S   E+ ++   G    I   +   R M VAIARE++
Sbjct: 62  DLSHLYEGVRRKQEMTGMEHVFSSGFKEFLRARQHG----IPAGEPAQRAMRVAIAREID 117

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
           E+   L FL ++ S    +G+ G V G+M  F  ++G     + +  PGI E+LI+  LG
Sbjct: 118 EMERYLQFLATVGSTSPYIGLFGTVWGIMHAFLGLSGVQQATLAMVAPGIAEALIATALG 177

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L  +IP+ IAYN+F  D  + A+++E F +EF A+L+RQ     +
Sbjct: 178 LFAAIPAVIAYNRFAGDVDRVAVRLENFNDEFVALLNRQVHAKST 222


>gi|317402477|gb|EFV83045.1| TolQ colicin import protein [Achromobacter xylosoxidans C54]
          Length = 226

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/222 (31%), Positives = 114/222 (51%), Gaps = 4/222 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+S+ +L     + V+ I+ +L   SI+SW+ I  K +       Q R FE  FWSG
Sbjct: 3   ATNDMSLLSLISHASVPVQLIMLMLLGISIMSWTYIFAKRLAIKRAHAQTRRFEDDFWSG 62

Query: 67  QSLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGA-RSPIGIQDRIDRMMDVAIAR 123
             L  + +++ +  +    LA IF + M+E+ K+    A      + D   R M  A  R
Sbjct: 63  GDLSMLQQAVASRRDEQGALARIFDAGMTEFLKARRGNASNDATAVLDGPRRAMRAAYQR 122

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++ +   L+FL S  S    +G+LG V G+M  F  ++      +    PGI E+LI+ 
Sbjct: 123 EMDALESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNMQQATLASVAPGIAEALIAT 182

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +GL  +IP+ +AYN+F  D  + +++ + F +EF  IL RQ
Sbjct: 183 AIGLFAAIPAVVAYNRFTNDIDRISIRFDSFVDEFLNILQRQ 224


>gi|328953810|ref|YP_004371144.1| protein TolQ [Desulfobacca acetoxidans DSM 11109]
 gi|328454134|gb|AEB09963.1| protein TolQ [Desulfobacca acetoxidans DSM 11109]
          Length = 263

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 55/231 (23%), Positives = 105/231 (45%), Gaps = 14/231 (6%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+ +  L +  G  VK ++ +L +FS+  W +I  K       ++Q  EF  LFW  +
Sbjct: 23  VSDLDVVPLILNAGPVVKGVMFILLVFSVACWGIIFAKVFQLSRAKKQTAEFLDLFWGAR 82

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQ-------------DRID 114
           +L T     ++     +AAIF     E  K       +  G +             + ++
Sbjct: 83  NLSTAYHETRHLQASPVAAIFRLGYIELGKLMQTQVSTDSGDRDVLGTIAVRGAGVENVN 142

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG 174
           R +  A+  E   ++  ++FL +  +    +G+ G V G+M  F+ I    S ++  +  
Sbjct: 143 RSLRRAMNTETTRLSRAITFLATTGNTAPFIGLFGTVWGIMTSFRGIGLKGSASLAVVAP 202

Query: 175 -IIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            I E+L++  +GL  +IP+ +AYN F+   +    +M  F ++F  I+ R 
Sbjct: 203 GISEALVATAVGLAAAIPAVVAYNYFLSKVRVLETEMASFISDFLNIIERD 253


>gi|298290782|ref|YP_003692721.1| tonB-system energizer ExbB [Starkeya novella DSM 506]
 gi|296927293|gb|ADH88102.1| tonB-system energizer ExbB [Starkeya novella DSM 506]
          Length = 357

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 53/224 (23%), Positives = 97/224 (43%), Gaps = 7/224 (3%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L   S+++W+V + KSV     + + R   + +    
Sbjct: 120 PHDLSPWGMFMAADWVVKAVMIGLAFASVVTWTVWLAKSVELTFAKGRLRRALKGYLGAA 179

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SLE               A+  +   E K+S   G     GI++R+   +          
Sbjct: 180 SLEEARD---VGPAGPAGAMLRTTFLEVKRS---GDLPADGIKERVSISLSRIEVAAGRA 233

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISILLGL 186
           IT     L ++ +    VG+ G V G+M  F  I+   + N+  + PGI E+L++  +GL
Sbjct: 234 ITRGTGLLATIGATAPFVGLFGTVWGIMNSFIGISKAQTTNLAVVAPGIAEALLATAIGL 293

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      + + +   + E   +LSR  +   +
Sbjct: 294 VAAIPAVVIYNHFSRQVSGYRLLLGDASAEVLRLLSRDLDRRDA 337


>gi|113868788|ref|YP_727277.1| biopolymer transport protein [Ralstonia eutropha H16]
 gi|113527564|emb|CAJ93909.1| biopolymer transport protein [Ralstonia eutropha H16]
          Length = 227

 Score =  156 bits (393), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 71/228 (31%), Positives = 116/228 (50%), Gaps = 5/228 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI  L +   L  + ++ LL + S+ SW+ I +K +   + R Q   FE
Sbjct: 1   MNPVTV-TQDMSIVTLVLHASLLAQAVMALLLVMSLFSWTYIFRKHLALRSARTQTEGFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           + FW+G  L+ +  S     H+   L  IF S M E+ K+ ++G      + D   R M 
Sbjct: 60  RDFWAGGDLQALYNSAVNNRHNTGALERIFESGMGEFLKARERGNE-AGALLDAARRAMR 118

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E
Sbjct: 119 AAYQREMDVLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLASVAPGIAE 178

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +L++  +GL  +IP+ IAYN++  +  + A++ E F  EF  IL RQ 
Sbjct: 179 ALVATAIGLFAAIPAVIAYNRYATEIDRLAIRFESFMEEFLNILQRQA 226


>gi|224823452|ref|ZP_03696561.1| protein TolQ [Lutiella nitroferrum 2002]
 gi|224603907|gb|EEG10081.1| protein TolQ [Lutiella nitroferrum 2002]
          Length = 216

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 65/212 (30%), Positives = 103/212 (48%), Gaps = 2/212 (0%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
            +L +   L V+ ++  L + S+LSW++II K     + RR    FEQ FW G  L  + 
Sbjct: 1   MSLILNASLVVQLVMLGLALLSVLSWTLIISKLGTLRSARRHSESFEQNFWGGTDLNRLY 60

Query: 74  KSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKL 132
           +  +   +   +  IF S  +E+ K   +       I D   R M  A  REL+ +    
Sbjct: 61  EDARQQGDTVGMERIFQSGFAEFLKQRGRSGAELSDIMDGARRAMRAAAQRELDRLDSHT 120

Query: 133 SFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVSIP 191
           SFL ++ S    +G+ G V G+M  F  +       +    PGI E+L++  +GL  +IP
Sbjct: 121 SFLATVGSVSPYIGLFGTVWGIMHAFIGLGNAGQATLSTVAPGIAEALVATAIGLFAAIP 180

Query: 192 SSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           + +AYN+F  D  + A + + F  EFS IL R
Sbjct: 181 AVVAYNRFAADVDRLASRFDTFMEEFSNILQR 212


>gi|311103964|ref|YP_003976817.1| protein TolQ [Achromobacter xylosoxidans A8]
 gi|310758653|gb|ADP14102.1| protein TolQ [Achromobacter xylosoxidans A8]
          Length = 226

 Score =  155 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 113/219 (51%), Gaps = 4/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+ +L     + V+ I+ +L   SI+SW+ I  K +       Q R FE  FWSG  L
Sbjct: 6   DMSLLSLISHASVPVQLIMLMLLGISIMSWTYIFAKRLAIKRAHAQTRRFEDDFWSGGDL 65

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGAR-SPIGIQDRIDRMMDVAIARELE 126
             + +++ +  +    LA IF + M+E+ K+    A      + D   R M  A  RE++
Sbjct: 66  SMLQQAVASRRDEQGALARIFDAGMTEFLKARRGNAAGDATAVLDGPRRAMRAAYQREMD 125

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   L+FL S  S    +G+LG V G+M  F  ++      +    PGI E+LI+  +G
Sbjct: 126 SLESHLNFLASAGSVSPYIGLLGTVWGIMHAFIGLSNMQQATLASVAPGIAEALIATAIG 185

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           L  +IP+ +AYN+F  D  + +++ + F +EF  IL RQ
Sbjct: 186 LFAAIPAVVAYNRFTNDIDRISIRFDSFVDEFLNILQRQ 224


>gi|221134417|ref|ZP_03560722.1| tolQ protein [Glaciecola sp. HTCC2999]
          Length = 222

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 72/220 (32%), Positives = 118/220 (53%), Gaps = 3/220 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   LF+Q  L VK ++ LL   SI+SW+ I+Q+S    + + +  +FE+ FWSG 
Sbjct: 2   SHDMSFIGLFLQASLVVKLVMILLMGASIVSWAFIVQRSRALNSAKNELFQFEEQFWSGT 61

Query: 68  SLETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            L  + + L +   I  + +IF++   E+ +   K       + +   R M VA++RE++
Sbjct: 62  DLNKLFQDLSSRSQITGVHSIFVAGFREFVRLR-KSEAQGDVVVEGSSRAMRVALSREVD 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
           E+  KL FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +G
Sbjct: 121 ELESKLPFLATVGSISPYIGLFGTVWGIMNAFIALGQVQQATLAMVAPGIAEALIATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ IAYN+F    +K       F  EF+AIL RQ 
Sbjct: 181 LFAAIPAVIAYNRFSNQVEKIENGYINFMEEFAAILQRQA 220


>gi|261343495|ref|ZP_05971140.1| protein TolQ [Providencia rustigianii DSM 4541]
 gi|282568641|gb|EFB74176.1| protein TolQ [Providencia rustigianii DSM 4541]
          Length = 227

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L V+ I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVQIIMFVLLGFSIASWAIIIQRTKILNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  +   +   G   IF S   E+ +       +P  +     R M +++ REL
Sbjct: 61  ELSRLYKESQARRDALGGTEQIFYSGFKEFVRLHQANIHAPDAVITGAARAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESVESHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +A+N+      K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAFNRLNLRVNKLEQSYDNFMEEFLAILHRQA 221


>gi|194290410|ref|YP_002006317.1| membrane spanning protein in tola-tolq-tolr complex; proton channel
           component [Cupriavidus taiwanensis LMG 19424]
 gi|193224245|emb|CAQ70254.1| membrane spanning protein in TolA-TolQ-TolR complex; putative
           proton channel component [Cupriavidus taiwanensis LMG
           19424]
          Length = 227

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 71/228 (31%), Positives = 117/228 (51%), Gaps = 5/228 (2%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MN   +   D+SI  L +   +  + ++ LL + S+ SW+ I +K +   + R Q   FE
Sbjct: 1   MNPVTV-TQDMSIVTLVLHASVLAQAVMALLLVMSLFSWTYIFRKHLAVRSARTQTEGFE 59

Query: 61  QLFWSGQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           + FW+G  L+ +  S     H+   L  IF S M E+ K+ ++G      + D   R M 
Sbjct: 60  RDFWAGGDLQALYNSAVNNRHNTGALERIFESGMGEFLKARERGNE-AGALLDAARRAMR 118

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A  RE++ +   L FL S+ S    +G+ G V G+M  F+ ++      +    PGI E
Sbjct: 119 AAYQREMDVLESHLPFLASVGSVSPYIGLFGTVWGIMNAFRGLSNVQQATLASVAPGIAE 178

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +L++  +GL  +IP+ IAYN++  +  + A++ E F  EF  IL RQT
Sbjct: 179 ALVATAIGLFAAIPAVIAYNRYATEIDRLAIRFESFMEEFLNILQRQT 226


>gi|148555051|ref|YP_001262633.1| Tol-Pal system, TolQ [Sphingomonas wittichii RW1]
 gi|148500241|gb|ABQ68495.1| Tol-Pal system, TolQ [Sphingomonas wittichii RW1]
          Length = 232

 Score =  155 bits (392), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 60/218 (27%), Positives = 110/218 (50%), Gaps = 3/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S  ALF+Q  + VK ++  L + S+ +W++I+  S+      R  + FE  FW  + ++
Sbjct: 14  LSPIALFLQADIVVKAVMIGLLLASVWTWTIIVSGSMALTRAFRASKGFETDFWKSEDID 73

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGA-RSPIGIQDRIDRMMDVAIARELEEIT 129
              +      +I  A +F + ++EW++S   G      G + R+   M  A   E++ ++
Sbjct: 74  KFYEG-PGRQDIPAAKVFSAGVAEWRRSVRNGQPVDRDGTRARLSNAMAAAAGAEIDRLS 132

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
           ++L+ L ++ S    VG+ G V G+M  F  IA   + ++  +   I E+L +  LGL  
Sbjct: 133 DRLNILATVGSVAPFVGLFGTVWGIMRSFTDIAASQNTSLGVVAPGIAEALFATALGLFA 192

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ IAYN+ +    K   Q+  F +     LSR+ E
Sbjct: 193 AIPAVIAYNRLLHRVSKIEGQLHRFGDAIHMTLSRELE 230


>gi|332525522|ref|ZP_08401679.1| transmembrane protein/ biopolymer transport [Rubrivivax
           benzoatilyticus JA2]
 gi|332109089|gb|EGJ10012.1| transmembrane protein/ biopolymer transport [Rubrivivax
           benzoatilyticus JA2]
          Length = 227

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 76/221 (34%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SI +L +Q    V+ ++  L + S+ SW+VI  K     T+R +   FE+ FWSG+S
Sbjct: 3   QDLSIVSLVLQASAVVQLVMAGLALVSLASWTVIFGKLFGLRTVRSRNEAFEREFWSGRS 62

Query: 69  LETVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           L  + ++  N  +   +  IF S M E+ K  ++         D   R M  +  REL+ 
Sbjct: 63  LTELNQAASNKADAAPIERIFASGMREFLKLRERRL-DAGAQLDGARRAMRASFQRELDA 121

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           I   LSFL S+ S    VG+ G V G+M  F  ++      +    PGI E+L++  +GL
Sbjct: 122 IESHLSFLASVGSVSPYVGLFGTVWGIMHAFVGLSNLQQVTLATVAPGIAEALVATAIGL 181

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
             +IP+ IAYN+F  D  + A+Q E F  EFS IL R   G
Sbjct: 182 FAAIPAVIAYNRFARDIDRIAIQFETFIEEFSNILQRNASG 222


>gi|331000271|ref|ZP_08323955.1| protein TolQ [Parasutterella excrementihominis YIT 11859]
 gi|329572437|gb|EGG54090.1| protein TolQ [Parasutterella excrementihominis YIT 11859]
          Length = 227

 Score =  155 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 68/225 (30%), Positives = 109/225 (48%), Gaps = 6/225 (2%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+SI  L       V+ ++ +L IFS++SW++I QK       RR+ R F++ FW G
Sbjct: 3   ASADLSIITLVAHASAVVQIVLAILLIFSLVSWTIIFQKWFQMSRARREARNFDKRFWGG 62

Query: 67  QSLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPI---GIQDRIDRMMDVAI 121
             L  + +S     +       IF S M+E+ +S      +     G+ D + R M    
Sbjct: 63  ADLNKLYESATERRSSIGPQEGIFYSGMTEFLRSRASNLEARAGTFGVIDGVSRAMRARY 122

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
            REL+ +   LS L ++ S    +G+ G V G+M  F  +    S ++  +   I E+L+
Sbjct: 123 QRELDILESGLSVLATIGSVSPYIGLFGTVWGIMDAFTGLGNLESASLAVVAPGIAEALV 182

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +  +GL  +IP+ I YN+F     + + Q E F  EF  IL RQ 
Sbjct: 183 ATAIGLFAAIPAVIGYNRFAYSLDRLSSQYESFMQEFQNILGRQA 227


>gi|163869134|ref|YP_001610373.1| tolQ protein [Bartonella tribocorum CIP 105476]
 gi|161018820|emb|CAK02378.1| tolQ protein [Bartonella tribocorum CIP 105476]
          Length = 237

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 87/218 (39%), Positives = 140/218 (64%), Gaps = 1/218 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + +  LFMQ  L VK ++ LL + S+ SW++I  K   +  +RR+ ++FE+ FWSG++LE
Sbjct: 12  MGMLHLFMQASLVVKVVMVLLLLASVWSWAIIFDKIFTYRRIRREIKQFERTFWSGKALE 71

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +  S K+     ++A+FM+AM EWKKS +KG  +   +Q RID+ MD+ + RE E+I  
Sbjct: 72  DLYASCKSQRTNSISAVFMAAMVEWKKSLEKGTHTSTSLQSRIDKAMDLTLGRESEKIES 131

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           KLSFL ++ SAG  +G+ G V+G+M  F SI+   + ++  +   I E+L++  +GL  +
Sbjct: 132 KLSFLATLGSAGPFIGLFGTVIGIMESFLSISASQNTSLAIVAPGIAEALLATAIGLFAA 191

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           IP+ IAYNK   +S +   Q+E FA+EFS I+SR+ + 
Sbjct: 192 IPAVIAYNKLTHESARIIAQIENFADEFSTIVSRRIDE 229


>gi|325923400|ref|ZP_08185065.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Xanthomonas gardneri ATCC 19865]
 gi|325546115|gb|EGD17304.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Xanthomonas gardneri ATCC 19865]
          Length = 259

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVELILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F S   E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFESGFREFSRLRDRRRLDGRVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQAGAD 258


>gi|167470907|ref|ZP_02335611.1| protein TolQ [Yersinia pestis FV-1]
          Length = 225

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/221 (30%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    F+  FWSG  L 
Sbjct: 1   MNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRILNAATRDAEAFKDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + D   R M +++ RELE +
Sbjct: 61  RLYQESQARRDTLSGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +GL 
Sbjct: 121 ETHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ +AYN+  +   K     + F  EF AIL RQ   +
Sbjct: 181 AAIPAVMAYNRLNQHVNKLEQNYDNFMEEFIAILHRQAFAS 221


>gi|88705608|ref|ZP_01103318.1| MotA/TolQ/ExbB proton channel [Congregibacter litoralis KT71]
 gi|88700121|gb|EAQ97230.1| MotA/TolQ/ExbB proton channel [Congregibacter litoralis KT71]
          Length = 230

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 106/218 (48%), Gaps = 6/218 (2%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
             L M  G+ VK ++ LL   S+ SW +I Q+   F +   +  +FE+ FWSG  L  + 
Sbjct: 1   MDLVMDAGVTVKLVMALLMAASVTSWYMIFQRFFYFRSAGEEMLDFEEHFWSGVDLAQLY 60

Query: 74  KSLKNHHNIG-----LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           +        G     +  +F +   E+ +   +       + +   R M VA+ RE E +
Sbjct: 61  REGNERAADGEIIIGVEGVFRAGFKEFSRLAQQSDMDAEAMLEGARRAMRVAMLREEERL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+L++  +GL 
Sbjct: 121 EKHLPFLATVGSTSPYVGLFGTVWGIMNSFRGLANTSQATLATVAPGISEALVATAMGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ +AYN+F      +  + + F +EFS+IL RQ 
Sbjct: 181 AAIPAVMAYNRFASKVDVYGKRYDTFVDEFSSILGRQA 218


>gi|329888412|ref|ZP_08267010.1| protein TolQ [Brevundimonas diminuta ATCC 11568]
 gi|328846968|gb|EGF96530.1| protein TolQ [Brevundimonas diminuta ATCC 11568]
          Length = 262

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/219 (31%), Positives = 116/219 (52%), Gaps = 4/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++   LFM     VK ++  L   S+ SW++II K+V F  +  +  EFE+   SG+SLE
Sbjct: 10  LNPIELFMTADWVVKTVMIGLAAASVWSWTIIIDKAVRFSRMNARATEFEKQVESGRSLE 69

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIG---IQDRIDRMMDVAIARELEE 127
            V           L  + +  + +W+++  +GA +      +  RIDR +D  IARE ++
Sbjct: 70  EVAAQAGPQPVDPLPRMLVLTLQDWREARARGAMTDTQGNMLIARIDRALDSVIARESQK 129

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           I   L  L  +++A   +G+ G V G+M  F SIA   + N+    P I E+L +  +GL
Sbjct: 130 IENGLGVLSVVATASPFIGLFGTVWGIMNAFDSIAAAGNTNLTTVAPAIAEALFATAIGL 189

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IA+N F   + KF  ++E FA++  + ++R+ 
Sbjct: 190 AAAIPAYIAFNAFSVSAGKFTGRLEAFADDLQSAIARRL 228


>gi|254469020|ref|ZP_05082426.1| protein TolQ [beta proteobacterium KB13]
 gi|207087830|gb|EDZ65113.1| protein TolQ [beta proteobacterium KB13]
          Length = 223

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 64/219 (29%), Positives = 104/219 (47%), Gaps = 4/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S  +L M   + V+ ++ +L   S+ SW  I  K            EFE+ FW+G   
Sbjct: 6   DLSFLSLVMGASIPVQLVMLILIAASVFSWKYIFIKIKTIKNAEEHATEFEKYFWAGAQF 65

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           + + +S  +  N    L +IF +   E+  S           ++ I R M VA  REL+ 
Sbjct: 66  KQLYESASHSSNNVGGLKSIFFAGYKEFIASTKDQKLDKQS-KESIRRAMQVAYNRELDS 124

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL S+ S    +G+ G V G+M  F  ++    + +    PGI E+LI+  +GL
Sbjct: 125 LERHLPFLASVGSVSPYIGLFGTVWGIMNSFIGLSNVAQSTLAQVAPGIAEALIATAIGL 184

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ IAYN+F     + A++ E F  EF   + R+ 
Sbjct: 185 FAAIPAVIAYNRFAAKVDRLAIRYESFMEEFINNVDRRA 223


>gi|217977011|ref|YP_002361158.1| tonB-system energizer ExbB [Methylocella silvestris BL2]
 gi|217502387|gb|ACK49796.1| tonB-system energizer ExbB [Methylocella silvestris BL2]
          Length = 348

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 97/220 (44%), Gaps = 5/220 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +F+     VK ++  L   S+++W++ + KS++    R   R   +     +
Sbjct: 112 PADLSPWGMFLHADRIVKGVMIGLAFASLVTWTIWLVKSLDLWRARASARRDLEAVTEAE 171

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L     + K      +A    +A SE  +S         G+++RI  ++    +    +
Sbjct: 172 DLRAAQTTFK-DQRSPVARFVEAARSEEDRSR---GLPAEGVKERIAALLVRLESHAGRK 227

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +    S + ++ +    VG+ G V G+M  F  I+  ++ N+  +   I E+L++  +GL
Sbjct: 228 MARGTSVVATIGATAPFVGLFGTVWGIMDSFIGISKSHTTNLAVVAPGIAEALLATAMGL 287

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      +  Q+   A E    +SR  +
Sbjct: 288 IAAIPAVMIYNVFARGITGYKAQLGDAAAEVLRHVSRDLD 327


>gi|268590339|ref|ZP_06124560.1| protein TolQ [Providencia rettgeri DSM 1131]
 gi|291314248|gb|EFE54701.1| protein TolQ [Providencia rettgeri DSM 1131]
          Length = 227

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L V+ I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNILDLFLKASLLVQLIMFVLIGFSIASWAIIIQRTKILNAATREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  +   +   G   IF S   E+ +       +P  +     R M +++ REL
Sbjct: 61  ELSRLYKESQARRDELSGAEQIFHSGFKEFVRLHQANIHAPDAVVTGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESVEAHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +A+N+      K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAFNRLNLRVSKLEQNYDNFMEEFLAILHRQA 221


>gi|21243871|ref|NP_643453.1| TolQ protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|294626859|ref|ZP_06705451.1| TolQ protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294665408|ref|ZP_06730696.1| TolQ protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|21109472|gb|AAM37989.1| TolQ protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|292598873|gb|EFF43018.1| TolQ protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292604819|gb|EFF48182.1| TolQ protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 259

 Score =  155 bits (391), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F S   E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFESGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQAGAD 258


>gi|289661904|ref|ZP_06483485.1| TolQ protein [Xanthomonas campestris pv. vasculorum NCPPB702]
 gi|289666995|ref|ZP_06488070.1| TolQ protein [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 259

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F S   E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFESGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQVGAD 258


>gi|58581288|ref|YP_200304.1| hypothetical protein XOO1665 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84623206|ref|YP_450578.1| TolQ protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|58425882|gb|AAW74919.1| TolQ protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84367146|dbj|BAE68304.1| TolQ protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 259

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 66/222 (29%), Positives = 109/222 (49%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +     L ++F     E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRSVGGLESMFEGGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQVGAD 258


>gi|67458896|ref|YP_246520.1| TolQ protein [Rickettsia felis URRWXCal2]
 gi|67004429|gb|AAY61355.1| TolQ protein [Rickettsia felis URRWXCal2]
          Length = 242

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K      ++R+ + FE +FWSG  LE + +S+K   N  
Sbjct: 33  GKSVMLMLLIASIWSWAIILDKIFKLAQVQRRMKNFENVFWSGGVLEQLYESIKRSVNNP 92

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI   M +A  RE+E++ + LSFL ++ S+
Sbjct: 93  LALIFVSAMDECKSLNTKGLSDALKNNHKERITGAMYLAQNREVEKLEKNLSFLATVGSS 152

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 153 APFVGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 212

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F++E ++ILS+  +
Sbjct: 213 SRITLINNKIEDFSSELNSILSKAID 238


>gi|325917787|ref|ZP_08179971.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325536003|gb|EGD07815.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 259

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F S   E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFESGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQAGAD 258


>gi|71279709|ref|YP_268466.1| tolQ protein [Colwellia psychrerythraea 34H]
 gi|71145449|gb|AAZ25922.1| tolQ protein [Colwellia psychrerythraea 34H]
          Length = 228

 Score =  154 bits (390), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 67/223 (30%), Positives = 116/223 (52%), Gaps = 2/223 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +ISIF LF++  + V+ ++ +L  FSI+ W++I Q+     T   + + FE  FWSG  L
Sbjct: 4   EISIFHLFLEASILVQFVMLVLLTFSIVCWAMIFQRRKILRTAAAELKAFEDKFWSGADL 63

Query: 70  ETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             +         I  + ++F++   E+ +       +P  I D   R M VA++RE++ +
Sbjct: 64  SKLYSETSAKSQIQGIESLFIAGFKEFARLRKSHIDNPQIIVDGTHRAMRVALSREVDSL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              L F+ ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL 
Sbjct: 124 ETHLPFMATVGSISPYIGLFGTVWGIMNSFIALGAVKQATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ IA+N+F    +K       F +EFS+IL RQ+    S
Sbjct: 184 AAIPAVIAFNRFSHKVEKLENSYGNFMDEFSSILQRQSAAEQS 226


>gi|114771189|ref|ZP_01448609.1| Biopolymer transport protein, TolQ [alpha proteobacterium HTCC2255]
 gi|114548114|gb|EAU51001.1| Biopolymer transport protein, TolQ [alpha proteobacterium HTCC2255]
          Length = 230

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 84/219 (38%), Positives = 128/219 (58%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S+ AL+++    VK ++ +L   SI SWS+IIQK +N+   R+    F++ FWSG  
Sbjct: 12  IDFSVLALYLRATFTVKIVMLMLIFSSIWSWSIIIQKFINYRKARKNAHLFDKAFWSGAP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + + +        IF++AMSEW++S  +G     G Q RIDR MDVAIARE E +
Sbjct: 72  LDQLYERVGSDPTGASEKIFVAAMSEWERS-HRGEDLIGGAQQRIDRSMDVAIARESEIL 130

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L+FL ++ S    +G+ G V G+   F+ IA   + N+  +   I E+L++  LGL 
Sbjct: 131 NNGLTFLATVGSTAPFIGLFGTVWGIKNAFEEIAIQQNTNLAVVAPGIAEALVATALGLL 190

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   D+ +     E FA+EFS ILSRQ +
Sbjct: 191 AAIPAVIFYNKLSADADRLVGGYESFADEFSTILSRQLD 229


>gi|56476925|ref|YP_158514.1| TOLQ-related transport transmembrane protein [Aromatoleum
           aromaticum EbN1]
 gi|56312968|emb|CAI07613.1| TOLQ-related transport transmembrane protein [Aromatoleum
           aromaticum EbN1]
          Length = 224

 Score =  154 bits (390), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 72/219 (32%), Positives = 113/219 (51%), Gaps = 4/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI +L  Q  + V+ ++TLL   S++SW  I +KS    + R +   FE+ FWSG  L
Sbjct: 6   NLSIISLVSQASVLVQLVMTLLATLSLVSWYWIFRKSFQIRSARNKTNGFERDFWSGGDL 65

Query: 70  ETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +S     H   G+  IF S   E+ K   K         D   R M     RE+++
Sbjct: 66  NGLFQSAAAARHQTGGMERIFESGYREFTKLRAKS-HDHAATIDGARRAMRATYQREMDD 124

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L+FL S+ S    +G+LG V G+M  F+ ++   S  +    PGI E+L++  +GL
Sbjct: 125 LEAHLAFLASVGSVSPYIGLLGTVWGIMNAFRGLSNVSSATLAQVAPGIAEALVATAIGL 184

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN+F  D  +  ++ E F  EFS IL RQ 
Sbjct: 185 FAAIPAVVAYNRFAHDIDRVGIRFESFMEEFSNILQRQL 223


>gi|116748198|ref|YP_844885.1| MotA/TolQ/ExbB proton channel [Syntrophobacter fumaroxidans MPOB]
 gi|116697262|gb|ABK16450.1| MotA/TolQ/ExbB proton channel [Syntrophobacter fumaroxidans MPOB]
          Length = 268

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 55/222 (24%), Positives = 95/222 (42%), Gaps = 9/222 (4%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
            F +    G  VK I+  L + SI  W +I+ K+      +++   F   F   ++  T+
Sbjct: 27  FFDMVRNAGPMVKFIMVSLVVLSIACWCIILLKARLVRRAQKESELFVNYFRQRKNYSTL 86

Query: 73  CKSLKNHHNIGLAAIFMSAMSEWKKS--------CDKGARSPIGIQDRIDRMMDVAIARE 124
            +  +      LA IF    +E  +           + + +P  + + +DR +   I  E
Sbjct: 87  YRESEPLDESHLAQIFRIGYAELNRLGKSLETKNLQELSTNPEVVLENVDRAIRGGIMAE 146

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
            +     L  L +  S    +G+ G V G+M  F  I    S N+  +   I E+L++  
Sbjct: 147 RQRFESFLPLLATTGSTAPFIGLFGTVWGIMTSFHEIGLKGSANLAVVAPGISEALVATA 206

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +GL  +IP+ +AYN F    K   ++M  FA +F  IL R  
Sbjct: 207 MGLAAAIPAVVAYNHFANRIKMIEIEMSHFAADFLNILKRDL 248


>gi|238756019|ref|ZP_04617343.1| hypothetical protein yruck0001_31500 [Yersinia ruckeri ATCC 29473]
 gi|238705744|gb|EEP98137.1| hypothetical protein yruck0001_31500 [Yersinia ruckeri ATCC 29473]
          Length = 225

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 69/221 (31%), Positives = 109/221 (49%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I  LF+Q  L VK I+ +L  FSI SW++IIQ++       R    FE  FWSG  L 
Sbjct: 1   MNILDLFLQASLFVKLIMLVLMGFSIASWAIIIQRTRVLNAATRDAEAFEDKFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +  +   +   G   IF S   E+ +     + +P  + D   R M +++ RELE +
Sbjct: 61  RLYQESQARRDTLGGSEQIFHSGFKEFARLHRANSHAPEAVIDGASRAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F S+       +  +   I E+LI+  +GL 
Sbjct: 121 ENHIPFLGTVGSISPYIGLFGTVWGIMHAFISLGAVKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ +AYN+      K     + F  EF AIL RQ   +
Sbjct: 181 AAIPAVMAYNRLNLHVSKLEQNYDNFMEEFIAILHRQAFAS 221


>gi|166712986|ref|ZP_02244193.1| TolQ [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 259

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 110/222 (49%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F     E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFEGGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQAGAD 258


>gi|291612987|ref|YP_003523144.1| protein TolQ [Sideroxydans lithotrophicus ES-1]
 gi|291583099|gb|ADE10757.1| protein TolQ [Sideroxydans lithotrophicus ES-1]
          Length = 225

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 65/221 (29%), Positives = 106/221 (47%), Gaps = 4/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           I D+S   L     L V+ ++ LL + S++SW  I  K     +  +Q REFE  FW   
Sbjct: 4   IQDLSFMHLVTNASLLVQLVMGLLLLVSLMSWWYIFLKMFAVRSAVKQAREFEDAFWGNP 63

Query: 68  SLETVCKSLKNHHNIG---LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
           +L  + +   +        L  IF +  +E+ K           + D   R M     RE
Sbjct: 64  NLNALYQQANSQARTDVGALERIFAAGFAEFVKLKKTHGVDGAAVMDGTRRAMRAKYQRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           ++ +   LSFL ++ S    VG+LG V G+M  F+ ++      +    PGI E+L++  
Sbjct: 124 MDHLESHLSFLATVGSVSPYVGLLGTVWGIMNAFRGLSNVGQATLAQVAPGIAEALVATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           +GL  +IP+ +AYN++  D  + + + E F  EFS +L RQ
Sbjct: 184 MGLFAAIPAVVAYNRYAHDITRLSSRFESFIEEFSNVLQRQ 224


>gi|188577431|ref|YP_001914360.1| protein TolQ [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188521883|gb|ACD59828.1| protein TolQ [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 259

 Score =  154 bits (389), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 67/222 (30%), Positives = 110/222 (49%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F     E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFEGGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQVGAD 258


>gi|330814397|ref|YP_004358636.1| motA/TolQ/ExbB proton channel family protein [Candidatus
           Pelagibacter sp. IMCC9063]
 gi|327487492|gb|AEA81897.1| motA/TolQ/ExbB proton channel family protein [Candidatus
           Pelagibacter sp. IMCC9063]
          Length = 222

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 72/218 (33%), Positives = 115/218 (52%), Gaps = 6/218 (2%)

Query: 5   GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFW 64
            L   D SI  LFM+  L VK ++  L + SI SW++II K   F  + ++    E  FW
Sbjct: 10  SLGTTDFSILTLFMRADLVVKFVMISLVLASIFSWALIIDKIKIFKKIFKETDIAEDQFW 69

Query: 65  SGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
           S +S     K   +  +  L  +F + M        +  +S   I +R  R+MDVAI ++
Sbjct: 70  SSKSAGEFYKKTSSSSDNPLVVVFRAGMEC-----VQDHKSKGQIVERTKRVMDVAIDKQ 124

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
           +E+  + L+FL ++ S    VG+ G V G+M  FQSIA   + ++  +   I E+L +  
Sbjct: 125 IEKYEKNLTFLATVGSVAPFVGLFGTVWGIMNSFQSIAISRNTSLAIVAPGIAEALFATA 184

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           LGL  +IP+ +AYNKF  DS+++  ++E F   F  I+
Sbjct: 185 LGLLAAIPAVVAYNKFSSDSRRYTQKLENFTQSFLTII 222


>gi|283479855|emb|CAY75771.1| Biopolymer transport exbB protein [Erwinia pyrifoliae DSM 12163]
          Length = 337

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 102/222 (45%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L  MD+S++ ++    + VK ++  L + S+ +W++   KS+   + R++ +  + L   
Sbjct: 98  LMQMDLSVWGMYQHADIVVKAVMIGLLLASVATWAIFFSKSIELRSARKRLKREQLLLAD 157

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+   +   +  +  L+ I +   +E +     G+    GI++R    ++  +A   
Sbjct: 158 ARSLDEASQIGGDFQSQSLS-ILLIKEAENELELSAGSDDNNGIKERTAFRLERRVAAIG 216

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 217 RHPGRGNGFLATIGSIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 276

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 277 GLVAAIPAVVIYNVFARAIGSYKASLGDVAAQVLLLQSRDLD 318


>gi|237748802|ref|ZP_04579282.1| TolQ [Oxalobacter formigenes OXCC13]
 gi|229380164|gb|EEO30255.1| TolQ [Oxalobacter formigenes OXCC13]
          Length = 228

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 72/224 (32%), Positives = 117/224 (52%), Gaps = 6/224 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S  +L     L V+ I+ LL + S++SW+ I QK     + R +   FE  FWSG 
Sbjct: 4   SQDLSFISLISNASLLVQLIMALLVVVSLMSWTFIFQKMFAIKSARTETVSFEHAFWSGG 63

Query: 68  SLETVCKSLKNHHN-IGLAAIFMSAMSEWKKSCD----KGARSPIGIQDRIDRMMDVAIA 122
           +L+ + +   ++     L  IF + M E+ K  +      A+  + + D   R M  A  
Sbjct: 64  NLQNLYQRAGSNSKTGALERIFHAGMGEYIKGKNAISGHTAQDTVAVLDGARRAMRAAYQ 123

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLIS 181
           RE++ +   L+FL S+ S    VG+ G V G+M  F+ +A  +   +    PGI E+LI+
Sbjct: 124 REMDSLESHLAFLASVGSVSPYVGLFGTVWGIMNAFRGLANVHQATLATVAPGIAEALIA 183

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +GL  +IP+ +AYN+F  D  + +++ E F  EFS IL RQ+
Sbjct: 184 TAIGLFAAIPAVVAYNRFSHDIDRLSIRFETFIEEFSNILQRQS 227


>gi|288940687|ref|YP_003442927.1| protein TolQ [Allochromatium vinosum DSM 180]
 gi|288896059|gb|ADC61895.1| protein TolQ [Allochromatium vinosum DSM 180]
          Length = 224

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 63/221 (28%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+FAL +   L V+ ++ +L + S++SW++I+ ++      R+    FE+ FWSG  L
Sbjct: 4   DLSLFALILDASLVVQLVLLVLVVASVISWTMILDRTRVLGRARKLADRFEERFWSGGDL 63

Query: 70  ETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K L      G  LA IF +   E+ +           +    +R M VA++RE++ 
Sbjct: 64  GALYKELSQDEKGGQGLAVIFRAGFKEFVRLRKVEDTDMPSVLQGAERSMRVALSREMDR 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   L+FL ++ S    +G+ G V G+M  F ++       +  +   I E+L++  +GL
Sbjct: 124 LETNLAFLATVGSTSPYIGLFGTVWGIMQSFHALGNVEQATLALVAPGISEALVATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
             +IP+ IAYN++    ++   + E F  EF+ +L RQ  G
Sbjct: 184 FAAIPAVIAYNRYSNQVERLNNRYEEFIEEFATLLQRQGRG 224


>gi|238897407|ref|YP_002923084.1| inner membrane protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465161|gb|ACQ66935.1| inner membrane protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 236

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 64/217 (29%), Positives = 107/217 (49%), Gaps = 3/217 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  LF++    VK II++L  FSI SW++I++K+    +  +    FE  FWSG  L 
Sbjct: 1   MSILDLFLKASFLVKGIISILICFSIFSWAIILKKTSILRSATKAANAFENRFWSGIELS 60

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +   +  +   G   IF S   E+ +                 R M +++ RELE +
Sbjct: 61  RLYQQSDDRRDKLSGSEQIFYSGFKEFVRLHRAHHHVCESAVKGAARAMRISMNRELEAL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 121 ETHVPFLGTIGSISPYIGLFGTVWGIMHSFIALGAAKQATLQMVAPGIAEALIATAIGLF 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +IP+ +AYN+F ++  K     + F  EF AIL R+
Sbjct: 181 SAIPAVMAYNRFNQNINKIEQNYDNFVEEFIAILHRE 217


>gi|237746668|ref|ZP_04577148.1| TolQ protein [Oxalobacter formigenes HOxBLS]
 gi|229378019|gb|EEO28110.1| TolQ protein [Oxalobacter formigenes HOxBLS]
          Length = 229

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 71/224 (31%), Positives = 115/224 (51%), Gaps = 6/224 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S  +L     L V+ I+ LL + S++SW+ I QK       R +   FE  FWSG 
Sbjct: 6   SQDLSFISLIANASLLVQLIMALLVVVSLMSWTFIFQKMFAIKNARVETENFEHAFWSGG 65

Query: 68  SLETVCKSL-KNHHNIGLAAIFMSAMSEWKK----SCDKGARSPIGIQDRIDRMMDVAIA 122
           +L+++ +    N+    L  IF + M E+ K          +  + + D   R M  A  
Sbjct: 66  NLQSLYQRAGNNNRTGALERIFYAGMGEYLKGKNAMTPHSTQDAVALLDGARRAMRAAYQ 125

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLIS 181
           RE++ +   L+FL S+ S    VG+ G V G+M  F+ +A  +   +    PGI E+LI+
Sbjct: 126 REMDSLESHLAFLASVGSVSPYVGLFGTVWGIMNAFRGLANVHQATLATVAPGIAEALIA 185

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +GL  +IP+ +AYN++  D  + +++ E F  EFS IL RQ+
Sbjct: 186 TAIGLFAAIPAVVAYNRYSHDIDRLSIRFETFIEEFSNILQRQS 229


>gi|126725526|ref|ZP_01741368.1| Biopolymer transport protein, TolQ [Rhodobacterales bacterium
           HTCC2150]
 gi|126704730|gb|EBA03821.1| Biopolymer transport protein, TolQ [Rhodobacterales bacterium
           HTCC2150]
          Length = 231

 Score =  154 bits (389), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 86/220 (39%), Positives = 126/220 (57%), Gaps = 1/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D SI ALF +  L VK ++ +L + S  SWS+IIQK + + + R Q   F++ FWSG+ 
Sbjct: 12  LDFSILALFWRATLTVKIVMMMLIVASFWSWSIIIQKLIGYRSARSQAARFDESFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +  S+    N     +F + M EW++S     R   G Q RIDR MDVAIA+E EE+
Sbjct: 72  LDELFDSIGPTPNSPGEKVFFAGMVEWRRSHRDDGRLIAGAQARIDRSMDVAIAKEAEEM 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LSFL S+ S    +G+ G V G+   F+ IA   + N+  +   I E+L++  LGL 
Sbjct: 132 NRGLSFLASVGSTAPFIGLFGTVWGIKTAFEQIAIAQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ + YNK   DS +     E FA+EF+ ILSRQ + 
Sbjct: 192 AAIPAVVFYNKLSADSDRILGGYEAFADEFATILSRQLDE 231


>gi|194290134|ref|YP_002006041.1| biopolymer transporter [Cupriavidus taiwanensis LMG 19424]
 gi|193223969|emb|CAQ69978.1| BIOPOLYMER TRANSPORT PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 242

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 92/217 (42%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+ +  L+ Q    ++    +L I S+ SW VI+ K+ + + L++  +  E+ FW   
Sbjct: 1   MQDLGLTHLWSQGDFVMRATAIILLIMSLASWIVILTKAWDLVRLKKMAQGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +   ++L    +     + ++    ++  ++        + I D + R +  +I   +
Sbjct: 61  DFDHALETLGAGDSNPFRTLAIAGKEAAQHHRASQPQLHDVMDISDWLTRSLKSSIDESV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
             +   L+ L S+ S    VG+ G V G+      I       +      + E+LI    
Sbjct: 121 ARMQSGLAVLASVGSTAPFVGLFGTVWGIYHALIGIGASGVPTIDKVAGPVGEALIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALTRGNKSVISKLNRFAHDLHAYF 217


>gi|21232451|ref|NP_638368.1| TolQ protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66767466|ref|YP_242228.1| TolQ protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|188990572|ref|YP_001902582.1| Biopolymer transport TolQ protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21114233|gb|AAM42292.1| TolQ protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66572798|gb|AAY48208.1| TolQ protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|167732332|emb|CAP50524.1| Biopolymer transport TolQ protein [Xanthomonas campestris pv.
           campestris]
          Length = 259

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYAELILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKQANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F S   E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFESGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQAGAD 258


>gi|330958284|gb|EGH58544.1| tolQ protein [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 234

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 106/218 (48%), Gaps = 1/218 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++++ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F S   L 
Sbjct: 8   MTVWGLISDASLLVKAVMLILLLASLVSWFLIIQRSLALRQYERSLDAFQQRFRSETELA 67

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +          G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++ +
Sbjct: 68  PLYSRSAQEAADGIGQVFNAGYAEYVQLKQRPGIEPDTVLSGVERALQVAISEQELQLEK 127

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVS 189
            L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL  +
Sbjct: 128 GLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLFAA 187

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 IPAVIAYNRFAARGQTLTARYYTFGNELQVRLNRTLQG 225


>gi|303258200|ref|ZP_07344207.1| protein TolQ [Burkholderiales bacterium 1_1_47]
 gi|302858953|gb|EFL82037.1| protein TolQ [Burkholderiales bacterium 1_1_47]
          Length = 228

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/225 (30%), Positives = 109/225 (48%), Gaps = 6/225 (2%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D+SI  L       V+ ++ +L IFS++SW++I QK       RR+ R F++ FW G
Sbjct: 4   ASADLSIITLVAHASAVVQIVLAILLIFSLVSWTIIFQKWFQMSRARREARNFDKRFWGG 63

Query: 67  QSLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPI---GIQDRIDRMMDVAI 121
             L  + +S     +       IF S M+E+ +S      +     G+ D + R M    
Sbjct: 64  ADLNKLYESATERRSSIGPQEGIFYSGMTEFLRSRASNLEARAGTFGVIDGVSRAMRARY 123

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
            REL+ +   LS L ++ S    +G+ G V G+M  F  +    S ++  +   I E+L+
Sbjct: 124 QRELDILESGLSVLATIGSVSPYIGLFGTVWGIMDAFTGLGNLESASLAVVAPGIAEALV 183

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +  +GL  +IP+ I YN+F     + + Q E F  EF  IL RQ 
Sbjct: 184 ATAIGLFAAIPAVIGYNRFAYSLDRLSSQYESFMQEFQNILGRQA 228


>gi|292490338|ref|YP_003525777.1| protein TolQ [Nitrosococcus halophilus Nc4]
 gi|291578933|gb|ADE13390.1| protein TolQ [Nitrosococcus halophilus Nc4]
          Length = 225

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 114/222 (51%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            +D+S+F L       V+ ++ +L + S+++W++I +K       +    EFE  FWSG+
Sbjct: 2   AVDLSLFELVTGASFLVQLVMLILLVISVIAWTLIFRKRSELKGAKEAADEFEDRFWSGK 61

Query: 68  SLETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L ++   L        G+  IF S   E+ +   +       + D   R M V++ARE+
Sbjct: 62  ELNSLYAELAAREIPLHGMEGIFFSGFREFVRLRKQTNAEHRAVLDGTQRAMRVSLAREI 121

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L FL +  S    +G+ G V G+M  F+++   +   + +  PGI E+LI+  +
Sbjct: 122 DTLEAALPFLATAGSTSPYIGLFGTVWGIMNSFRALGNAHQATLAMVAPGIAEALIATAM 181

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ IAYN++I + ++   + + F  EFS IL RQ  
Sbjct: 182 GLFAAIPAVIAYNRYIHEVERLINRYDTFLEEFSTILQRQLH 223


>gi|89053461|ref|YP_508912.1| MotA/TolQ/ExbB proton channel [Jannaschia sp. CCS1]
 gi|88863010|gb|ABD53887.1| Cell division and transport-associated protein TolQ [Jannaschia sp.
           CCS1]
          Length = 230

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 73/218 (33%), Positives = 114/218 (52%), Gaps = 1/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D ++ ALF +  L V+ ++  L + S+  W++   K   F   R     F+  FWSG+ L
Sbjct: 13  DFTLIALFFRASLIVQLVMIALIVASVWVWAIAFSKFAMFRKARANAATFDATFWSGEPL 72

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +    ++          +F++ M+EW++S         G+Q R+DR MDVAIARE   +T
Sbjct: 73  DEYYDTVAEAPRSASERVFVAGMTEWRRSLRDDGALIPGVQQRVDRSMDVAIARESGRMT 132

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
             L+FL +  +    VG+ G V G+M  FQ IA     ++  +   I E+L++  LGL  
Sbjct: 133 NGLTFLATTGATAPFVGLFGTVWGIMRSFQEIAISGQTSLAVVAPGIAEALLATGLGLLA 192

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ I YNK   D+       E FA+EFS +LSRQ +
Sbjct: 193 AIPAVILYNKLSNDADTIIGTYESFADEFSTLLSRQLD 230


>gi|52841804|ref|YP_095603.1| biopolymer transport protein TolQ [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628915|gb|AAU27656.1| biopolymer transport protein TolQ [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 229

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 117/220 (53%), Gaps = 7/220 (3%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           ++   FMQ GL VK ++ +L I SI+SW++I Q++  F   ++    F + FW    L  
Sbjct: 11  NVLMYFMQAGLVVKSVMLILLIASIISWTLIFQRAWFFNRRKQMTETFTRRFWDCGDLSK 70

Query: 72  VCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +   + ++ +    +AAIF +   E+ +   +G  S     + I R+M ++ A+E E++ 
Sbjct: 71  LYADVDSNSDERQGVAAIFHAGFKEFVRCRKQGKVS----IEPIQRVMQISHAKEAEKLE 126

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L F  S+ S    VG+ G V G+M  FQ++       + +  PGI E+L++  LGL  
Sbjct: 127 QHLPFFASVGSISPYVGLFGTVWGIMTSFQALGHAQQATIAMVAPGISEALVATALGLFT 186

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ IAYN++   +     + + F  E  +++ +QT G+
Sbjct: 187 AIPAVIAYNRYTTRANTLLNKYDLFQEELISLIEQQTSGS 226


>gi|78048831|ref|YP_365006.1| biopolymer transport TolQ protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325929360|ref|ZP_08190490.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Xanthomonas perforans 91-118]
 gi|78037261|emb|CAJ25006.1| biopolymer transport TolQ protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325540272|gb|EGD11884.1| Cell division and transport-associated protein TolQ (TC 2.C.1.2.1)
           [Xanthomonas perforans 91-118]
          Length = 259

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 4/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL I S +SW +I +K+  F    R+  EFE  FWSG  L 
Sbjct: 37  INYVDLILRASIPVKIIVLLLLIGSFISWVIIFRKARAFKLANREADEFENRFWSGADLA 96

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  + +    GL ++F S   E+ +  D+         +   R M  A  RE++++
Sbjct: 97  KLYASATDRNRTVGGLESMFESGFREFSRLRDRRRLDARVQLEGAQRAMRTAFTREVDQL 156

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 157 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMVSSGEQAGIAAVAPGISEALFATAIGL 216

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            V+IP+  AYN+F    ++ +++ E FA+EFS+IL RQ   +
Sbjct: 217 FVAIPAVWAYNRFTTRVERLSVRYETFADEFSSILQRQAGAD 258


>gi|94311216|ref|YP_584426.1| MotA/TolQ/ExbB proton channel [Cupriavidus metallidurans CH34]
 gi|93355068|gb|ABF09157.1| biopolymer transport exbB protein MotA/TolQ/ExbB proton channel
           [Cupriavidus metallidurans CH34]
          Length = 243

 Score =  154 bits (388), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/217 (21%), Positives = 91/217 (41%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+ +  L+ Q    ++    +L I S+LSW VI+ K+ + I L++     E+ FW   
Sbjct: 1   MQDLGLSHLWSQGDFVMRATAIILLIMSLLSWIVILTKAWDLIRLKKMAHGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +    +L  +       + ++    ++  ++        + I D + R +  AI   +
Sbjct: 61  DFDHALDTLGANDANPFRMLAVTGREAAQHHRASQPQLHDALDISDWLTRSLKSAIDEAV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
             +   L+ L S+ S    VG+ G V G+      I       +      + E+LI    
Sbjct: 121 ARMQSGLAILASVGSTAPFVGLFGTVWGIYHALIGIGASGVPTIDKVAGPVGEALIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALSRGNKGVISKLNRFAHDLHAYF 217


>gi|121605813|ref|YP_983142.1| MotA/TolQ/ExbB proton channel [Polaromonas naphthalenivorans CJ2]
 gi|120594782|gb|ABM38221.1| Cell division and transport-associated protein TolQ [Polaromonas
           naphthalenivorans CJ2]
          Length = 230

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 69/223 (30%), Positives = 110/223 (49%), Gaps = 3/223 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SI +L +     V+ ++ LL   SI SW+ I +K V     ++   EF++ FWSG S
Sbjct: 3   QDLSIVSLLLHASWVVQAVVALLIGISIASWAAIFRKIVALKRAQQLNDEFDRGFWSGTS 62

Query: 69  LETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  +      +      +  IF S M E++K  ++       + D   R M  +  RE++
Sbjct: 63  LNDLFAGAAQNAKISGSMERIFASGMREYQKLRERHISDAGTLLDGARRAMRASYQREMD 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            I   LSFL ++ S    VG+ G V G+M  F  +A      +    PGI E+L++  + 
Sbjct: 123 AIEANLSFLATVGSVSPYVGLFGTVWGIMHAFTGLAAMEQVTLATVAPGIAEALVATAIA 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP+ +AYN+F  D  + A ++E F  EFS IL R    +
Sbjct: 183 LFAAIPAVVAYNRFAHDIDRIANRLETFIEEFSNILQRNLGAH 225


>gi|120554622|ref|YP_958973.1| MotA/TolQ/ExbB proton channel [Marinobacter aquaeolei VT8]
 gi|120324471|gb|ABM18786.1| Cell division and transport-associated protein TolQ [Marinobacter
           aquaeolei VT8]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 113/221 (51%), Gaps = 4/221 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            ++S++ L    G+ V+ ++ LL + S++SW++I Q+   F   R+   EFE  FWSG  
Sbjct: 3   TELSVWHLIANAGILVQLVMLLLMLASVVSWALIFQRLQVFRKARQAQLEFEDRFWSGMD 62

Query: 69  LETVCKS--LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + K    +     G+ ++F +   E+ +   +  R    + +   R M VA +RE E
Sbjct: 63  LGQLYKEVSAEPTPFSGMESVFRAGFKEFSRLRQQS-RDADAVMEGTQRAMRVAFSREQE 121

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +G
Sbjct: 122 RLETHLPFLATVGSTSPYVGLFGTVWGIMNSFRGLAQVQQATLATVAPGISEALIATAMG 181

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ IAYN+F   S       E FA EFS+IL R+  
Sbjct: 182 LFAAIPAVIAYNRFSAMSDALLKNYETFAEEFSSILHRRVH 222


>gi|254428812|ref|ZP_05042519.1| protein TolQ [Alcanivorax sp. DG881]
 gi|196194981|gb|EDX89940.1| protein TolQ [Alcanivorax sp. DG881]
          Length = 239

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/223 (23%), Positives = 106/223 (47%), Gaps = 2/223 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I+ L     L V+ ++ +L + S+ SW +I+ + +      +  ++F   F    
Sbjct: 1   MNDMTIWGLVSDASLVVQAVMLVLILASVGSWCLIVLRHLAMRRGEKHQKQFLATFRGED 60

Query: 68  SLETVCK-SLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           +L+++ +  +  H    L  +F +  +E++        SP  +Q+ ++R+M   I+ +  
Sbjct: 61  NLDSLAQLPVPGHRQAALQTLFNAGYAEYQLLHGDWDASPASVQEGVERVMQGVISEQEA 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
           ++   LSFL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +G
Sbjct: 121 DLEAGLSFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP+ IAYN+     ++       F  E    L R   G 
Sbjct: 181 LFAAIPAVIAYNRLSARGQRLIASSYAFGTELQQRLHRLLYGK 223


>gi|332305761|ref|YP_004433612.1| protein TolQ [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173090|gb|AEE22344.1| protein TolQ [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 236

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 116/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SIF LF Q  L V+ ++ LL   S+ SW+ I Q+S      +   ++FE  FWSG  L
Sbjct: 4   ELSIFGLFWQASLLVQLVMLLLLAASVASWTFIFQRSQALSRAKSDMKKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + + L    +  G+A++F +   E+ +     +     I D   R M V+++RE++++
Sbjct: 64  NRLYQELAARESVGGMASLFCAGFKEFVRLRKSSSTPSEAIMDGTYRAMRVSLSREIDDL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
             +L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL 
Sbjct: 124 ESRLPFLATVGSISPYIGLFGTVWGIMNAFIALGEVQQATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IPS IAYN+F    +K       F  EFS+IL RQ+
Sbjct: 184 AAIPSVIAYNRFSHQVEKLENNYGNFMEEFSSILHRQS 221


>gi|70733350|ref|YP_263125.1| TonB system transport protein ExbB [Pseudomonas fluorescens Pf-5]
 gi|68347649|gb|AAY95255.1| TonB system transport protein ExbB [Pseudomonas fluorescens Pf-5]
          Length = 334

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N  G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 97  NTLGMA-HDLSPWGMYQNADIIVKLVMIGLAIASIITWTIWIAKGFELMGAKRRLRSEIA 155

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                 +L+    +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 156 ALKKATTLKEASATA--TKEGTLANLLVHDALEEMRLS-ANSREKEGIKERVSFRLERLV 212

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 213 AACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 272

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   + E   ++SR  +
Sbjct: 273 ATALGLVAAIPAVVIYNVFARSITGYKAQVTDASAEVLLLVSRDLD 318


>gi|88810555|ref|ZP_01125812.1| MotA/TolQ/ExbB proton channel [Nitrococcus mobilis Nb-231]
 gi|88792185|gb|EAR23295.1| MotA/TolQ/ExbB proton channel [Nitrococcus mobilis Nb-231]
          Length = 234

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 108/220 (49%), Gaps = 4/220 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+SI  L +   L V+ ++ +L   SI SW++I +K       +     FE  FWSG +L
Sbjct: 4   DLSIAGLVLNASLIVQFVLLILLGASISSWTLIFRKWQTIGQAQSGANAFEDRFWSGGNL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   +   H    GL  IF +   E+ +   +G+  P  + D   R M V++ RE++ 
Sbjct: 64  AEIYAQVSQPHEQAGGLERIFRAGFREFTRMRKQGSN-PESVVDASHRAMRVSLQREIDI 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGL 186
           +   + FL ++ S    +G+ G V G+M  F ++       +    PGI E+L++  +GL
Sbjct: 123 LESYVPFLATVGSTSPYIGLFGTVWGIMNAFLALGNMQQATLTTVAPGIAEALVATAMGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ IAYN++    ++     E F  EF++IL R   
Sbjct: 183 FAAIPAVIAYNRYASQIERLTNHYEIFMEEFASILQRHVH 222


>gi|302343859|ref|YP_003808388.1| protein TolQ [Desulfarculus baarsii DSM 2075]
 gi|301640472|gb|ADK85794.1| protein TolQ [Desulfarculus baarsii DSM 2075]
          Length = 277

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 59/225 (26%), Positives = 106/225 (47%), Gaps = 5/225 (2%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L  Q G  VK ++ LL +FS++SW+VI  K +      +Q  +F+ +FW  +SL 
Sbjct: 43  MDIMHLIFQAGWVVKFVLFLLVLFSVISWAVIFSKLMVLRRSIKQNEQFQAMFWHAKSLG 102

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKK----SCDKGARSPIGIQDRIDRMMDVAIARELE 126
                        LA +F  A +E +K       +G   P G+   I R +    A E  
Sbjct: 103 AANAQAMQLAGSPLATVFRLAYAELQKVMGLRKGRGDGLPEGLMANIKRALSRGTAAEAT 162

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
           ++   ++FL + ++    +G+ G V G+M  F +I    + N+    PGI E+L++   G
Sbjct: 163 KLARSVTFLATCANTSPFIGLFGTVWGIMDAFSNIGALKTANLATVAPGIAEALVATATG 222

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           L  +IP+ + +N F    +    +M+ F+ +F  ++  +     S
Sbjct: 223 LFAAIPAVVFFNHFNRRIQVLEAEMDTFSQDFLNLVELEVMSRQS 267


>gi|51246261|ref|YP_066145.1| biopolymer transport protein TolQ [Desulfotalea psychrophila LSv54]
 gi|50877298|emb|CAG37138.1| related to biopolymer transport protein (TolQ) [Desulfotalea
           psychrophila LSv54]
          Length = 232

 Score =  153 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 56/230 (24%), Positives = 102/230 (44%), Gaps = 10/230 (4%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+SI  + +  G  VK ++ +L +FS+ SW++++ K      +RR   +F   FW   +
Sbjct: 1   MDLSITHMILSAGPMVKFVMLVLLVFSVSSWTIVLMKWALLRNIRRDSEDFLDSFWGSPN 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKS---------CDKGARSPIGIQDRIDRMMDV 119
           L    K +        AA+F +  +E +K           ++     +   D + R +  
Sbjct: 61  LNEAYKEVNQFPYSSEAAVFSAGFTELQKITKIQSSKEESNQPLGMQMAAMDNLKRAVRK 120

Query: 120 AIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIES 178
           A  ++  E  + L FL +  SA   +G+ G V G+M  F  I    S ++  +   I E+
Sbjct: 121 AETQKFNEFNKALPFLATTGSASPFIGLFGTVWGIMTSFHQIGQQGSASLAVVAPGISEA 180

Query: 179 LISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L+    GL V+IP+ + +N F     +     + F  +F  ++ R   G 
Sbjct: 181 LVVTAAGLFVAIPAVVTFNYFSHKFDQADAAAQHFTTDFLNLIERDLLGR 230


>gi|254253143|ref|ZP_04946461.1| MotA/TolQ/ExbB proton channel [Burkholderia dolosa AUO158]
 gi|124895752|gb|EAY69632.1| MotA/TolQ/ExbB proton channel [Burkholderia dolosa AUO158]
          Length = 237

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 16  SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 75

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 76  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPGLVLDGARRAMRASFQREM 135

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 136 DVLESNLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 195

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 196 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 237


>gi|109899249|ref|YP_662504.1| MotA/TolQ/ExbB proton channel [Pseudoalteromonas atlantica T6c]
 gi|109701530|gb|ABG41450.1| Cell division and transport-associated protein TolQ
           [Pseudoalteromonas atlantica T6c]
          Length = 236

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 70/218 (32%), Positives = 116/218 (53%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SIF LF Q  L V+ ++ LL   S+ SW+ I Q+S      +   ++FE  FWSG  L
Sbjct: 4   ELSIFGLFWQASLLVQLVMLLLLAASVASWTFIFQRSQALSRAKNDMKKFEDKFWSGVDL 63

Query: 70  ETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
             + + L    ++  +A++F +   E+ +     +     I D   R M V+++RE++E+
Sbjct: 64  NRLYQELAARESVQGMASLFCAGFKEFVRLRKSSSTPSEAIMDGTYRAMRVSLSREIDEL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
             +L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+LI+  +GL 
Sbjct: 124 ESRLPFLATVGSISPYIGLFGTVWGIMNAFIALGEVQQATLAMVAPGIAEALIATAMGLF 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IPS IAYN+F    +K       F  EFS+IL RQ+
Sbjct: 184 AAIPSVIAYNRFSHQVEKLENNYGNFMEEFSSILHRQS 221


>gi|146279028|ref|YP_001169187.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17025]
 gi|145557269|gb|ABP71882.1| MotA/TolQ/ExbB proton channel [Rhodobacter sphaeroides ATCC 17025]
          Length = 355

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 99/226 (43%), Gaps = 3/226 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
              D++ + +F      V+ ++ +L   S ++W+V++ K V     RR+           
Sbjct: 128 IPHDLTPWGMFEAAHWVVQAVMIVLAAASFVTWTVLLFKLVEIAIARRRLASTAGTVRGS 187

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDK-GARSPIGIQDRIDRMMDVAIAREL 125
            +L+   + L        A +  +A  E ++S          G+++R+  +++   A+  
Sbjct: 188 ATLDEAVQRLS-GRRDPAAFMARAAFEELQRSDAALDLAGTAGLKERVRSILERVEAQAG 246

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   +  L ++ S G  VG+ G V G+M  F  I+   + N+  +   I E+L++  L
Sbjct: 247 ERLRRGIGLLATIGSVGPFVGLFGTVWGIMNAFIGISQSQTTNLAVVAPGIAEALLATGL 306

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F+     + + +         +LSR  +   +
Sbjct: 307 GLVAAIPAVVIYNHFVRSIASWRLSLADAGAAVERMLSRDLDFRTA 352


>gi|78065366|ref|YP_368135.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. 383]
 gi|77966111|gb|ABB07491.1| Cell division and transport-associated protein TolQ [Burkholderia
           sp. 383]
          Length = 246

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 25  SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARVQTERFEKDFWSGG 84

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 85  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRISDPGLVLDGARRAMRASFQREM 144

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 145 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 204

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 205 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 246


>gi|114799599|ref|YP_758885.1| protein TolQ [Hyphomonas neptunium ATCC 15444]
 gi|114739773|gb|ABI77898.1| protein TolQ [Hyphomonas neptunium ATCC 15444]
          Length = 236

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 68/218 (31%), Positives = 108/218 (49%), Gaps = 3/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D S+ +L M     VK ++  LF+ S+ SW VI +K      L++  R+FE+ FWSG++ 
Sbjct: 14  DFSLISLLMAADPVVKLVLLALFLASVWSWIVIGEKFFKLGGLKKSSRDFEEAFWSGRAG 73

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKG-ARSPIGIQDRIDRMMDVAIARELEEI 128
           E +            + +F+SA  EW  +     +     I  R +R M  A+ RE+   
Sbjct: 74  E-IDMRPGQGGKDPASRVFISAAREWADAGKGPVSVEATAIVSRAERSMRAAVDREIGRA 132

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
           +  LS L ++ SA   +G+ G V G+M  F +IA     ++      I E+L +  LGL 
Sbjct: 133 SAGLSVLATIGSASPFIGLFGTVWGIMNAFLNIAEQQDTSLGTVAGPIAEALFATGLGLI 192

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +IP+ I YNKF  D  K   Q++ F+ +    LSR+ 
Sbjct: 193 AAIPAVIFYNKFTSDLTKLGDQLDTFSQDVLVRLSRRA 230


>gi|297568865|ref|YP_003690209.1| protein TolQ [Desulfurivibrio alkaliphilus AHT2]
 gi|296924780|gb|ADH85590.1| protein TolQ [Desulfurivibrio alkaliphilus AHT2]
          Length = 234

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 57/222 (25%), Positives = 105/222 (47%), Gaps = 6/222 (2%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           M++++F +F++ G  +K +I LL + S+ SW ++ QK + +  +R+   EF++ FW  ++
Sbjct: 1   MELNVFTMFLEAGPTIKAVILLLLVMSLYSWFIVFQKEILYRKVRQASEEFKEQFWKCRN 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKG-----ARSPIGIQDRIDRMMDVAIAR 123
           L    K+ K       A IF +A  E +K              +   + + R    A   
Sbjct: 61  LAEAHKTAKQAELAPEAMIFRAAYQELQKLNKAQGGELRLEQRLAGMEPLKRAAGKARDG 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISI 182
           E+ ++   L FL S  SA   +G+ G V G+M  F  I    S ++  +   I E+L+  
Sbjct: 121 EIAQLASSLPFLASTGSASPFIGLFGTVWGIMTAFHEIGVRGSASLAVVAPGISEALVVT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +GL V+IP+ + YN +     +     + F  +F  ++ R 
Sbjct: 181 AMGLAVAIPAVVFYNYYTNRLAQIEDNSQAFVTDFINLIERD 222


>gi|317486274|ref|ZP_07945106.1| TolQ protein [Bilophila wadsworthia 3_1_6]
 gi|316922444|gb|EFV43698.1| TolQ protein [Bilophila wadsworthia 3_1_6]
          Length = 230

 Score =  153 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 58/223 (26%), Positives = 108/223 (48%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+SI +L  Q  L  K ++ +L   S+ SW+++ +K +N     ++  +    F   + 
Sbjct: 1   MDLSILSLLAQATLVAKAVLVVLLFMSVFSWALMFRKWMNIRAALKKAADGMDRFNHARD 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L    +SL    +  L  +    ++E+ +S + G  S   + D + R +   +  E+  +
Sbjct: 61  LREAVQSLGGDPDSPLYTVAHEGVTEFNRSKEAG-NSEDVVVDNVRRALRQGVDMEMTRL 119

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
           T  LSFL + ++    +G+ G V G+M  F +I    S ++    PGI E+LI+  +GL 
Sbjct: 120 TSSLSFLATSANTAPFIGLFGTVWGIMNTFHAIGAMKSASLATVAPGISEALIATAMGLL 179

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           V+IP++I YN F         ++  FA  F   + R+   + +
Sbjct: 180 VAIPATIGYNTFHGSLGVLETRLVNFAGMFLNRVQRELNAHRA 222


>gi|85716760|ref|ZP_01047728.1| ABC transporter, ATPase subunit [Nitrobacter sp. Nb-311A]
 gi|85696478|gb|EAQ34368.1| ABC transporter, ATPase subunit [Nitrobacter sp. Nb-311A]
          Length = 1014

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 98/222 (44%), Gaps = 6/222 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FMQ  + VK ++  L   S+++W++ + + V     RR+ +   +      
Sbjct: 775 PQDLSPWGMFMQADIIVKAVMIGLAFASLVTWTIWLARGVELAASRRRAQSCLRKLERAG 834

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           +L      +         ++ +  +A +E ++S      S  GI++R+   +    A+  
Sbjct: 835 TLAAARAEIAEGWTGKGPVSDLMEAAENECRRS---NDLSSEGIKERLAIALSRIEAKAG 891

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            +I      L ++ +    VG+ G V G+M  F  I+   + N+  +   I E+L++  L
Sbjct: 892 RDIARGTGLLATIGATAPFVGLFGTVWGIMNAFIGISHSKTTNLAVVAPGIAEALLATAL 951

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ I YN F      +   +   + E    +SR  E
Sbjct: 952 GLVAAIPAVIIYNVFARALSSYRALLSDASGEIIQHISRDLE 993


>gi|34496006|ref|NP_900221.1| tolQ-related transport transmembrane protein [Chromobacterium
           violaceum ATCC 12472]
 gi|34101859|gb|AAQ58227.1| tolQ-related transport transmembrane protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 222

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 65/218 (29%), Positives = 107/218 (49%), Gaps = 2/218 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           +  IS  +L +   L V+ ++  L + S+LSW++I  K     + +R   EFE+ FWSG 
Sbjct: 1   MQQISFISLILNASLLVQLVMAGLALTSLLSWALIFNKISVLRSAKRHSEEFERNFWSGA 60

Query: 68  SLETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            L  + + +    +   +  IF S  +E+ K   +       I D   R M  A  REL+
Sbjct: 61  DLNRLYEDVCRRSDTVGMERIFQSGFAEFLKLRGRSGAELSDIMDGSRRAMRAAAQRELD 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +    SFL ++ S    +G+ G V G+M  F  +       +    PGI E+L++  +G
Sbjct: 121 ALDSHTSFLATVGSVSPYIGLFGTVWGIMHAFIGLGNAGQATLSTVAPGIAEALVATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           L  +IP+ +AYN+F  D  + A + + +  EFS IL R
Sbjct: 181 LFAAIPAVVAYNRFATDVDRLATRFDTYMEEFSNILQR 218


>gi|187929196|ref|YP_001899683.1| MotA/TolQ/ExbB proton channel [Ralstonia pickettii 12J]
 gi|187726086|gb|ACD27251.1| MotA/TolQ/ExbB proton channel [Ralstonia pickettii 12J]
          Length = 242

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/217 (22%), Positives = 92/217 (42%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + ++ +  L+ Q  +  +    LL I S+ SW VI  K+ + + L+   +  E+ FW   
Sbjct: 1   MQELGLSHLWTQGDIVTRATAILLLIMSLASWIVIFTKAWDIVRLKSMAQGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +   ++L +  +    A+  +    ++  ++        + I D I R +  AI   +
Sbjct: 61  DFDHAIQTLGSPKDNPFHALAQTGREAAQHHRASQPQLHDVMDISDWITRSLKSAIDEAV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
            ++   L+ L S+ S    VG+ G V G+      I       +      + ESLI    
Sbjct: 121 GQMQSGLAVLASVGSTAPFVGLFGTVWGIYHALLGIGAVGVPTIDKVAGPVGESLIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALTRGNKAIIAKLNRFAHDLHAYF 217


>gi|238026340|ref|YP_002910571.1| MotA/TolQ/ExbB proton channel [Burkholderia glumae BGR1]
 gi|237875534|gb|ACR27867.1| MotA/TolQ/ExbB proton channel [Burkholderia glumae BGR1]
          Length = 225

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 73/223 (32%), Positives = 119/223 (53%), Gaps = 3/223 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           +  D+SI +L +   +  + ++ LL + S++SW+ I +K       RRQ   FE+ FWSG
Sbjct: 3   SAQDLSIVSLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFALRRARRQTERFERDFWSG 62

Query: 67  QSLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             L+ + +S  N+ +    L  IF S M E+ K+ +K    P  I D   R M  A  RE
Sbjct: 63  GDLQALYQSAANNRHTIGSLERIFESGMREFLKAKEKRISDPSLILDGARRAMRAAFQRE 122

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           ++ +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  
Sbjct: 123 MDMLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATA 182

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +GL  +IP+ +AYN++  +  + A + E F  EFS IL RQ +
Sbjct: 183 IGLFAAIPAVVAYNRYAHEIDRLASRFETFVEEFSNILQRQAQ 225


>gi|329893682|ref|ZP_08269816.1| MotA/TolQ/ExbB proton channel family protein [gamma proteobacterium
           IMCC3088]
 gi|328923609|gb|EGG30921.1| MotA/TolQ/ExbB proton channel family protein [gamma proteobacterium
           IMCC3088]
          Length = 236

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 63/222 (28%), Positives = 112/222 (50%), Gaps = 6/222 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
            +S+  L ++  L V+ ++ +L + SI SW +I+++ + F   +    +FE  FWSG  L
Sbjct: 4   QLSLLDLVLEASLTVQAVMAMLVLASITSWFMIVKRGLYFQRAKSAMLDFEDAFWSGSDL 63

Query: 70  ETVCKSLKNHHNIG-----LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
            ++ K        G     + ++F +   E+ +   +       I +   R M VA+ RE
Sbjct: 64  SSLYKDGSERAANGELILGMESLFRAGFKEFSRLAQQPEMDADAILEGARRAMRVAMLRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
            E + + LSFL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  
Sbjct: 124 EERLEQNLSFLASVGSTSPYIGLFGTVWGIMHSFRGLASSSQATLATVAPGISEALVATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +GL  +IP+ +AYN++      F  + + F +EFS +L RQ 
Sbjct: 184 MGLFAAIPAVLAYNRYTARVDVFVNRYDTFMDEFSGLLYRQA 225


>gi|197121113|ref|YP_002133064.1| protein TolQ [Anaeromyxobacter sp. K]
 gi|220915814|ref|YP_002491118.1| protein TolQ [Anaeromyxobacter dehalogenans 2CP-1]
 gi|196170962|gb|ACG71935.1| protein TolQ [Anaeromyxobacter sp. K]
 gi|219953668|gb|ACL64052.1| protein TolQ [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 257

 Score =  153 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/222 (24%), Positives = 105/222 (47%), Gaps = 8/222 (3%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++   +    G     ++ LL   S +SW++I++K +     + Q  +F + FW  + L+
Sbjct: 33  LNYLEIATNSGPVGIGVLALLLGASAVSWAIIVKKWLQIRRAQDQSVKFLETFWQSKRLD 92

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQ-------DRIDRMMDVAIAR 123
            + ++ ++     L+ +F +   E  K   +      G         + ++R +  A A 
Sbjct: 93  AIYQAAESLGASPLSHVFRAGYVELSKVTARKNEGDPGAMSDQLGGIENVERALKRAAAS 152

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E+  +  ++ FLG+ +SA   VG+ G V G+M  F  I    + N+      I E+LI+ 
Sbjct: 153 EVTALERQVPFLGTTASAAPFVGLFGTVWGIMRAFHEIYLMGNANLATVAKPISEALIAT 212

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +GL  +IP+ +AYN F+   +    +M  F+N+F  I+ R 
Sbjct: 213 AVGLFAAIPAVVAYNFFLSKIRVLDSEMTNFSNDFLNIVRRH 254


>gi|103485826|ref|YP_615387.1| MotA/TolQ/ExbB proton channel [Sphingopyxis alaskensis RB2256]
 gi|98975903|gb|ABF52054.1| MotA/TolQ/ExbB proton channel [Sphingopyxis alaskensis RB2256]
          Length = 232

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 60/217 (27%), Positives = 106/217 (48%), Gaps = 2/217 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S  ALF+Q  + VK ++  L   SI  W+VI         L R    FE+ FW   +++
Sbjct: 14  LSPVALFLQADIIVKAVMIGLLAASIYVWAVIFTHGRGVGKLMRASERFERDFWRADNID 73

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
                      +  A +  + + EW++S         G ++R+   M+ AIA E++ + E
Sbjct: 74  RFFDK-NGAEELPSAKVLSAGIGEWRRSTKGKVIDRDGTRERLGIAMNSAIAGEIDRLAE 132

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
           K+  L ++ +    VG+ G V G+M  F +IA   ++++  +   I E+L +  +GL  +
Sbjct: 133 KIGTLATIGAVAPFVGLFGTVWGIMRSFTAIAAENNSSLAVVAPGIAEALFATAIGLFAA 192

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           IP+ IAYN F +   +   ++  FA+   A  SR+ E
Sbjct: 193 IPAVIAYNAFSQRLNRLESRLGRFADGLHATFSRELE 229


>gi|188532604|ref|YP_001906401.1| biopolymer transport protein ExbB [Erwinia tasmaniensis Et1/99]
 gi|188027646|emb|CAO95496.1| Biopolymer transport ExbB protein [Erwinia tasmaniensis Et1/99]
          Length = 244

 Score =  153 bits (385), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 104/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L  MD+S++ ++    + VK ++  L + S+++W++   KS+     R++ +  + L  +
Sbjct: 5   LMQMDLSVWGMYQHADIVVKAVMIGLLLASVVTWAIFFSKSIELSRARKRLKREQALLAN 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SLE   +  +  H+  L+++ +S      +    G+    GI++R    ++  +A   
Sbjct: 65  ARSLENAAQVCEGFHHQSLSSLLVSEAVNELELSV-GSDDNNGIKERTAFRLERRVAAIS 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ +    +G+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHAGRGNGFLATIGAVAPFIGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARTIGSYKASLGDVAAQVLLLQSRDLD 225


>gi|197284478|ref|YP_002150350.1| colicin uptake protein TolQ [Proteus mirabilis HI4320]
 gi|227356656|ref|ZP_03841042.1| TonB family auxiliary protein TolQ [Proteus mirabilis ATCC 29906]
 gi|194681965|emb|CAR41393.1| biopolymer transport protein [Proteus mirabilis HI4320]
 gi|227163164|gb|EEI48095.1| TonB family auxiliary protein TolQ [Proteus mirabilis ATCC 29906]
          Length = 228

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 70/221 (31%), Positives = 112/221 (50%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++  LF++ GL VK I+ LL  FSI SW++IIQ++       R+  +FE  FWSG 
Sbjct: 1   MADMNVIDLFLKAGLLVKLIMLLLIGFSIASWAIIIQRTKVLNAADREAADFEDKFWSGT 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  +   +   G   IF S   E+ +       +P  + +   R M V+  REL
Sbjct: 61  DLARLYKESQARRDELSGAEQIFHSGFKEFARLHQANVHAPDAVVNGASRAMRVSFNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGSVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+F +   K     + F  EF  IL RQ 
Sbjct: 181 GLFAAIPAVMAYNRFTQRVNKLEQSYDNFMEEFLTILHRQA 221


>gi|229593364|ref|YP_002875483.1| biopolymer transport membrane protein [Pseudomonas fluorescens
           SBW25]
 gi|229365230|emb|CAY53532.1| biopolymer transport membrane protein [Pseudomonas fluorescens
           SBW25]
          Length = 322

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 54/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N  G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 85  NTLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWIAKGFELLGAKRRLRNEIV 143

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                 +L+   +S        LA   +    E  +     AR   GI++R+   ++  +
Sbjct: 144 HLKKATTLKEASESA--TKKGTLANTLVHDALEEMRLS-ANAREKEGIKERVAFRLERLV 200

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 201 AACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 260

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   + E   ++SR  +
Sbjct: 261 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAEVLLLVSRDLD 306


>gi|312963866|ref|ZP_07778337.1| TonB system transport protein [Pseudomonas fluorescens WH6]
 gi|311281901|gb|EFQ60511.1| TonB system transport protein [Pseudomonas fluorescens WH6]
          Length = 325

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 53/230 (23%), Positives = 102/230 (44%), Gaps = 5/230 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N  G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 88  NTLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWIAKGFELLGAKRRLRTEIV 146

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                 +L+   ++        LA + +    E  +      R   GI++R+   ++  +
Sbjct: 147 HLKKATTLKEASETA--TKKGTLANLLVHDALEEMRLS-ANTREKEGIKERVSFRLERLV 203

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 204 AACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 263

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +  LGL  +IP+ + YN F      +  Q+   + E   ++SR  +   S
Sbjct: 264 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAEVLLLVSRDLDHQPS 313


>gi|183598185|ref|ZP_02959678.1| hypothetical protein PROSTU_01563 [Providencia stuartii ATCC 25827]
 gi|188020351|gb|EDU58391.1| hypothetical protein PROSTU_01563 [Providencia stuartii ATCC 25827]
          Length = 227

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 66/221 (29%), Positives = 110/221 (49%), Gaps = 3/221 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D++I  LF++  L V+ I+ +L  FSI SW++IIQ++       R+   FE  FWSG 
Sbjct: 1   MTDMNIVDLFLKASLLVQIIMFVLIGFSIASWAIIIQRTKILNAAAREAEAFEDKFWSGI 60

Query: 68  SLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  +   +   G   IF +   E+ +       +P  +     R M +++ REL
Sbjct: 61  ELSRLYKESQARRDSLSGAEQIFHAGFKEFVRLHQANIHAPDAVVTGASRAMRISMNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESVEAHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ +AYN+  +   K     + F  EF AIL RQ 
Sbjct: 181 GLFAAIPAVMAYNRLNQRVNKLEQSYDNFMEEFLAILHRQA 221


>gi|115350734|ref|YP_772573.1| MotA/TolQ/ExbB proton channel [Burkholderia ambifaria AMMD]
 gi|115280722|gb|ABI86239.1| Cell division and transport-associated protein TolQ [Burkholderia
           ambifaria AMMD]
          Length = 242

 Score =  152 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 21  SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 80

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 81  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLTDPGLVLDGARRAMRASFQREM 140

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 141 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 200

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 201 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 242


>gi|309782378|ref|ZP_07677102.1| transporter, MotA/TolQ/ExbB proton channel family [Ralstonia sp.
           5_7_47FAA]
 gi|308918715|gb|EFP64388.1| transporter, MotA/TolQ/ExbB proton channel family [Ralstonia sp.
           5_7_47FAA]
          Length = 242

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 47/217 (21%), Positives = 91/217 (41%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + ++ +  L+ Q  +  +    LL I S+ SW VI  K+ + + L+   +  E+ FW   
Sbjct: 1   MQELGLSHLWTQGDVVTRATAILLLIMSLASWIVIFTKAWDIVRLKSMAQGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +   ++L +  +     +  +    ++  ++        + I D I R +  AI   +
Sbjct: 61  DFDHAIQTLGSPKDNPFHTLAQTGREAAQHHRASQPQLHDVMDISDWITRSLKSAIDEAV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
            ++   L+ L S+ S    VG+ G V G+      I       +      + ESLI    
Sbjct: 121 GQMQSGLAVLASVGSTAPFVGLFGTVWGIYHALLGIGAVGVPTIDKVAGPVGESLIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALTRGNKAIIAKLNRFAHDLHAYF 217


>gi|241663387|ref|YP_002981747.1| MotA/TolQ/ExbB proton channel [Ralstonia pickettii 12D]
 gi|240865414|gb|ACS63075.1| MotA/TolQ/ExbB proton channel [Ralstonia pickettii 12D]
          Length = 242

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 47/217 (21%), Positives = 91/217 (41%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + ++ +  L+ Q  +  +    LL I S+ SW VI  K+ + + L+   +  E+ FW   
Sbjct: 1   MQELGLSHLWTQGDIVTRATAILLLIMSLASWIVIFTKAWDIVRLKSMAQGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +   ++L +  +     +  +    ++  ++        + I D I R +  AI   +
Sbjct: 61  DFDHAIQTLGSPKDNPFHTLAQTGREAAQHHRASQPQLHDVMDISDWITRSLKSAIDEAV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
            ++   L+ L S+ S    VG+ G V G+      I       +      + ESLI    
Sbjct: 121 GQMQSGLAVLASVGSTAPFVGLFGTVWGIYHALLGIGAVGVPTIDKVAGPVGESLIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALTRGNKAIIAKLNRFAHDLHAYF 217


>gi|87118955|ref|ZP_01074853.1| TolQ protein [Marinomonas sp. MED121]
 gi|86165346|gb|EAQ66613.1| TolQ protein [Marinomonas sp. MED121]
          Length = 226

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 72/221 (32%), Positives = 114/221 (51%), Gaps = 3/221 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI+ L     L V+ ++ LL   S+ SW VI Q+       ++  R FE LFWSG  L 
Sbjct: 1   MSIWGLIASASLVVQLVMLLLASASVFSWVVIFQRIRVLRNAKKVRRTFEDLFWSGMDLS 60

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + + +  +     G+  IF + + E+ +        P  + + + R M VA+ARE E++
Sbjct: 61  QLYRQITAEGRRIEGIENIFTAGIKEFTRLRQSANMDPDAVMEGVQRSMRVALAREEEKL 120

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    VG+ G V G+M  F  +A      +    PGI E+LI+  +GL 
Sbjct: 121 DQHLPFLATVGSTSPYVGLFGTVWGIMHSFIGLAEVQQATLATVAPGIAEALIATAIGLL 180

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +IP+ I YN+F   S   A+  E F++EFS+IL R+  G 
Sbjct: 181 AAIPAVICYNRFSATSDALAINYETFSDEFSSILHRKVHGR 221


>gi|226330932|ref|ZP_03806450.1| hypothetical protein PROPEN_04855 [Proteus penneri ATCC 35198]
 gi|225201727|gb|EEG84081.1| hypothetical protein PROPEN_04855 [Proteus penneri ATCC 35198]
          Length = 228

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 71/225 (31%), Positives = 113/225 (50%), Gaps = 3/225 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+++  LF++ GL VK I+ LL  FSI SW++IIQ++       R+  +FE  FWSG 
Sbjct: 1   MADMNVIDLFLKAGLLVKLIMLLLIGFSIASWAIIIQRTKVLNAADREAADFEDKFWSGT 60

Query: 68  SLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + K  +   +   G   IF S   E+ +       +P  I +   R M V+  REL
Sbjct: 61  DLARLYKDSQARRDELSGSEQIFHSGFKEFARLHQASVHAPDAIVNGASRAMRVSFNREL 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
           E +   + FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +
Sbjct: 121 ESLETHIPFLGTVGSISPYIGLFGTVWGIMHAFIALGSVKQATLQMVAPGIAEALIATAI 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
           GL  +IP+ +AYN+F +   K     + F  EF  IL RQ   + 
Sbjct: 181 GLFAAIPAVMAYNRFTQRVNKLEQSYDNFMEEFLTILHRQAFASA 225


>gi|198282213|ref|YP_002218534.1| protein TolQ [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666774|ref|YP_002424578.1| TolQ protein [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198246734|gb|ACH82327.1| protein TolQ [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518987|gb|ACK79573.1| TolQ protein [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 233

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 68/227 (29%), Positives = 110/227 (48%), Gaps = 3/227 (1%)

Query: 1   MNNYGLA--IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFRE 58
           M+ + +A     +S+  L M     V+ I+ +L I S++SW++I QK   F   +R    
Sbjct: 1   MDPHSIANTAQSLSLGHLVMNASWVVQGILAILMIASVISWTIIFQKWAIFAAAQRALER 60

Query: 59  FEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMD 118
           FE+ FWSG  +  + + +  + N+   A  +      +    +    P    D   R M 
Sbjct: 61  FEKRFWSGGEMSQIYQHVSGNANLETGAGSIFCAGYEEFQRQRNKIRPSDALDAARRAMR 120

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
           VA  RE+  +   L+FL S+SS    +G+ G V G+M  F +I       +    P + E
Sbjct: 121 VAQMREVGRLENNLAFLASVSSVSPFIGLFGTVWGIMTAFMNIGMAGQATLATVAPPVAE 180

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           +LI+   GL  +IP++ AYN++I    K   Q E F +EF+ IL RQ
Sbjct: 181 ALIATAAGLFAAIPATAAYNRYIHQLDKLDAQYEVFMDEFTNILHRQ 227


>gi|330954684|gb|EGH54944.1| tolQ protein [Pseudomonas syringae Cit 7]
          Length = 236

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 107/220 (48%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I+ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F S   L 
Sbjct: 8   MTIWGLISDASLLVKAVMLILLLASLVSWYLIIQRSLVLRHYERSLDAFQQRFRSAADLA 67

Query: 71  TVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +     +      G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLQAQASSAQRDATGIEDVFQAGYAEYMQLKQRPGIEPDVVLSGVERSLQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ +AYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVVAYNRFAARGQTLTARYYSFGNELQVRLNRTLQG 227


>gi|75674900|ref|YP_317321.1| MotA/TolQ/ExbB proton channel [Nitrobacter winogradskyi Nb-255]
 gi|74419770|gb|ABA03969.1| outer membrane transport energization protein ExbB [Nitrobacter
           winogradskyi Nb-255]
          Length = 400

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 99/222 (44%), Gaps = 6/222 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FMQ  + VK ++  L   S+++W+V + K +     RR+ +   +      
Sbjct: 161 PQDLSPWGMFMQADIVVKAVMIGLAFASLVTWTVWLAKGIELAASRRRAQSCVRKLERAD 220

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           SL+     +         +A +  +A  E ++S   G  S  GI++R+   +    A+  
Sbjct: 221 SLDAARSEIAEGWTCEGTVADLMGAAERELQRS---GDLSSEGIKERLAIALSRIEAKAG 277

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            +I      L ++ +    VG+ G V G+M  F  I+   + N+  +   I E+L++  L
Sbjct: 278 RDIARGTGLLATIGATAPFVGLFGTVWGIMNAFIGISQTKTTNLAVVAPGIAEALLATAL 337

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ I YN F      +   +   + E    +SR  E
Sbjct: 338 GLVAAIPAVIIYNVFARALSSYRALLSDASGEIIQHISRDLE 379


>gi|330815671|ref|YP_004359376.1| tolQ protein [Burkholderia gladioli BSR3]
 gi|327368064|gb|AEA59420.1| tolQ protein [Burkholderia gladioli BSR3]
          Length = 225

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 72/223 (32%), Positives = 119/223 (53%), Gaps = 3/223 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           +  D+SI +L +   +  + ++ LL + S++SW+ I +K       R+Q   FE+ FWSG
Sbjct: 3   SAQDLSIVSLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARKQTERFERDFWSG 62

Query: 67  QSLETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             L+ + +S  N+ +    L  IF S M E+ K+ +K    P  I D   R M  +  RE
Sbjct: 63  GDLQALYQSAANNRHTIGSLERIFESGMREFLKAKEKRISDPSLILDGARRAMRASFQRE 122

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           ++ +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  
Sbjct: 123 MDMLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATA 182

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +GL  +IP+ +AYN++  D  + A + E F  EFS IL RQ +
Sbjct: 183 IGLFAAIPAVVAYNRYAHDIDRLASRFETFVEEFSNILQRQAQ 225


>gi|73541923|ref|YP_296443.1| MotA/TolQ/ExbB proton channel [Ralstonia eutropha JMP134]
 gi|72119336|gb|AAZ61599.1| MotA/TolQ/ExbB proton channel [Ralstonia eutropha JMP134]
          Length = 242

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 93/217 (42%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+ +  L+ Q    ++    +L I S+LSW VI+ K+ + I L++     E+ FW   
Sbjct: 1   MQDLGLSHLWSQGDFVMRATAIILLIMSLLSWIVILTKAWDLIRLKKMAHGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +   ++L ++       + ++    ++  ++        + I D + R +  +I   +
Sbjct: 61  DFDHALETLGSNDANPFRTLAIAGKEAAQHHRASQPQLHDVMDISDWLTRSLKSSIDDAV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
             +   L+ L S+ S    VG+ G V G+      I       +      + E+LI    
Sbjct: 121 AHMQSGLAVLASVGSTAPFVGLFGTVWGIYHALIGIGASGVPTIDKVAGPVGEALIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALTRGNKSVISKLNRFAHDLHAYF 217


>gi|296136872|ref|YP_003644114.1| protein TolQ [Thiomonas intermedia K12]
 gi|295796994|gb|ADG31784.1| protein TolQ [Thiomonas intermedia K12]
          Length = 250

 Score =  152 bits (383), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 73/220 (33%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + SI ++ +   + V+ ++ LL   S+ SW+VI +K     + R +  +FEQ FWSG  
Sbjct: 3   QNFSIVSMVLGASIVVQLVLALLLSVSLASWTVIFRKYFAIKSARVKSEDFEQEFWSGTG 62

Query: 69  LETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + +S      H   L  IF S M E+ K  ++       + D   R M  A  RE++
Sbjct: 63  LNDLYQSALSNGRHGSPLQRIFASGMREYLKLRERHVLDGSTLVDGARRAMRAAFQREMD 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   LSFL S+ S    VG+ G V G+M  F  ++      +    PGI E+L++  +G
Sbjct: 123 ALEANLSFLASVGSVSPYVGLFGTVWGIMHAFVGLSNLQQVTLATVAPGIAEALVATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ IAYN F  D  + A + E F  EFS IL RQ+
Sbjct: 183 LFAAIPAVIAYNFFARDIDRLANRYESFTEEFSNILQRQS 222


>gi|156932496|ref|YP_001436412.1| biopolymer transport protein ExbB [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156530750|gb|ABU75576.1| hypothetical protein ESA_00276 [Cronobacter sakazakii ATCC BAA-894]
          Length = 239

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 99/220 (45%), Gaps = 4/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VK ++  L + S+++W++   KSV     +R+ +  +Q     ++
Sbjct: 3   TDLSVWGMYQHADIVVKIVMIGLILASVVTWAIFFSKSVELSGHKRRLKREQQELAGART 62

Query: 69  LETVCKSLKNH-HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           L+   +  +        A +   A +E  +    G+    GI++R    ++  +A     
Sbjct: 63  LDDAREMAERFGPKSLSARLIEEAQNE--RELSAGSEDNEGIKERTGFRLERRVAAAGRH 120

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL
Sbjct: 121 MGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQSQTTNLAVVAPGIAEALLATAIGL 180

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 181 VAAIPAVVIYNIFARTIGSYKATLGDVAAQVLLLQSRDLD 220


>gi|315498696|ref|YP_004087500.1| mota/tolq/exbb proton channel [Asticcacaulis excentricus CB 48]
 gi|315416708|gb|ADU13349.1| MotA/TolQ/ExbB proton channel [Asticcacaulis excentricus CB 48]
          Length = 234

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 60/227 (26%), Positives = 113/227 (49%), Gaps = 3/227 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   +S   LF++    VK ++ LL + S+ SW++II+K      L ++   FE    +G
Sbjct: 6   AAESLSFIDLFLRADWVVKGVMLLLALGSLWSWAIIIEKGFKLAKLNKEAAGFEAELAAG 65

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIG--IQDRIDRMMDVAIARE 124
           ++LE +              + ++  S W +   K   +P G  +  R+DR ++  I+ E
Sbjct: 66  RALEDIAAKHGTQPTAPFPKLLVTVTSAWGEYKGKSISAPEGELLLSRVDRELNHVISTE 125

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
            + + + LS L  +++A   +G+ G V G+M  F +IA     N+    P I E+L +  
Sbjct: 126 ADVMEDGLSLLAVVATAAPFIGLFGTVWGIMNAFSAIASQGDTNLATVAPAISEALFATA 185

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +GL  +IP+ I +N +     +F  ++EGFA+E    ++ +  G ++
Sbjct: 186 IGLGAAIPAYIFFNLYNAKVARFVGRLEGFADELMVSVTGRLGGKLA 232


>gi|86157090|ref|YP_463875.1| MotA/TolQ/ExbB proton channel [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773601|gb|ABC80438.1| Cell division and transport-associated protein TolQ
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 247

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 54/222 (24%), Positives = 105/222 (47%), Gaps = 8/222 (3%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++   +    G     ++ LL   S +SW++I++K +     + Q  +F + FW  + L+
Sbjct: 23  LNYLEIATNSGPVGIGVLALLLGASAVSWAIIVKKWLQIRRAQDQSVKFLETFWQSKRLD 82

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQ-------DRIDRMMDVAIAR 123
            + ++ ++     L+ +F +   E  K   +      G         + ++R +  A A 
Sbjct: 83  AIYQAAESLGASPLSHVFRAGYVELSKVTARKNEGDPGAMSDQLGGIENVERALKRAAAS 142

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E+  +  ++ FLG+ +SA   VG+ G V G+M  F  I    + N+      I E+LI+ 
Sbjct: 143 EVTALERQVPFLGTTASAAPFVGLFGTVWGIMRAFHEIYLMGNANLATVAKPISEALIAT 202

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +GL  +IP+ +AYN F+   +    +M  F+N+F  I+ R 
Sbjct: 203 AVGLFAAIPAVVAYNFFLSKIRVLDSEMTNFSNDFLNIVRRH 244


>gi|254463470|ref|ZP_05076886.1| protein TolQ [Rhodobacterales bacterium HTCC2083]
 gi|206680059|gb|EDZ44546.1| protein TolQ [Rhodobacteraceae bacterium HTCC2083]
          Length = 231

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 84/219 (38%), Positives = 130/219 (59%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ALF++  + VK ++ +L + SI +WS+++QK + + T R +  EF+Q FWSG+ 
Sbjct: 12  IDFSMWALFVRATITVKLVMIMLIVASIWAWSIVVQKYMQYRTARSEQAEFDQAFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    N     IF + M+EW++S         G Q RIDR MDVAI++E EE+
Sbjct: 72  LDQLFEQIGAQPNGASEKIFAAGMTEWRRSHRVDGGLIAGAQSRIDRSMDVAISKEAEEL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 QSGLSVLATVGSTAPFVGLFGTVWGIMNAFIEIAEAQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNKF  DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIYYNKFSADSDRIVGGYEAFADEFATILSRQLD 230


>gi|113868499|ref|YP_726988.1| biopolymer transport protein [Ralstonia eutropha H16]
 gi|113527275|emb|CAJ93620.1| biopolymer transport protein [Ralstonia eutropha H16]
          Length = 242

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 44/217 (20%), Positives = 91/217 (41%), Gaps = 3/217 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+ +  L+ Q    ++    +L I S+ SW VI+ K+ + + L++     E+ FW   
Sbjct: 1   MQDLGLSHLWTQGDFVMRATAIILLIMSLASWIVILTKAWDLVRLKKMAHGAEKRFWHSD 60

Query: 68  SLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +   ++L    +     + ++    ++  ++        + I D + R +  +I   +
Sbjct: 61  DFDHALETLGAGDSNPFRTLAIAGKEAAQHHRASQPQLHDVMDISDWLTRSLKSSIDDSV 120

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILL 184
             +   L+ L S+ S    VG+ G V G+      I       +      + E+LI    
Sbjct: 121 AHMQSGLAVLASVGSTAPFVGLFGTVWGIYHALIGIGASGVPTIDKVAGPVGEALIMTAF 180

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 181 GLAVAIPAVLGYNALTRGNKSVISKLNRFAHDLHAYF 217


>gi|239947582|ref|ZP_04699335.1| protein TolQ [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921858|gb|EER21882.1| protein TolQ [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 241

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I  K      ++R+ + FE +FWSG  LE + +S+K   N  
Sbjct: 32  GKSVMLMLLIASIWSWAIIWDKIFKLAQVQRRMKNFENVFWSGGVLEQLYESIKRSVNNP 91

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI   M +A  RE+E++ + LSFL ++ S+
Sbjct: 92  LALIFVSAMDECKSLSIKGLSDALKNNHKERITNSMYLAQNREVEKLEKNLSFLATVGSS 151

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 152 APFVGLFGTVWGIMHSFQSIANSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 211

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 212 SRITLINNKIEDFISELNSILSKAID 237


>gi|209522409|ref|ZP_03271017.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. H160]
 gi|209497152|gb|EDZ97399.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. H160]
          Length = 256

 Score =  151 bits (382), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 96/228 (42%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M +YGLA        ++    +  + I+ +L I S+LSW+VII K    I LRR  R  +
Sbjct: 1   MQHYGLA-------NVWDSGDIVTRGILCVLVIMSVLSWTVIIVKLWQLIRLRRVTRHSD 53

Query: 61  QLFWSGQSLETVCKSLKNH----HNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRID 114
             FWS    +    +L +     H+  L A+ ++        +   +     I + D I 
Sbjct: 54  ARFWSADRFDDGLHALGHPESNAHDNPLLALALAGHEAATHHRQTQQHLHDRIDVSDWIT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+      I      ++     
Sbjct: 114 RRLQDTMDETIARLQSGLAILASIGSTAPFVGLFGTVWGIYHALIVIGETGQTSIDHVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + ESLI    GL V+IP+ + YN     ++    +++ FA+   A  
Sbjct: 174 PVGESLIMTAFGLFVAIPAVLGYNGLTRANRSIVARLKRFAHGLHAYF 221


>gi|312115235|ref|YP_004012831.1| tonB-system energizer ExbB [Rhodomicrobium vannielii ATCC 17100]
 gi|311220364|gb|ADP71732.1| tonB-system energizer ExbB [Rhodomicrobium vannielii ATCC 17100]
          Length = 311

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 96/224 (42%), Gaps = 2/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             ++S   +F    + VK ++  L + S L+W+V   K+      RR  +       S  
Sbjct: 79  PHELSPLGMFHAADVVVKTVMIALMLASFLTWTVFFAKTAELWAARRGLKAAIMSIDSAP 138

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SL+   +++      G  A+  + + E ++S   G     G+++R+   +  A AR    
Sbjct: 139 SLDAAAEAVAQTKGPGAVAVAEA-VREVQRSRTLGNPDKDGVKERVASRLSRAEARASRH 197

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +   +  + ++ S    VG+ G V G+M  F  I+   + N+  +   I E+L++  LGL
Sbjct: 198 VMVGIGIVATIGSVAPFVGLFGTVWGIMNAFIGISKAQTTNLAVVAPGIAEALLATALGL 257

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++S   +   +
Sbjct: 258 VAAIPAVVVYNAFARQITDYRQLLADASAAVERLVSFDLDARCT 301


>gi|119472452|ref|ZP_01614551.1| inner membrane protein [Alteromonadales bacterium TW-7]
 gi|119444889|gb|EAW26188.1| inner membrane protein [Alteromonadales bacterium TW-7]
          Length = 234

 Score =  151 bits (382), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 62/222 (27%), Positives = 110/222 (49%), Gaps = 3/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++   L ++  L V+ ++  L   S++SW++I Q+           ++FEQ FWSG  L 
Sbjct: 5   LNFLDLILEASLLVQLVMLGLVAMSVMSWAIIFQRKKAISDALSNAKKFEQKFWSGIDLS 64

Query: 71  TVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +   + +    + G+ A+F +   E+ +      +    + +   R M VA++RE+E+I
Sbjct: 65  KLYNEISSRSAQSHGIEALFTAGFKEFARHKKNTFQGASIVMEGTHRSMRVALSREIEKI 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + LSFL ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 125 EKSLSFLATVGSISPYIGLFGTVWGIMNAFIALGEVKQATLQMVAPGIAEALIATAMGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            +IP+ IAYN+F    +K       F  EF+ IL RQ    I
Sbjct: 185 AAIPAVIAYNRFSNSVEKLESHYINFMEEFANILHRQAATQI 226


>gi|262277493|ref|ZP_06055286.1| protein TolQ [alpha proteobacterium HIMB114]
 gi|262224596|gb|EEY75055.1| protein TolQ [alpha proteobacterium HIMB114]
          Length = 225

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 67/213 (31%), Positives = 120/213 (56%), Gaps = 4/213 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D S + LF +    VK +I +L   SI SW++I +K   F  + +   EFE+ F + +S+
Sbjct: 16  DFSFWTLFTRADFIVKSVIIMLIAASIYSWALIFEKYKIFKKIFKSSDEFEEEFLNSKSV 75

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +T+ +   +  +  +  +F S  +   ++    ++S   + +++ R+MDVAI +E+E+  
Sbjct: 76  KTLFEKTSSDTDDPMTVVFRSGANYLMQNK---SQSQTVLTEKVKRVMDVAIDKEVEKYE 132

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
            KL+FL ++ S    +G+ G V G+M  FQSIA   + ++  +   I E+L +  LGL  
Sbjct: 133 NKLTFLATVGSVAPFIGLFGTVWGIMNSFQSIAISRNTSLAIVAPGIAEALFATALGLLA 192

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           +IP+ +AYNKF   S+KF  ++E F   F +I+
Sbjct: 193 AIPAVVAYNKFTSSSRKFTQKLENFTQTFLSII 225


>gi|161525753|ref|YP_001580765.1| protein TolQ [Burkholderia multivorans ATCC 17616]
 gi|189349525|ref|YP_001945153.1| biopolymer transport protein [Burkholderia multivorans ATCC 17616]
 gi|221201009|ref|ZP_03574049.1| protein TolQ [Burkholderia multivorans CGD2M]
 gi|221206539|ref|ZP_03579552.1| protein TolQ [Burkholderia multivorans CGD2]
 gi|221214393|ref|ZP_03587364.1| protein TolQ [Burkholderia multivorans CGD1]
 gi|160343182|gb|ABX16268.1| protein TolQ [Burkholderia multivorans ATCC 17616]
 gi|189333547|dbj|BAG42617.1| biopolymer transport protein [Burkholderia multivorans ATCC 17616]
 gi|221165650|gb|EED98125.1| protein TolQ [Burkholderia multivorans CGD1]
 gi|221173848|gb|EEE06282.1| protein TolQ [Burkholderia multivorans CGD2]
 gi|221178859|gb|EEE11266.1| protein TolQ [Burkholderia multivorans CGD2M]
          Length = 225

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPGLVLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLESNLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|237729936|ref|ZP_04560417.1| biopolymer transporter ExbB [Citrobacter sp. 30_2]
 gi|226908542|gb|EEH94460.1| biopolymer transporter ExbB [Citrobacter sp. 30_2]
          Length = 244

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 51/226 (22%), Positives = 105/226 (46%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KS+ F T +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSLEFFTQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+   +         L A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASEIAAGFDGKSLGAQLINEAQNELELS-EGSDDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGSYKAMLGDVAAQVLLLQSRDLDLNAS 229


>gi|226943196|ref|YP_002798269.1| tonB-system proton channel, ExbB [Azotobacter vinelandii DJ]
 gi|226718123|gb|ACO77294.1| tonB-system proton channel, ExbB [Azotobacter vinelandii DJ]
          Length = 359

 Score =  151 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 54/223 (24%), Positives = 107/223 (47%), Gaps = 5/223 (2%)

Query: 5   GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFW 64
           GLA  D+S + ++    + VK ++  L + S+++W++ + K +  +  RR+ +       
Sbjct: 122 GLA-HDLSPWGMYQNADIVVKGVMIGLLLASVVTWTIWMAKGLELLGARRRLQRSLADIK 180

Query: 65  SGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             ++L+     L +  N   A +   A  E + S   G     GI++R+   ++  +A  
Sbjct: 181 GLRTLDQASA-LPSGENCLRAKLIADAREELQLSA--GTIDKDGIKERVSFRLERLVAEC 237

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISIL 183
             +++     L ++ S    VG+ G V G+M  F  IA   + N+  + PGI E+L++  
Sbjct: 238 GRKMSVGTGVLATIGSTSPFVGLFGTVWGIMNSFIGIAKSQTTNLAVVAPGIAEALLATA 297

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +GL  +IP+ I YN F      +  Q+   ++E   ++SR  +
Sbjct: 298 IGLVAAIPAVIIYNVFARSIAAYKAQVANLSSEVLLLVSRDLD 340


>gi|330812607|ref|YP_004357069.1| transporter [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380715|gb|AEA72065.1| putative transporter [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 323

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 102/226 (45%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 86  NSLGMA-HDLSPWGMYKNADIIVKIVMIGLAIASIITWTIWIAKGFELLGAKRRLRGEIA 144

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                 +L+    +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 145 ALKKATTLKEASATAA--KAGTLANLLVHDALEEMRLS-ANSREKEGIKERVSFRLERLV 201

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 202 AACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 261

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   + E   ++SR  +
Sbjct: 262 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAEVLLLVSRDLD 307


>gi|323163896|gb|EFZ49706.1| protein TolQ [Shigella sonnei 53G]
 gi|323170858|gb|EFZ56508.1| protein TolQ [Escherichia coli LT-68]
 gi|332768164|gb|EGJ98349.1| protein TolQ [Shigella flexneri 2930-71]
          Length = 222

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 64/213 (30%), Positives = 109/213 (51%), Gaps = 3/213 (1%)

Query: 16  LFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKS 75
           +F++  L VK I+ +L  FSI SW++IIQ++       R+   FE  FWSG  L  + + 
Sbjct: 1   MFLKASLLVKLIMLILIGFSIASWAIIIQRTRILNAAAREAEAFEDKFWSGIELSRLYQE 60

Query: 76  LKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLS 133
            +   +   G   IF S   E+ +     + +P  + +   R M +++ RELE +   + 
Sbjct: 61  SQGKRDNLTGSEQIFYSGFKEFVRLHRANSHAPEAVVEGASRAMRISMNRELENLETHIP 120

Query: 134 FLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPS 192
           FLG++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL  +IP+
Sbjct: 121 FLGTVGSISPYIGLFGTVWGIMHAFIALGAVKQATLQMVAPGIAEALIATAIGLFAAIPA 180

Query: 193 SIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            +AYN+  +   K  +  + F  EF+AIL RQ 
Sbjct: 181 VMAYNRLNQRVNKLELNYDNFMEEFTAILHRQA 213


>gi|91205080|ref|YP_537435.1| hypothetical protein RBE_0265 [Rickettsia bellii RML369-C]
 gi|157827583|ref|YP_001496647.1| hypothetical protein A1I_06470 [Rickettsia bellii OSU 85-389]
 gi|91068624|gb|ABE04346.1| TolQ [Rickettsia bellii RML369-C]
 gi|157802887|gb|ABV79610.1| TolQ [Rickettsia bellii OSU 85-389]
          Length = 241

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K    + ++R+ R FE  FWSG  LE +  S+K   N  
Sbjct: 32  GKSVMLMLLIASIWSWAIILDKVFKLMQVQRKMRAFENTFWSGGVLEQLYDSIKRSVNNP 91

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI   M +A  RE+E++ + LSFL ++ S+
Sbjct: 92  LALIFVSAMDECKSINTKGLPELLKNNHKERITNSMYLAQNREIEKLEKNLSFLATVGSS 151

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              +G+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 152 SPFIGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 211

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 212 SRITLINNKIEDFISELNSILSKAID 237


>gi|260599390|ref|YP_003211961.1| biopolymer transport protein ExbB [Cronobacter turicensis z3032]
 gi|260218567|emb|CBA33808.1| Biopolymer transport protein exbB [Cronobacter turicensis z3032]
          Length = 239

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 98/220 (44%), Gaps = 4/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VK ++  L + S+++W++   KSV     +R+ +  +Q     ++
Sbjct: 3   TDLSVWGMYQHADIVVKIVMIGLILASVVTWAIFFSKSVELSGHKRRLKREQQELAGART 62

Query: 69  LETVCKSLKNH-HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           L+   +  +        A +   A +E  +    G     GI++R    ++  +A     
Sbjct: 63  LDDAREMAERFGPKSLSARLIEEAQNE--RELSAGCEDNEGIKERTGFRLERRVAAAGRH 120

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL
Sbjct: 121 MGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQSQTTNLAVVAPGIAEALLATAIGL 180

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 181 IAAIPAVVIYNIFARTIGGYKATLGDVAAQVLLLQSRDLD 220


>gi|161506270|ref|YP_001573382.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867617|gb|ABX24240.1| hypothetical protein SARI_04465 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 239

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 49/223 (21%), Positives = 103/223 (46%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F + +R+ +  +Q     +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFSQKRRLKHEQQQLVDARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+             L+A  ++      +   +G+    GI++R    ++  +A     +
Sbjct: 63  LDQAADIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVGRYM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 224


>gi|134294847|ref|YP_001118582.1| MotA/TolQ/ExbB proton channel [Burkholderia vietnamiensis G4]
 gi|134138004|gb|ABO53747.1| Cell division and transport-associated protein TolQ [Burkholderia
           vietnamiensis G4]
          Length = 225

 Score =  151 bits (381), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFEKDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF + M E+ K+ +K    P  + D   R M  A  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFEAGMREFLKAKEKRLSDPGLVLDGARRAMRAAFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|330875931|gb|EGH10080.1| tolQ protein [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 236

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 56/220 (25%), Positives = 107/220 (48%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++++ L     L VK ++ +L + S++SW +I+Q+S+      R    F+Q F S   L 
Sbjct: 8   MTVWGLISDASLLVKAVMLILLLASLVSWFLIVQRSLALRHYERSLDAFQQRFRSEAELA 67

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +          + G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLYAQASSAQSDSGGIGPVFQAGYAEYMQLKHRPGIDPDVVLSGVERSLQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNRFAARGQTLTARYYTFGNELQVRLNRTLQG 227


>gi|15892345|ref|NP_360059.1| tolQ protein [Rickettsia conorii str. Malish 7]
 gi|34580648|ref|ZP_00142128.1| tolQ protein [Rickettsia sibirica 246]
 gi|229586571|ref|YP_002845072.1| TolQ [Rickettsia africae ESF-5]
 gi|15619491|gb|AAL02960.1| tolQ protein [Rickettsia conorii str. Malish 7]
 gi|28262033|gb|EAA25537.1| tolQ protein [Rickettsia sibirica 246]
 gi|228021621|gb|ACP53329.1| TolQ [Rickettsia africae ESF-5]
          Length = 241

 Score =  151 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 116/206 (56%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K    + +++  R FE +FWSG  LE + +S+K   N  
Sbjct: 32  GKSVMLMLLIASIWSWAIILDKIFKLVQVQKSMRAFENVFWSGGVLEQLYESIKRSVNNP 91

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI   M +A  RE+E++ + LSFL ++ S+
Sbjct: 92  LALIFVSAMDECKSLSTKGLSEGLKNNHKERITGAMYLAQNREVEKLEKNLSFLATVGSS 151

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 152 APFVGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 211

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 212 SRITLINNKIEDFISELNSILSKAID 237


>gi|209695362|ref|YP_002263291.1| TolQ protein, inner membrane component [Aliivibrio salmonicida
           LFI1238]
 gi|208009314|emb|CAQ79580.1| TolQ protein, inner membrane component [Aliivibrio salmonicida
           LFI1238]
          Length = 228

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 110/222 (49%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++SI  LF+   L VK ++ +L   S++SW++I ++S            FE  FWSG  L
Sbjct: 4   ELSILDLFLHASLLVKIVMLILLSLSVMSWAMIFKRSKVLAVAHTDAERFESKFWSGMDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   +K   +   G   IF S  +E+ +     + S   + D   R M V ++RE+++
Sbjct: 64  AQLFNEVKVRKDRISGTEKIFYSGFNEFARLSRVNSSSSEAVMDGTIRSMRVTVSREVDD 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G V G+M  F ++       + +  PGI E+L++  +GL
Sbjct: 124 LETNLPFLATVGSITPYIGLFGTVWGIMHSFIALGAVKQATLAMVAPGIAEALVATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ IAYN+      K       F +EFS+IL RQ   +
Sbjct: 184 FAAIPAVIAYNQLSVKVGKLEHNYAAFMDEFSSILHRQAMAS 225


>gi|262193461|ref|YP_003264670.1| protein TolQ [Haliangium ochraceum DSM 14365]
 gi|262076808|gb|ACY12777.1| protein TolQ [Haliangium ochraceum DSM 14365]
          Length = 232

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 105/220 (47%), Gaps = 2/220 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   + + +L +Q    VK ++ LL + SI+ W +I  K ++     ++  +F + FW  
Sbjct: 10  AAGQLDLASLILQAHWVVKAVMALLALMSIIGWYIIGSKHIHIRRATKESNKFLESFWRT 69

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKK--SCDKGARSPIGIQDRIDRMMDVAIARE 124
           + +E + K  K   N  ++A+F++  +E  K  + ++  R      + ++R +      E
Sbjct: 70  RDIEQIYKQAKGLQNSPISAMFLAGYTELAKLEADERPTRDKEADLENVERALRRTQTIE 129

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLISILL 184
             ++   + FL +  SA   +G+ G V G+M  F S+    +N     PGI E+L +  +
Sbjct: 130 TTKLENMIPFLATTGSAAPFIGLFGTVWGIMNSFTSLGSGAANIQTVAPGIAEALFATAI 189

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           GL  +IP+ +AYN F    +     M  F  ++  I+ R 
Sbjct: 190 GLVAAIPAVMAYNYFTRRIRIQVSHMNTFEQDYLNIIRRH 229


>gi|157828297|ref|YP_001494539.1| tolQ protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165933001|ref|YP_001649790.1| TolQ [Rickettsia rickettsii str. Iowa]
 gi|13235464|emb|CAC33699.1| TolQ protein [Rickettsia rickettsii]
 gi|157800778|gb|ABV76031.1| tolQ protein [Rickettsia rickettsii str. 'Sheila Smith']
 gi|165908088|gb|ABY72384.1| TolQ [Rickettsia rickettsii str. Iowa]
          Length = 241

 Score =  151 bits (380), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K    + +++  R FE +FWSG  LE + +S+K   N  
Sbjct: 32  GKSVMLMLLIASIWSWAIILDKIFKLVQVQKSMRAFENVFWSGGVLEQLYESIKRSVNNP 91

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI  +M +A  RE+E++ + LSFL ++ S+
Sbjct: 92  LALIFVSAMDECKSLSTKGLSESLKNNHKERITGVMYLAQNREVEKLEKNLSFLATVGSS 151

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 152 APFVGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 211

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 212 SRITLINNKIEDFISELNSILSKAID 237


>gi|149915617|ref|ZP_01904143.1| MotA/TolQ/ExbB proton channel [Roseobacter sp. AzwK-3b]
 gi|149810509|gb|EDM70352.1| MotA/TolQ/ExbB proton channel [Roseobacter sp. AzwK-3b]
          Length = 231

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 76/219 (34%), Positives = 119/219 (54%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD S++ L+ +  + VK ++ +L I S  +WS+IIQK + +   R     F++ FWSG+ 
Sbjct: 12  MDFSLWGLYARATIIVKLVMWMLVIASFWAWSIIIQKIILYRKARADAAAFDRRFWSGEP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ +   +    +     IF + M EW++S         G   RIDR MDVAI++E EE+
Sbjct: 72  LDELFDEIGPEPSGRSERIFAAGMMEWRRSHRNDGGLIAGATARIDRSMDVAISKETEEL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              L  L ++ S    +G+ G V G+M  F  IA   + ++  +   I E+L++  LGL 
Sbjct: 132 QSSLQILATIGSTTPFIGLFGTVWGIMNAFIEIAEQQNTSLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS +     E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSSDSDRIVGSYEAFADEFATILSRQLD 230


>gi|206561544|ref|YP_002232309.1| putative TolQ transport transmembrane protein [Burkholderia
           cenocepacia J2315]
 gi|198037586|emb|CAR53524.1| putative TolQ transport transmembrane protein [Burkholderia
           cenocepacia J2315]
 gi|325522826|gb|EGD01298.1| putative TolQ transport transmembrane protein [Burkholderia sp.
           TJI49]
          Length = 225

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFEKDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPGLVLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|107021878|ref|YP_620205.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia AU 1054]
 gi|116688826|ref|YP_834449.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia HI2424]
 gi|170732125|ref|YP_001764072.1| protein TolQ [Burkholderia cenocepacia MC0-3]
 gi|254246217|ref|ZP_04939538.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia PC184]
 gi|105892067|gb|ABF75232.1| Cell division and transport-associated protein TolQ [Burkholderia
           cenocepacia AU 1054]
 gi|116646915|gb|ABK07556.1| Cell division and transport-associated protein TolQ [Burkholderia
           cenocepacia HI2424]
 gi|124870993|gb|EAY62709.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia PC184]
 gi|169815367|gb|ACA89950.1| protein TolQ [Burkholderia cenocepacia MC0-3]
          Length = 225

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 119/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
           + D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   VQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFEKDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLSDPGLVLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|194444554|ref|YP_002042424.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194403217|gb|ACF63439.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 244

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 103/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +     
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+             L+A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|261855151|ref|YP_003262434.1| protein TolQ [Halothiobacillus neapolitanus c2]
 gi|261835620|gb|ACX95387.1| protein TolQ [Halothiobacillus neapolitanus c2]
          Length = 225

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/224 (28%), Positives = 111/224 (49%), Gaps = 3/224 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             + S+  L +   L V+ ++ +L + S+ SW++I  KS      R Q + FE+ FWSG 
Sbjct: 2   STEPSVMHLVLGASLPVQLVLLILLLASVASWALIFHKSSLLRRARAQAKRFEESFWSGG 61

Query: 68  SLETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           SL      +        G  AIF +   E+K+      RS   + + ++R M V + R++
Sbjct: 62  SLNDFYDRISRDPRPREGQEAIFEAGFREFKRLRQIEGRSSSELLEGVERAMRVTLHRQI 121

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           ++  E LS L ++ S    VG+ G V G+M  F ++    +  +    P I E+LI+  +
Sbjct: 122 DKFEEGLSVLATIGSVSPYVGLFGTVWGIMSAFMNLGNAQNATLATVAPPIAEALIATAM 181

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           GL  +IP+ +AYN++     +   + + F +EF  +L RQ  G 
Sbjct: 182 GLFAAIPAVVAYNRYSTQIDELFGRYDRFTDEFLGLLQRQIGGQ 225


>gi|222106934|ref|YP_002547725.1| tonB-system energizer ExbB [Agrobacterium vitis S4]
 gi|221738113|gb|ACM39009.1| tonB-system energizer ExbB [Agrobacterium vitis S4]
          Length = 341

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 96/221 (43%), Gaps = 1/221 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
              D+S   +FM     VK ++  L + S+ +W++++ K++     + + R    +    
Sbjct: 103 IPHDLSPVGMFMAADWVVKSVMIALGLASVATWTILLVKTLQLSGSKARLRRGLAVLQEA 162

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           +SL     +L+         + ++A                G+++R+   +    +R   
Sbjct: 163 RSLSQAAGALQKRRGTVPDMLLIAARELKLSEPALDYAGNDGVKERVSSALSRIESRAGR 222

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISILLG 185
            +T     L ++ S G  VG+ G V G+M  F  I+   + N+  + PGI E+L++  +G
Sbjct: 223 RMTAGTGILATIGSIGPFVGLFGTVWGIMNSFIGISQSQTTNLAVVAPGIAEALLATAIG 282

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ + YN F      +  Q+   A     ++SR  +
Sbjct: 283 LVAAIPAVVIYNVFARAVTGYRQQLLDAATAVERLVSRDLD 323


>gi|90580124|ref|ZP_01235932.1| Putative TolQ protein [Vibrio angustum S14]
 gi|90439009|gb|EAS64192.1| Putative TolQ protein [Vibrio angustum S14]
          Length = 229

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/219 (27%), Positives = 107/219 (48%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++++  + +  G     ++ +L   SI SW++II++S       R+  +FE  FWSG  L
Sbjct: 4   ELTVLDIILNSGALEIMVMLILLGMSIASWTMIIKRSQVLSEASRKATQFEDRFWSGIDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K ++   +   G   IF S   E+ +      + P  + +   R M V++++E++E
Sbjct: 64  SQLYKEVQARKDDLTGSEQIFYSGFKEFARLHRSNDKVPEAVMEGTSRAMRVSLSKEVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G VLG+M  F ++       +    PGI  +LI+  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVLGIMTAFIALGAMKQPTLATVAPGIAGALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ + YN+      K       F  EFS+IL RQ 
Sbjct: 184 FAAIPAVMFYNRLTNKVSKLEHTYATFMEEFSSILHRQA 222


>gi|157148574|ref|YP_001455893.1| biopolymer transport protein ExbB [Citrobacter koseri ATCC BAA-895]
 gi|157085779|gb|ABV15457.1| hypothetical protein CKO_04401 [Citrobacter koseri ATCC BAA-895]
          Length = 239

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 102/223 (45%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KS+ F T +R+ +  +Q     +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSLEFFTQKRRLKREQQQLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+             L++  +       +   +G+    GI++R    ++  +A     +
Sbjct: 63  LDQASNIASAFAAKSLSSQLLYEAQNELELS-EGSEDNEGIKERTGFRLERRVAAVGRHM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNIFARQIGSYKATLGDVAAQILLLQSRDLDLNAS 224


>gi|294341041|emb|CAZ89436.1| Protein tolQ [Thiomonas sp. 3As]
          Length = 250

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 73/220 (33%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            + SI ++ +   + V+ ++ LL   S+ SW+VI +K     + R +  +FEQ FWSG  
Sbjct: 3   QNFSIVSMVLGASIVVQLVLALLLSVSLASWTVIFRKYFAIKSARVKSEDFEQEFWSGTG 62

Query: 69  LETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  + +S      H   L  IF S M E+ K  ++       + D   R M  A  RE++
Sbjct: 63  LNDLYQSALSNGRHGSPLQRIFASGMREYLKLRERHVLDGSTLVDGARRAMRAAFQREMD 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +   LSFL S+ S    VG+ G V G+M  F  ++      +    PGI E+L++  +G
Sbjct: 123 ALEANLSFLASVGSVSPYVGLFGTVWGIMHAFVGLSNLQQVTLATVAPGIAEALVATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IP+ IAYN F  D  + A + E F  EFS IL RQ+
Sbjct: 183 LFAAIPAVIAYNFFARDIDRLANRYESFTEEFSNILQRQS 222


>gi|170701070|ref|ZP_02892047.1| protein TolQ [Burkholderia ambifaria IOP40-10]
 gi|171322374|ref|ZP_02911195.1| protein TolQ [Burkholderia ambifaria MEX-5]
 gi|172059757|ref|YP_001807409.1| protein TolQ [Burkholderia ambifaria MC40-6]
 gi|170134010|gb|EDT02361.1| protein TolQ [Burkholderia ambifaria IOP40-10]
 gi|171092302|gb|EDT37674.1| protein TolQ [Burkholderia ambifaria MEX-5]
 gi|171992274|gb|ACB63193.1| protein TolQ [Burkholderia ambifaria MC40-6]
          Length = 225

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRLTDPGLVLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|238909959|ref|ZP_04653796.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
          Length = 244

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 103/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +     
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+             L+A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDIATGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|89075794|ref|ZP_01162182.1| Putative TolQ protein [Photobacterium sp. SKA34]
 gi|89048526|gb|EAR54101.1| Putative TolQ protein [Photobacterium sp. SKA34]
          Length = 229

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 60/219 (27%), Positives = 106/219 (48%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++++  + +  G     ++ +L   SI SW++II++S       R+   FE  FWSG  L
Sbjct: 4   ELTVLDIILNSGALEIMVMLILLGMSIASWTMIIKRSQVLSEASRKATNFEDRFWSGIDL 63

Query: 70  ETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + K ++   +   G   IF S   E+ +      + P  + +   R M V++++E++E
Sbjct: 64  SQLYKEVQARKDDLTGSEQIFYSGFKEFARLHRSNDKVPEAVMEGTSRAMRVSLSKEVDE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    +G+ G VLG+M  F ++       +    PGI  +LI+  +GL
Sbjct: 124 LETNLPFLATVGSISPYIGLFGTVLGIMTAFIALGAMKQPTLATVAPGIAGALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ + YN+      K       F  EFS+IL RQ 
Sbjct: 184 FAAIPAVMFYNRLTNKVSKLEHTYATFMEEFSSILHRQA 222


>gi|254787338|ref|YP_003074767.1| protein TolQ [Teredinibacter turnerae T7901]
 gi|237685839|gb|ACR13103.1| protein TolQ [Teredinibacter turnerae T7901]
          Length = 229

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 73/223 (32%), Positives = 121/223 (54%), Gaps = 5/223 (2%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  L +   L V+ ++ LLF+ S +SW +I+Q+ +     R+ FREFE  FWSG  L 
Sbjct: 6   LSILNLVLNASLLVQLVMLLLFMASAVSWVMIVQRGMYQGRARQAFREFESQFWSGIDLT 65

Query: 71  TVCKS----LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            + +        H   G+  IF +   E+ +   +G+  P  I +   R M VA +RE E
Sbjct: 66  QLYRQGNSGANKHSTDGIENIFRAGFKEFTRLRQQGSTDPDAIMEGTQRAMRVAHSREEE 125

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
           ++   L FL S++S    +G+ G V G+M  F+ +A  +   +    PGI E+L++  +G
Sbjct: 126 KLEANLPFLASVASVSPYIGLFGTVWGIMNSFRGLANVHQATLATVAPGISEALVATAMG 185

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP+ +AYN+F  ++++   + + FA EFS+IL RQ    
Sbjct: 186 LFAAIPAVLAYNRFSANAEQLTGKYQTFAEEFSSILHRQVHAK 228


>gi|332534225|ref|ZP_08410070.1| inner membrane protein required for outer membrane integrity,
           uptake of group A colicins and phage DNA
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036305|gb|EGI72776.1| inner membrane protein required for outer membrane integrity,
           uptake of group A colicins and phage DNA
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 234

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 63/222 (28%), Positives = 110/222 (49%), Gaps = 3/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++   L ++  L V+ ++  L   S++SW++I Q+           ++FEQ FWSG  L 
Sbjct: 5   LNFLDLILEASLLVQLVMLGLVAMSVMSWTIIFQRKKAISDALINAKKFEQKFWSGIDLS 64

Query: 71  TVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +   + +    + G+ A+F S   E+ +      +S   + +   R M VA++RE+E++
Sbjct: 65  KLYNEISSRSGQSQGIEALFTSGFKEFARHKKNTFQSASIVMEGTHRSMRVALSREIEKM 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LSFL ++ S    +G+ G V G+M  F ++       +  +   I E+LI+  +GL 
Sbjct: 125 ESSLSFLATVGSISPYIGLFGTVWGIMNAFIALGEVKQATLQMVAPGIAEALIATAMGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
            +IP+ IAYN+F    +K       F  EF+ IL RQ    I
Sbjct: 185 AAIPAVIAYNRFSNSVEKLESHYINFMEEFANILHRQAATQI 226


>gi|16761935|ref|NP_457552.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16766459|ref|NP_462074.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29143422|ref|NP_806764.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161616141|ref|YP_001590106.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167551932|ref|ZP_02345685.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167990296|ref|ZP_02571396.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231752|ref|ZP_02656810.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238112|ref|ZP_02663170.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168242979|ref|ZP_02667911.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168262888|ref|ZP_02684861.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463637|ref|ZP_02697554.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194451250|ref|YP_002047155.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194470700|ref|ZP_03076684.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194733979|ref|YP_002116115.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197249773|ref|YP_002148081.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197266007|ref|ZP_03166081.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|198244982|ref|YP_002217137.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200387183|ref|ZP_03213795.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204927984|ref|ZP_03219184.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205354076|ref|YP_002227877.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207858418|ref|YP_002245069.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213028805|ref|ZP_03343252.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213161298|ref|ZP_03347008.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213424365|ref|ZP_03357189.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647425|ref|ZP_03377478.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213851960|ref|ZP_03381492.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|289825772|ref|ZP_06544940.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|60392257|sp|P0A1H7|EXBB_SALTY RecName: Full=Biopolymer transport protein exbB
 gi|60392258|sp|P0A1H8|EXBB_SALTI RecName: Full=Biopolymer transport protein exbB
 gi|25301393|pir||AF0886 biopolymer transport ExbB protein STY3332 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16421714|gb|AAL22033.1| uptake of enterochelin [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16504237|emb|CAD02990.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139056|gb|AAO70624.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|161365505|gb|ABX69273.1| hypothetical protein SPAB_03943 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409554|gb|ACF69773.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194457064|gb|EDX45903.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194709481|gb|ACF88702.1| TonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633697|gb|EDX52111.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197213476|gb|ACH50873.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197244262|gb|EDY26882.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197289035|gb|EDY28406.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939498|gb|ACH76831.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199604281|gb|EDZ02826.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|204322306|gb|EDZ07503.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205273857|emb|CAR38857.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205323313|gb|EDZ11152.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205331187|gb|EDZ17951.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333747|gb|EDZ20511.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205337928|gb|EDZ24692.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205348481|gb|EDZ35112.1| tonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206710221|emb|CAR34578.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|261248289|emb|CBG26126.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267995343|gb|ACY90228.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159713|emb|CBW19232.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312914183|dbj|BAJ38157.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321225836|gb|EFX50890.1| MotA/TolQ/ExbB proton channel family protein [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322613561|gb|EFY10502.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322621153|gb|EFY18011.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322624216|gb|EFY21050.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628045|gb|EFY24834.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633164|gb|EFY29906.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322636259|gb|EFY32967.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639377|gb|EFY36066.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322647472|gb|EFY43961.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322648655|gb|EFY45102.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653709|gb|EFY50035.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322657816|gb|EFY54084.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663918|gb|EFY60117.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669070|gb|EFY65221.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672935|gb|EFY69042.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678073|gb|EFY74136.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322681250|gb|EFY77283.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687820|gb|EFY83787.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323131517|gb|ADX18947.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195631|gb|EFZ80808.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199687|gb|EFZ84777.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202565|gb|EFZ87605.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207947|gb|EFZ92893.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323212500|gb|EFZ97317.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215017|gb|EFZ99765.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222747|gb|EGA07112.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224171|gb|EGA08464.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323230496|gb|EGA14614.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235153|gb|EGA19239.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323239193|gb|EGA23243.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244450|gb|EGA28456.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247065|gb|EGA31031.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253453|gb|EGA37282.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323256241|gb|EGA39977.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262584|gb|EGA46140.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267321|gb|EGA50805.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269276|gb|EGA52731.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326629193|gb|EGE35536.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332990024|gb|AEF09007.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 244

 Score =  150 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 103/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +     
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+             L+A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|330968208|gb|EGH68468.1| tolQ protein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 236

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 108/220 (49%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++++ L     L VK ++ +L + S++SW +I+Q+S+      R    F+Q F S   L 
Sbjct: 8   MTVWGLVSDASLLVKAVMLILLLASLVSWFLIVQRSLALRHYERSLDAFQQRFRSEAELA 67

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +          + G+ +IF +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLYAQASSAQSDSGGIGSIFQAGYAEYVQLKHRPGIDPDVVLSGVERSLQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNRFAARGQTLTARYYTFGNELQVRLNRTLQG 227


>gi|28870405|ref|NP_793024.1| tolQ protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213969870|ref|ZP_03398004.1| tolQ protein [Pseudomonas syringae pv. tomato T1]
 gi|301386269|ref|ZP_07234687.1| tolQ protein [Pseudomonas syringae pv. tomato Max13]
 gi|302063955|ref|ZP_07255496.1| tolQ protein [Pseudomonas syringae pv. tomato K40]
 gi|302135263|ref|ZP_07261253.1| tolQ protein [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28853652|gb|AAO56719.1| tolQ protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213925418|gb|EEB58979.1| tolQ protein [Pseudomonas syringae pv. tomato T1]
          Length = 236

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 108/220 (49%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++++ L     L VK ++ +L + S++SW +I+Q+S+      R    F+Q F S   L 
Sbjct: 8   MTVWGLISDASLLVKAVMLILLLASLVSWFLIVQRSLALRHYERSLDAFQQRFRSEAELA 67

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +          + G+ +IF +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLYAQASSAQSDSGGIGSIFQAGYAEYMQLKHRPGIDPDVVLSGVERSLQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNRFAARGQTLTARYYTFGNELQVRLNRTLQG 227


>gi|306841382|ref|ZP_07474085.1| tonB-system energizer ExbB [Brucella sp. BO2]
 gi|306288567|gb|EFM59916.1| tonB-system energizer ExbB [Brucella sp. BO2]
          Length = 329

 Score =  150 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 95  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKVIGHSA 154

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 155 TLNDAVHALDGMKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 214

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 215 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 274

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 275 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 318


>gi|23502525|ref|NP_698652.1| biopolymer transport protein ExbB [Brucella suis 1330]
 gi|23348523|gb|AAN30567.1| biopolymer transport protein ExbB [Brucella suis 1330]
          Length = 292

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 58  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 117

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 118 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 177

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 178 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 237

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 238 VAAIPAVVIYNVFARSITGYRALLADASASVERLVSRDLDFRTA 281


>gi|325981321|ref|YP_004293723.1| protein TolQ [Nitrosomonas sp. AL212]
 gi|325530840|gb|ADZ25561.1| protein TolQ [Nitrosomonas sp. AL212]
          Length = 226

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 61/223 (27%), Positives = 106/223 (47%), Gaps = 5/223 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   L     L V+ ++ +L + S  SW  I +K       +R+  +FE +FW G 
Sbjct: 6   TQDMSFLYLISSASLLVQLVMLILVLISFFSWWFIFRKLFVIRNEKRKTDDFEDIFWRGV 65

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L  + + +    + +  L  IF +   E+ K           + +   R M     RE+
Sbjct: 66  DLNALHQRITSARYDSGSLERIFAAGFGEFNK--HPAGSDLDAVMESTRRAMRATYQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   LSFL ++ S    +G+LG V G+M  F+S++      +    PGI E+LI+  +
Sbjct: 124 DYLESHLSFLATVGSVSPYIGLLGTVWGIMNSFRSLSSVTQATIAHVAPGIAEALIATAM 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           GL  +IP+ +AYN++   + + A + E F  E S +L R+  G
Sbjct: 184 GLFAAIPAVVAYNRYASSTDQLATRFESFMEELSNVLQRRAAG 226


>gi|82700456|ref|YP_415030.1| MotA/TolQ/ExbB proton channel [Brucella melitensis biovar Abortus
           2308]
 gi|256370079|ref|YP_003107590.1| biopolymer transport protein ExbB [Brucella microti CCM 4915]
 gi|82616557|emb|CAJ11635.1| MotA/TolQ/ExbB proton channel [Brucella melitensis biovar Abortus
           2308]
 gi|256000242|gb|ACU48641.1| biopolymer transport protein ExbB [Brucella microti CCM 4915]
 gi|326539386|gb|ADZ87601.1| TonB-system energizer ExbB [Brucella melitensis M5-90]
          Length = 292

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 58  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 117

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 118 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 177

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 178 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 237

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 238 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 281


>gi|259909764|ref|YP_002650120.1| biopolymer transport protein ExbB [Erwinia pyrifoliae Ep1/96]
 gi|224965386|emb|CAX56918.1| Biopolymer transport protein [Erwinia pyrifoliae Ep1/96]
          Length = 244

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 102/222 (45%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L  MD+S++ ++    + VK ++  L + S+ +W++   KS+   + R++ +  + L   
Sbjct: 5   LMQMDLSVWGMYQHADIVVKAVMIGLLLASVATWAIFFSKSIELRSARKRLKREQLLLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+   +   +  +  L+ I +   +E +     G+    GI++R    ++  +A   
Sbjct: 65  ARSLDEASQIGGDFQSQSLS-ILLIKEAENELELSAGSDDNNGIKERTAFRLERRVAAIG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHPGRGNGFLATIGSIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARAIGSYKASLGDVAAQVLLLQSRDLD 225


>gi|229591135|ref|YP_002873254.1| putative TolQ transport transmembrane protein [Pseudomonas
           fluorescens SBW25]
 gi|229363001|emb|CAY49951.1| putative TolQ transport transmembrane protein [Pseudomonas
           fluorescens SBW25]
          Length = 230

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 62/223 (27%), Positives = 107/223 (47%), Gaps = 6/223 (2%)

Query: 7   AIMD-ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           A M+ ++I+ L     L VK ++  L + S+LSW +IIQ+      L RQ   F + F +
Sbjct: 3   ATMEHMTIWGLISDASLLVKAVMVTLLLASLLSWYLIIQRGSVLRRLERQLNGFVRRFRA 62

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
              L+ + +        G+A IF++ + E++            + + ++R + VAI  + 
Sbjct: 63  ASDLQPLYRETVQAGEGGIAPIFIAGVQEYQHLH----SHDPAVLEGVERALQVAITEQE 118

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
            E+ + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +
Sbjct: 119 IELEKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAI 178

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           GL  +IP+ IAYN+F    +    +   F NE    L R   G
Sbjct: 179 GLFAAIPAVIAYNRFAARGQTLLTRYYAFGNELQVRLHRTLRG 221


>gi|77461776|ref|YP_351283.1| MotA/TolQ/ExbB proton channel [Pseudomonas fluorescens Pf0-1]
 gi|77385779|gb|ABA77292.1| outer membrane transport energization protein ExbB [Pseudomonas
           fluorescens Pf0-1]
          Length = 317

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N  G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 80  NTLGMA-HDLSPWGMYQNADVIVKAVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIA 138

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                 +L+    +        LA + +    E  +     AR   GI++R+   ++  +
Sbjct: 139 ALKKAATLKEASATAA--KEGTLANLLVHDALEEMRLST-NAREKEGIKERVSFRLERLV 195

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 196 AACGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 255

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 256 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 301


>gi|330988188|gb|EGH86291.1| tolQ protein [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 236

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 108/220 (49%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I+ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F +   L 
Sbjct: 8   MTIWGLISDASLLVKAVMLILLLASLVSWYLIIQRSLALGHYERTLDAFQQRFRAEAELA 67

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +    ++      G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLYSDSRSAQEGADGIERVFNAGYAEYVQLKPRPGIEPDVVLSGVERALQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNRFAARGQTLTARYYSFGNELQVRLNRTLQG 227


>gi|186476701|ref|YP_001858171.1| MotA/TolQ/ExbB proton channel [Burkholderia phymatum STM815]
 gi|184193160|gb|ACC71125.1| MotA/TolQ/ExbB proton channel [Burkholderia phymatum STM815]
          Length = 243

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 92/228 (40%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYG+A        ++ Q     + I   L I S+LSWSVI+ KS N + L R  R  E
Sbjct: 1   MQNYGIA-------HVWAQGDFVTRGIALALLIMSVLSWSVIVVKSWNVMRLNRLTRNAE 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMS------AMSEWKKSCDKGARSPIGIQDRID 114
           + FW         K L +  +      F++        ++            + + D + 
Sbjct: 54  KAFWHSDDFADGAKKLGSDTSSPTENPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQAGLAILASIGSTAPFVGLFGTVWGIYHALLTIGATGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKGIVSKLNRFAHGLHAFF 221


>gi|226945716|ref|YP_002800789.1| TolQ proton channel [Azotobacter vinelandii DJ]
 gi|226720643|gb|ACO79814.1| TolQ proton channel [Azotobacter vinelandii DJ]
          Length = 231

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 69/219 (31%), Positives = 113/219 (51%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +S+++L     L V+ ++ +L   S+ SW +I Q+       RR    FE+ FWSG  L 
Sbjct: 9   MSMWSLISNASLVVQLVMLVLVAASVTSWIMIFQRGNMLRAARRSLDSFEERFWSGIDLA 68

Query: 71  TVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + +    +   + GL  IF +   E+ + C +    P  + D + R M VAI+RE E++
Sbjct: 69  KLYRQAGSEPDPDSGLERIFRAGFKEFSRLCQQSGVVPDAVMDGVARSMRVAISREEEKL 128

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F+ +A      +    PGI E+LI+  +GL 
Sbjct: 129 EQSLPFLATVGSTSPYIGLFGTVWGIMNSFRGLAQVQQATLSTVAPGIAEALIATAIGLF 188

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ IAYN+F    +    +   FA+EF AIL R+  
Sbjct: 189 AAIPAVIAYNRFSARGELLIARYYTFADEFQAILHRKVH 227


>gi|326624910|gb|EGE31255.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
          Length = 239

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 49/223 (21%), Positives = 102/223 (45%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +      +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLADARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+             L+A  ++      +   +G+    GI++R    ++  +A     +
Sbjct: 63  LDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVGRYM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 224


>gi|258545750|ref|ZP_05705984.1| TolQ protein [Cardiobacterium hominis ATCC 15826]
 gi|258518995|gb|EEV87854.1| TolQ protein [Cardiobacterium hominis ATCC 15826]
          Length = 243

 Score =  149 bits (377), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 111/220 (50%), Gaps = 1/220 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   +S+  L     + VK I+ +LF+  + +  +  +K V F+ LR + ++F++ FWSG
Sbjct: 5   AETGLSVSRLIGDASIPVKVIMLILFMMFLTTLFITGKKYVQFLRLRHKIKQFDRTFWSG 64

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
             LE +    +  H   +  +F     E+ +       +P  I     R M  A+ RE  
Sbjct: 65  NDLEVLYAGYEKRHPESIERVFTDGFREFMQFQGNSLDNPDVIVHNCRRAMTAALNRESS 124

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
                L+ L ++ S+   +G+LG V G+M  F +I G  S ++ S+   I E+LI+  +G
Sbjct: 125 RQERGLNLLATIGSSAPYIGLLGTVYGIMNSFIAIGGAQSASISSVAPGIAEALIATAIG 184

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L  +IPS ++YN F+  S+   ++ + F  EFS +L RQ 
Sbjct: 185 LLAAIPSVLSYNYFVAHSESLTVEYDAFIEEFSNLLQRQI 224


>gi|257485271|ref|ZP_05639312.1| tolQ protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 236

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 58/220 (26%), Positives = 106/220 (48%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I+ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F +   L 
Sbjct: 8   MTIWGLISDASLLVKAVMLILLLASLVSWYLIIQRSLALGHYERTLDAFQQRFRAEAELA 67

Query: 71  TVCK--SLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           T+            G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  TLYAESHSAQEGADGIERVFNAGYAEYVQLKPRPGIEPDVVPSGVERALQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNCFAARGQTLTARYYSFGNELQVRLNRTLQG 227


>gi|167586276|ref|ZP_02378664.1| MotA/TolQ/ExbB proton channel [Burkholderia ubonensis Bu]
          Length = 225

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 71/222 (31%), Positives = 118/222 (53%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   +  + ++ LL + S++SW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   SQDLSIISLVLNASVLAQAVMGLLLLLSLMSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K+ +K    P  + D   R M  +  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKAKEKRISDPGLVLDGARRAMRASFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L++  +
Sbjct: 124 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNSFRGLANVQQATLANVAPGIAEALVATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ +
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAQ 225


>gi|291086577|ref|ZP_06356197.2| TonB-system energizer ExbB [Citrobacter youngae ATCC 29220]
 gi|291067834|gb|EFE05943.1| TonB-system energizer ExbB [Citrobacter youngae ATCC 29220]
          Length = 239

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 51/223 (22%), Positives = 103/223 (46%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KS+ F T +R+ +   QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSLEFFTQKRRLKRELQLLADARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           LE   +         L A  ++      +   +G+    GI++R    ++  +A     +
Sbjct: 63  LEGASEIAAGFDAKSLGAQLINEAQNELELS-EGSDDNEGIKERTGFRLERRVAAVGRHM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNVFARQIGSYKAMLGDVAAQVLLLQSRDLDLNAS 224


>gi|265984685|ref|ZP_06097420.1| biopolymer transport channel protein [Brucella sp. 83/13]
 gi|264663277|gb|EEZ33538.1| biopolymer transport channel protein [Brucella sp. 83/13]
          Length = 319

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 85  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKVIGHSA 144

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 145 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 204

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 205 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 264

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 265 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 308


>gi|168819784|ref|ZP_02831784.1| TonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205343445|gb|EDZ30209.1| TonB-system energizer ExbB [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
          Length = 244

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 103/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +     
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+             L+A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  VRSLDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAAG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|71735527|ref|YP_275169.1| tolQ protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71556080|gb|AAZ35291.1| tolQ protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320323664|gb|EFW79748.1| tolQ protein [Pseudomonas syringae pv. glycinea str. B076]
 gi|320328302|gb|EFW84306.1| tolQ protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330878529|gb|EGH12678.1| tolQ protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330889788|gb|EGH22449.1| tolQ protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 236

 Score =  149 bits (376), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 108/220 (49%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I+ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F +   L 
Sbjct: 8   MTIWGLISDASLLVKAVMLILLLASLVSWYLIIQRSLALGHYERTLDAFQQRFRAEAELA 67

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +    ++      G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLYAESRSAQEGADGIERVFNAGYAEYVQLKPRPGIEPDVVLSGVERALQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNRFAARGQTLTARYYSFGNELQVRLNRTLQG 227


>gi|13235473|emb|CAC33632.1| TolQ protein [Rickettsia montanensis]
          Length = 241

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 70/206 (33%), Positives = 114/206 (55%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K    + +++  R FE +FWSG  LE + +S+K   N  
Sbjct: 32  GKSVMLMLLIASIWSWAIILDKIFKLVQVQKSMRAFENVFWSGGVLERLYESIKRSVNNP 91

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+ AM E K    KG         ++RI   M +A  RE+ ++ + LSFL ++ S+
Sbjct: 92  LALIFVLAMDECKSLSTKGLSEGLKNNHKERITGAMYLAQNREVAKLEKNLSFLATVGSS 151

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 152 APFVGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 211

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 212 SRITLINNKIEDFISELNSILSKAID 237


>gi|290474740|ref|YP_003467620.1| TonB complex protein [Xenorhabdus bovienii SS-2004]
 gi|289174053|emb|CBJ80840.1| TonB complex protein [Xenorhabdus bovienii SS-2004]
          Length = 330

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 46/220 (20%), Positives = 98/220 (44%), Gaps = 2/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S++ ++      VK ++  L I S+++W++   K    +  RR+ R+ +       
Sbjct: 100 ATDLSVWGMYQNADAVVKTVMLGLVIASVITWALFFSKGTELLIARRRLRKEQWALADAA 159

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L+   K   +     ++ + +S     +++    +    G ++R    M+ A+A     
Sbjct: 160 NLDVAAKIASDFGKQSISRLLLSEAQ-SERALSAASTDKAGTKERTSFRMERAVAAISRH 218

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL
Sbjct: 219 MGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGL 278

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      +  Q+   A +   +L R  +
Sbjct: 279 VAAIPAVVIYNIFARVISSYRGQVGDMAAQAILLLGRDLD 318


>gi|255020127|ref|ZP_05292197.1| MotA/TolQ/ExbB proton channel family protein [Acidithiobacillus
           caldus ATCC 51756]
 gi|254970420|gb|EET27912.1| MotA/TolQ/ExbB proton channel family protein [Acidithiobacillus
           caldus ATCC 51756]
          Length = 233

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 68/222 (30%), Positives = 108/222 (48%), Gaps = 5/222 (2%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   +S+  L +     V+ I+ LL I S+ SW VI QK++ F   +R  + FE+ FWSG
Sbjct: 9   AAESLSLTHLVLHASWVVQAILVLLLIASVASWYVIFQKALVFAHAQRALKRFEKRFWSG 68

Query: 67  QSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             +  + + +        G  AIF +   E+++   +   +         R M  A  RE
Sbjct: 69  GEMAQIYQQVTGNAQLETGAGAIFCAGYEEFQRQRKQARGADALDA--ARRAMRGAQIRE 126

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISIL 183
           + ++   L  L S+SS    VG+LG V G+M  F +I       +    P + E+LI+ L
Sbjct: 127 VGQLEGNLPLLASISSVAPFVGLLGTVWGIMTTFMNIGAAQQATLATVAPPVAEALIATL 186

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            GL  +IP++  YN+F+    +     E F +EF+ IL RQT
Sbjct: 187 AGLFAAIPATFFYNRFVHRLDELDSHYEVFMDEFTNILHRQT 228


>gi|218550255|ref|YP_002384046.1| biopolymer transport protein ExbB [Escherichia fergusonii ATCC
           35469]
 gi|218357796|emb|CAQ90440.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           fergusonii ATCC 35469]
          Length = 244

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFTKSVEFFKQKRRLKREQQLLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+   +   +     L+   ++      +    G+    GI++R    ++ ++A   
Sbjct: 65  ARSLDQASEIAGDFGKYSLSLQLLNEAQNELELS-AGSDDNDGIKERTSFRLERSVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAQSQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNIFARQIAGFKAMLGDVAAQVLLLQSRDLD 225


>gi|92116361|ref|YP_576090.1| MotA/TolQ/ExbB proton channel [Nitrobacter hamburgensis X14]
 gi|91799255|gb|ABE61630.1| outer membrane transport energization protein ExbB [Nitrobacter
           hamburgensis X14]
          Length = 337

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 96/222 (43%), Gaps = 6/222 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FMQ  + VK ++  L   S+++W++ + K V     RR+ +   +      
Sbjct: 98  PRDLSPWGMFMQADIVVKAVMVGLAFASLVTWTIWLAKGVELAAARRRAQSCVRKLARAD 157

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           SL                +A +  +A  E K+S      +  GI++R+   +    AR  
Sbjct: 158 SLAAAQAETADGWTGQGTVAELLEAAEGELKRSR---DLTAEGIKERLAIALSRIEARAG 214

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            E+      L ++ +    VG+ G V G+M  F  I+   + N+  +   I E+L++  L
Sbjct: 215 REVARGTGLLATIGATAPFVGLFGTVWGIMNAFIGISLSKTTNLAVVAPGIAEALLATAL 274

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ I YN F      +   +   + E    +SR  E
Sbjct: 275 GLVAAIPAVIIYNVFARALSSYRALLSDASGEIIQHISRDLE 316


>gi|319943005|ref|ZP_08017288.1| TolQ colicin import protein [Lautropia mirabilis ATCC 51599]
 gi|319743547|gb|EFV95951.1| TolQ colicin import protein [Lautropia mirabilis ATCC 51599]
          Length = 230

 Score =  149 bits (375), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 63/229 (27%), Positives = 113/229 (49%), Gaps = 9/229 (3%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI ++     L  + ++ LL + S++SW++I +K       +R    FE+ FW 
Sbjct: 1   MNAHDLSILSMISDASLLAQAVMALLLVISLVSWTIIFRKLFAIKAAQRATNRFEEKFWQ 60

Query: 66  GQSLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDR------IDRMM 117
           G  L  + + + +       +A IF + M E++++   G     G +          R M
Sbjct: 61  GAELNALYQEVSHASKDPGPMARIFEAGMKEFRRARQNGITGNGGPESSNIVLAPASRAM 120

Query: 118 DVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGII 176
             A  RE++ +   L+FL S  S    +G+ G V G+M  F+ +A      +    PGI 
Sbjct: 121 RAAFQREMDALESSLAFLASAGSVSPYIGLFGTVWGIMNAFRGLADVQQATLASVAPGIA 180

Query: 177 ESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           E+L++  +GL  +IP+ +AYN++  + ++ A + E F +EFS IL R  
Sbjct: 181 EALVATAIGLFAAIPAVVAYNRYAYEIERLANRFETFIDEFSNILDRHA 229


>gi|238650758|ref|YP_002916612.1| tolQ protein [Rickettsia peacockii str. Rustic]
 gi|238624856|gb|ACR47562.1| tolQ protein [Rickettsia peacockii str. Rustic]
          Length = 241

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 71/206 (34%), Positives = 115/206 (55%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K    + +++  R FE +FWSG  LE + +S+K   N  
Sbjct: 32  GKSVMLMLLIASIWSWAIILDKIFKLVQVQKSMRAFENVFWSGGVLEQLYESIKRSVNNP 91

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI   M +A  R +E++ + LSFL ++ S+
Sbjct: 92  LALIFVSAMDECKSLSTKGLSEGLKNNHKERITGAMYLAQNRAVEKLEKNLSFLATVGSS 151

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 152 APFVGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 211

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 212 SRITLINNKIEDFISELNSILSKAID 237


>gi|90408533|ref|ZP_01216690.1| tol protein, membrane-spanning inner membrane protein, required for
           outer membrane integrity, uptake of group A
           [Psychromonas sp. CNPT3]
 gi|90310352|gb|EAS38480.1| tol protein, membrane-spanning inner membrane protein, required for
           outer membrane integrity, uptake of group A
           [Psychromonas sp. CNPT3]
          Length = 227

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 105/219 (47%), Gaps = 3/219 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++S   LF+Q  L VK ++ LL   S+ SW++I  +S            FE+ FWSG  L
Sbjct: 4   EMSFLGLFLQASLLVKFVMLLLLAMSVYSWTIIFSRSRVLKAAHEALEHFEKRFWSGHDL 63

Query: 70  ETVCKS--LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + +    ++    G   IF     E+ +      R+   + +   R M V ++RE+EE
Sbjct: 64  SRLYQETAARSERIGGGEKIFFQGFKEFSRLHTMPGRNVDSVTEGAHRSMRVVLSREVEE 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + E LS L ++ S    +G+ G V G+M  F ++      ++  +   I E+LI+  +GL
Sbjct: 124 LEEGLSALATIGSISPYIGLFGTVWGIMNAFMALGQVQQASLNMVAPGIAEALIATAMGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
             +IP+ +AYN++     +          EF++IL RQ 
Sbjct: 184 FAAIPAVMAYNRYTAKMMRLETAYINLMEEFTSILHRQA 222


>gi|119898621|ref|YP_933834.1| putative biopolymer transport protein ExbB [Azoarcus sp. BH72]
 gi|119671034|emb|CAL94947.1| putative biopolymer transport protein ExbB [Azoarcus sp. BH72]
          Length = 273

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 48/221 (21%), Positives = 87/221 (39%), Gaps = 12/221 (5%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+       K  + +L + SI SW +I  K      L RQ     +
Sbjct: 39  NPYGLEA-------LWSAGDFVAKGTLAILVVMSIGSWYIIFSKLYEQAKLNRQGNSANK 91

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW    ++   ++L    +   A  +++       +   G    I + + I   +  A 
Sbjct: 92  TFWGAGDVDKGLETL----DKNSAYHYIAKSGNDATAHHDGLLQFIDVNEWIQLSIHRAT 147

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 148 EKVQSRLQGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGVAGQASIDKVAGPVGEALI 207

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN  +  +K     +  F  E  A+L
Sbjct: 208 MTAIGLAVAVPAVLGYNWLVRRNKAALEDVRSFGAELHAVL 248


>gi|17986648|ref|NP_539282.1| biopolymer transport EXBB protein [Brucella melitensis bv. 1 str.
           16M]
 gi|17982264|gb|AAL51546.1| biopolymer transport exbb protein [Brucella melitensis bv. 1 str.
           16M]
          Length = 290

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 56  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 115

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 116 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 175

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 176 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 235

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 236 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 279


>gi|292900653|ref|YP_003540022.1| biopolymer transport protein [Erwinia amylovora ATCC 49946]
 gi|291200501|emb|CBJ47630.1| biopolymer transport protein [Erwinia amylovora ATCC 49946]
          Length = 244

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 99/222 (44%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L  MD+S++ ++    + VK ++  L + S+ +W++   KS+   + R++ +  +    +
Sbjct: 5   LMQMDLSVWGMYQHADIVVKAVMIGLLLASVATWAIFFSKSIELRSARKRLKREQLSLAA 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SLE   +         L+ + +   +E +      +    GI++R    ++  +A   
Sbjct: 65  ARSLEEALQIGGGFQRQSLSTLLVKE-AENELELSANSDDNNGIKERTAFRLERQVAAIG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHAGRGNGFLATIGSIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARTIASYKASLGDVAAQVLLLQSRDLD 225


>gi|310766368|gb|ADP11318.1| biopolymer transport protein ExbB [Erwinia sp. Ejp617]
          Length = 244

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 102/222 (45%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L  MD+S++ ++    + VK ++  L + S+ +W++   KS+   + R++ +  + L   
Sbjct: 5   LMQMDLSVWGMYQHADIVVKAVMIGLLLASVATWAIFFSKSIELRSARKRLKREQLLLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+   +   +  +  L+ I +   +E +     G+    GI++R    ++  +A   
Sbjct: 65  ARSLDEASQIGGDFQSQSLS-ILLIKEAENELELSAGSDDNNGIKERTAFRLERRVAAIG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHAGRGNGFLATIGSIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARAIGSYKASLGDVAAQVLLLQSRDLD 225


>gi|157964385|ref|YP_001499209.1| hypothetical protein RMA_0432 [Rickettsia massiliae MTU5]
 gi|157844161|gb|ABV84662.1| TolQ [Rickettsia massiliae MTU5]
          Length = 244

 Score =  149 bits (375), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 72/206 (34%), Positives = 116/206 (56%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +L I SI SW++I+ K    + +++  R FE +FWSG  LE + +S+K   N  
Sbjct: 35  GKSVMLMLLIASIWSWAIILDKIFKLVQVQKSMRAFENVFWSGGVLEQLYESIKRSVNNP 94

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         ++RI   M +A  RE+E++ + LSFL ++ S+
Sbjct: 95  LALIFVSAMDECKSLSTKGLSEGLKNNHKERIMGAMYLAQNREVEKLEKNLSFLATVGSS 154

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              VG+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 155 APFVGLFGTVWGIMHSFQSIATSNNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 214

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 215 SRITLINNKIEDFISELNSILSKAID 240


>gi|78358668|ref|YP_390117.1| tolQ protein [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78221073|gb|ABB40422.1| Cell division and transport-associated protein TolQ [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 228

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 55/220 (25%), Positives = 110/220 (50%), Gaps = 2/220 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           M+ +IF L MQ    VK ++++L + S+ SWS+++QK +   + RR+  +    F   + 
Sbjct: 1   MESNIFGLLMQATPVVKGVLSILVLMSVASWSLMLQKWIVLSSARRKAAQGLSAFTHARD 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L    +SL   H   L  +    ++E+ +       S   + D + R +   ++ +   +
Sbjct: 61  LREAVQSLSGDHTSPLYQVAQEGVAEYNRLR-DMQSSEDVVADNVRRALRQGVSMQTSRL 119

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
           +  L+FL + ++A   +G+ G V G+M  F SI    + ++ ++   I E+L++  +GL 
Sbjct: 120 SSSLAFLATCANAAPFIGLFGTVWGIMHSFHSIGLMKTASLAAVAPGISEALVATAIGLG 179

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           V+IP+++ YN F+       +Q+  FA  F   + R+   
Sbjct: 180 VAIPATVGYNLFLGMLNGIEVQLVNFAGVFLNRVQRELHA 219


>gi|239832740|ref|ZP_04681069.1| tonB-system energizer ExbB [Ochrobactrum intermedium LMG 3301]
 gi|239825007|gb|EEQ96575.1| tonB-system energizer ExbB [Ochrobactrum intermedium LMG 3301]
          Length = 338

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 96/226 (42%), Gaps = 1/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+S + +FM     VK ++  L + S+ +W+V + KS+     RR+  +  ++   
Sbjct: 102 ILPHDLSPWGMFMAADWVVKAVMIGLALASLATWTVWVAKSLELAGARRRAYKALKVIGH 161

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +L    ++L      G   +  +                 G+++R+   +    A+  
Sbjct: 162 SATLAEAVRALDGAKGPGAVLVRAAEDEVRLSGPALARAGGEGLKERVSSRLSRIEAKAG 221

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +++    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +
Sbjct: 222 RRLSKGTGVLATIGSVAPFVGLFGTVWGIMNSFINISQAQTTNLAVVAPGIAEALLATAI 281

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 282 GLVAAIPAVVIYNVFARSITGYRSLLADASAGVERLVSRDLDFRTA 327


>gi|170766052|ref|ZP_02900863.1| TonB-system energizer ExbB [Escherichia albertii TW07627]
 gi|170125198|gb|EDS94129.1| TonB-system energizer ExbB [Escherichia albertii TW07627]
          Length = 244

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +Q+   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQMLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|82545391|ref|YP_409338.1| biopolymer transport protein ExbB [Shigella boydii Sb227]
 gi|187730205|ref|YP_001881769.1| biopolymer transport protein ExbB [Shigella boydii CDC 3083-94]
 gi|81246802|gb|ABB67510.1| ExbB [Shigella boydii Sb227]
 gi|187427197|gb|ACD06471.1| tonB-system energizer ExbB [Shigella boydii CDC 3083-94]
 gi|320175247|gb|EFW50355.1| MotA/TolQ/ExbB proton channel family protein [Shigella dysenteriae
           CDC 74-1112]
 gi|320187488|gb|EFW62175.1| MotA/TolQ/ExbB proton channel family protein [Shigella flexneri CDC
           796-83]
          Length = 244

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 102/222 (45%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+    +      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLFNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|15803550|ref|NP_289583.1| biopolymer transport protein ExbB [Escherichia coli O157:H7 EDL933]
 gi|15833144|ref|NP_311917.1| biopolymer transport protein ExbB [Escherichia coli O157:H7 str.
           Sakai]
 gi|16130904|ref|NP_417479.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli str. K-12 substr. MG1655]
 gi|74313549|ref|YP_311968.1| biopolymer transport protein ExbB [Shigella sonnei Ss046]
 gi|82778226|ref|YP_404575.1| biopolymer transport protein ExbB [Shigella dysenteriae Sd197]
 gi|89109778|ref|AP_003558.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli str. K-12 substr. W3110]
 gi|91212418|ref|YP_542404.1| biopolymer transport protein ExbB [Escherichia coli UTI89]
 gi|117625309|ref|YP_854510.1| biopolymer transport protein ExbB [Escherichia coli APEC O1]
 gi|157156078|ref|YP_001464472.1| biopolymer transport protein ExbB [Escherichia coli E24377A]
 gi|168747488|ref|ZP_02772510.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4113]
 gi|168753971|ref|ZP_02778978.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4401]
 gi|168760162|ref|ZP_02785169.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4501]
 gi|168767025|ref|ZP_02792032.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4486]
 gi|168773341|ref|ZP_02798348.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4196]
 gi|168781878|ref|ZP_02806885.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4076]
 gi|168785876|ref|ZP_02810883.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC869]
 gi|168797594|ref|ZP_02822601.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC508]
 gi|170018738|ref|YP_001723692.1| biopolymer transport protein ExbB [Escherichia coli ATCC 8739]
 gi|170082551|ref|YP_001731871.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170680008|ref|YP_001745271.1| biopolymer transport protein ExbB [Escherichia coli SMS-3-5]
 gi|188492681|ref|ZP_02999951.1| tonB-system energizer ExbB [Escherichia coli 53638]
 gi|191167568|ref|ZP_03029380.1| TonB-system energizer ExbB [Escherichia coli B7A]
 gi|191172531|ref|ZP_03034071.1| TonB-system energizer ExbB [Escherichia coli F11]
 gi|193062063|ref|ZP_03043159.1| TonB-system energizer ExbB [Escherichia coli E22]
 gi|193067250|ref|ZP_03048218.1| TonB-system energizer ExbB [Escherichia coli E110019]
 gi|194426357|ref|ZP_03058912.1| TonB-system energizer ExbB [Escherichia coli B171]
 gi|194431783|ref|ZP_03064074.1| TonB-system energizer ExbB [Shigella dysenteriae 1012]
 gi|194436750|ref|ZP_03068850.1| TonB-system energizer ExbB [Escherichia coli 101-1]
 gi|195937151|ref|ZP_03082533.1| biopolymer transport protein ExbB [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807245|ref|ZP_03249582.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4206]
 gi|208813577|ref|ZP_03254906.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4045]
 gi|208818524|ref|ZP_03258844.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4042]
 gi|209397203|ref|YP_002272484.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4115]
 gi|209920481|ref|YP_002294565.1| biopolymer transport protein ExbB [Escherichia coli SE11]
 gi|215488331|ref|YP_002330762.1| biopolymer transport protein ExbB [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217327909|ref|ZP_03443992.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. TW14588]
 gi|218555579|ref|YP_002388492.1| biopolymer transport protein ExbB [Escherichia coli IAI1]
 gi|218560080|ref|YP_002392993.1| biopolymer transport protein ExbB [Escherichia coli S88]
 gi|218691296|ref|YP_002399508.1| biopolymer transport protein ExbB [Escherichia coli ED1a]
 gi|218696715|ref|YP_002404382.1| biopolymer transport protein ExbB [Escherichia coli 55989]
 gi|218701779|ref|YP_002409408.1| biopolymer transport protein ExbB [Escherichia coli IAI39]
 gi|218706634|ref|YP_002414153.1| biopolymer transport protein ExbB [Escherichia coli UMN026]
 gi|227887711|ref|ZP_04005516.1| biopolymer transport protein ExbB [Escherichia coli 83972]
 gi|237706248|ref|ZP_04536729.1| biopolymer transporter ExbB [Escherichia sp. 3_2_53FAA]
 gi|238902121|ref|YP_002927917.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli BW2952]
 gi|253772156|ref|YP_003034987.1| biopolymer transporter ExbB [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038176|ref|ZP_04872234.1| biopolymer transporter ExbB [Escherichia sp. 1_1_43]
 gi|254162957|ref|YP_003046065.1| biopolymer transport protein ExbB [Escherichia coli B str. REL606]
 gi|254794961|ref|YP_003079798.1| biopolymer transport protein ExbB [Escherichia coli O157:H7 str.
           TW14359]
 gi|256019072|ref|ZP_05432937.1| biopolymer transport protein ExbB [Shigella sp. D9]
 gi|256024410|ref|ZP_05438275.1| biopolymer transport protein ExbB [Escherichia sp. 4_1_40B]
 gi|260845765|ref|YP_003223543.1| membrane spanning protein ExbB [Escherichia coli O103:H2 str.
           12009]
 gi|260857144|ref|YP_003231035.1| membrane spanning protein ExbB [Escherichia coli O26:H11 str.
           11368]
 gi|260869765|ref|YP_003236167.1| membrane spanning protein ExbB [Escherichia coli O111:H- str.
           11128]
 gi|261228020|ref|ZP_05942301.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli O157:H7 str. FRIK2000]
 gi|261254877|ref|ZP_05947410.1| membrane spanning protein ExbB [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284387|ref|YP_003501205.1| Biopolymer transport protein exbB [Escherichia coli O55:H7 str.
           CB9615]
 gi|293406623|ref|ZP_06650549.1| biopolymer transporter ExbB [Escherichia coli FVEC1412]
 gi|293412383|ref|ZP_06655106.1| tonB-system energizer ExbB [Escherichia coli B354]
 gi|293416450|ref|ZP_06659089.1| tonB-system energizer ExbB [Escherichia coli B185]
 gi|293449353|ref|ZP_06663774.1| tonB-system energizer ExbB [Escherichia coli B088]
 gi|298382362|ref|ZP_06991959.1| biopolymer transporter exbB [Escherichia coli FVEC1302]
 gi|307139696|ref|ZP_07499052.1| biopolymer transport protein ExbB [Escherichia coli H736]
 gi|307310361|ref|ZP_07590009.1| tonB-system energizer ExbB [Escherichia coli W]
 gi|331643708|ref|ZP_08344839.1| TonB-system energizer ExbB [Escherichia coli H736]
 gi|331648796|ref|ZP_08349884.1| TonB-system energizer ExbB [Escherichia coli M605]
 gi|331669972|ref|ZP_08370817.1| TonB-system energizer ExbB [Escherichia coli TA271]
 gi|331674557|ref|ZP_08375317.1| TonB-system energizer ExbB [Escherichia coli TA280]
 gi|331679081|ref|ZP_08379753.1| TonB-system energizer ExbB [Escherichia coli H591]
 gi|332280174|ref|ZP_08392587.1| membrane spanning protein in TonB-ExbB-ExbD complex [Shigella sp.
           D9]
 gi|78099974|sp|P0ABU8|EXBB_ECO57 RecName: Full=Biopolymer transport protein exbB
 gi|78099975|sp|P0ABU7|EXBB_ECOLI RecName: Full=Biopolymer transport protein exbB
 gi|12517572|gb|AAG58142.1|AE005530_8 uptake of enterochelin; tonB-dependent uptake of B colicins
           [Escherichia coli O157:H7 str. EDL933]
 gi|882535|gb|AAA69173.1| exbB [Escherichia coli str. K-12 substr. MG1655]
 gi|1789381|gb|AAC76042.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli str. K-12 substr. MG1655]
 gi|13363362|dbj|BAB37313.1| biopolymer transport ExbB protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|73857026|gb|AAZ89733.1| uptake of enterochelin; tonB-dependent uptake of B colicins
           [Shigella sonnei Ss046]
 gi|81242374|gb|ABB63084.1| ExbB [Shigella dysenteriae Sd197]
 gi|85675811|dbj|BAE77064.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli str. K12 substr. W3110]
 gi|91073992|gb|ABE08873.1| TonB-dependent enterochelin uptake protein [Escherichia coli UTI89]
 gi|115514433|gb|ABJ02508.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli APEC O1]
 gi|157078108|gb|ABV17816.1| TonB-system energizer ExbB [Escherichia coli E24377A]
 gi|169753666|gb|ACA76365.1| tonB-system energizer ExbB [Escherichia coli ATCC 8739]
 gi|169890386|gb|ACB04093.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli str. K-12 substr. DH10B]
 gi|170517726|gb|ACB15904.1| TonB-system energizer ExbB [Escherichia coli SMS-3-5]
 gi|187770997|gb|EDU34841.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4196]
 gi|188017796|gb|EDU55918.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4113]
 gi|188487880|gb|EDU62983.1| tonB-system energizer ExbB [Escherichia coli 53638]
 gi|189000633|gb|EDU69619.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4076]
 gi|189358565|gb|EDU76984.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4401]
 gi|189363812|gb|EDU82231.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4486]
 gi|189369243|gb|EDU87659.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4501]
 gi|189373966|gb|EDU92382.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC869]
 gi|189379738|gb|EDU98154.1| TonB-system energizer ExbB [Escherichia coli O157:H7 str. EC508]
 gi|190902425|gb|EDV62162.1| TonB-system energizer ExbB [Escherichia coli B7A]
 gi|190907199|gb|EDV66798.1| TonB-system energizer ExbB [Escherichia coli F11]
 gi|192932283|gb|EDV84881.1| TonB-system energizer ExbB [Escherichia coli E22]
 gi|192959207|gb|EDV89642.1| TonB-system energizer ExbB [Escherichia coli E110019]
 gi|194415665|gb|EDX31932.1| TonB-system energizer ExbB [Escherichia coli B171]
 gi|194420139|gb|EDX36217.1| TonB-system energizer ExbB [Shigella dysenteriae 1012]
 gi|194424232|gb|EDX40219.1| TonB-system energizer ExbB [Escherichia coli 101-1]
 gi|208727046|gb|EDZ76647.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4206]
 gi|208734854|gb|EDZ83541.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4045]
 gi|208738647|gb|EDZ86329.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4042]
 gi|209158603|gb|ACI36036.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. EC4115]
 gi|209759718|gb|ACI78171.1| biopolymer transport ExbB protein [Escherichia coli]
 gi|209759720|gb|ACI78172.1| biopolymer transport ExbB protein [Escherichia coli]
 gi|209759722|gb|ACI78173.1| biopolymer transport ExbB protein [Escherichia coli]
 gi|209759724|gb|ACI78174.1| biopolymer transport ExbB protein [Escherichia coli]
 gi|209759726|gb|ACI78175.1| biopolymer transport ExbB protein [Escherichia coli]
 gi|209913740|dbj|BAG78814.1| biopolymer transport protein [Escherichia coli SE11]
 gi|215266403|emb|CAS10841.1| membrane spanning protein ExbB in TonB-ExbB-ExbD complex
           [Escherichia coli O127:H6 str. E2348/69]
 gi|217320276|gb|EEC28701.1| tonB-system energizer ExbB [Escherichia coli O157:H7 str. TW14588]
 gi|218353447|emb|CAU99531.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli 55989]
 gi|218362347|emb|CAQ99969.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli IAI1]
 gi|218366849|emb|CAR04619.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli S88]
 gi|218371765|emb|CAR19618.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli IAI39]
 gi|218428860|emb|CAR09805.2| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli ED1a]
 gi|218433731|emb|CAR14648.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli UMN026]
 gi|222034727|emb|CAP77469.1| biopolymer transport exbB protein [Escherichia coli LF82]
 gi|226839800|gb|EEH71821.1| biopolymer transporter ExbB [Escherichia sp. 1_1_43]
 gi|226899288|gb|EEH85547.1| biopolymer transporter ExbB [Escherichia sp. 3_2_53FAA]
 gi|227835107|gb|EEJ45573.1| biopolymer transport protein ExbB [Escherichia coli 83972]
 gi|238861747|gb|ACR63745.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli BW2952]
 gi|242378560|emb|CAQ33347.1| ExbB protein; uptake of enterochelin; tonB-dependent uptake of B
           colicins, subunit of TonB energy transducing system,
           vitamin B12 outer membrane transport complex, vitamin
           B12 transport system, Outer Membrane Ferric Enterobactin
           Transport System, Ferric Enterobactin Transport System,
           Outer Membrane Ferrichrome Transport System, ferrichrome
           uptake system, Outer Membrane Ferric Citrate Transport
           System and ferric dicitrate uptake system [Escherichia
           coli BL21(DE3)]
 gi|253323200|gb|ACT27802.1| tonB-system energizer ExbB [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253974858|gb|ACT40529.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli B str. REL606]
 gi|253979014|gb|ACT44684.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli BL21(DE3)]
 gi|254594361|gb|ACT73722.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli O157:H7 str. TW14359]
 gi|257755793|dbj|BAI27295.1| membrane spanning protein ExbB [Escherichia coli O26:H11 str.
           11368]
 gi|257760912|dbj|BAI32409.1| membrane spanning protein ExbB [Escherichia coli O103:H2 str.
           12009]
 gi|257766121|dbj|BAI37616.1| membrane spanning protein ExbB [Escherichia coli O111:H- str.
           11128]
 gi|260447955|gb|ACX38377.1| tonB-system energizer ExbB [Escherichia coli DH1]
 gi|281180045|dbj|BAI56375.1| biopolymer transport protein [Escherichia coli SE15]
 gi|284923031|emb|CBG36124.1| biopolymer transport protein [Escherichia coli 042]
 gi|290764260|gb|ADD58221.1| Biopolymer transport protein exbB [Escherichia coli O55:H7 str.
           CB9615]
 gi|291322443|gb|EFE61872.1| tonB-system energizer ExbB [Escherichia coli B088]
 gi|291426629|gb|EFE99661.1| biopolymer transporter ExbB [Escherichia coli FVEC1412]
 gi|291431806|gb|EFF04789.1| tonB-system energizer ExbB [Escherichia coli B185]
 gi|291469154|gb|EFF11645.1| tonB-system energizer ExbB [Escherichia coli B354]
 gi|294491817|gb|ADE90573.1| TonB-system energizer ExbB [Escherichia coli IHE3034]
 gi|298277502|gb|EFI19018.1| biopolymer transporter exbB [Escherichia coli FVEC1302]
 gi|306909256|gb|EFN39751.1| tonB-system energizer ExbB [Escherichia coli W]
 gi|307625392|gb|ADN69696.1| biopolymer transport protein ExbB [Escherichia coli UM146]
 gi|309703439|emb|CBJ02779.1| biopolymer transport protein [Escherichia coli ETEC H10407]
 gi|312947565|gb|ADR28392.1| biopolymer transport protein ExbB [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315062322|gb|ADT76649.1| membrane spanning protein in TonB-ExbB-ExbD complex [Escherichia
           coli W]
 gi|315137602|dbj|BAJ44761.1| biopolymer transport protein exbB [Escherichia coli DH1]
 gi|320180965|gb|EFW55886.1| MotA/TolQ/ExbB proton channel family protein [Shigella boydii ATCC
           9905]
 gi|320189361|gb|EFW64020.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           O157:H7 str. EC1212]
 gi|320195155|gb|EFW69784.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           WV_060327]
 gi|320201922|gb|EFW76497.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           EC4100B]
 gi|320640082|gb|EFX09654.1| biopolymer transport protein ExbB [Escherichia coli O157:H7 str.
           G5101]
 gi|320645380|gb|EFX14389.1| biopolymer transport protein ExbB [Escherichia coli O157:H- str.
           493-89]
 gi|320650693|gb|EFX19150.1| biopolymer transport protein ExbB [Escherichia coli O157:H- str. H
           2687]
 gi|320656387|gb|EFX24294.1| biopolymer transport protein ExbB [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661760|gb|EFX29168.1| biopolymer transport protein ExbB [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666911|gb|EFX33887.1| biopolymer transport protein ExbB [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323377092|gb|ADX49360.1| tonB-system energizer ExbB [Escherichia coli KO11]
 gi|326337715|gb|EGD61549.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           O157:H7 str. 1125]
 gi|326347279|gb|EGD71004.1| MotA/TolQ/ExbB proton channel family protein [Escherichia coli
           O157:H7 str. 1044]
 gi|330909062|gb|EGH37576.1| motA/TolQ/ExbB proton channel family protein [Escherichia coli
           AA86]
 gi|331037179|gb|EGI09403.1| TonB-system energizer ExbB [Escherichia coli H736]
 gi|331042543|gb|EGI14685.1| TonB-system energizer ExbB [Escherichia coli M605]
 gi|331062885|gb|EGI34799.1| TonB-system energizer ExbB [Escherichia coli TA271]
 gi|331068651|gb|EGI40046.1| TonB-system energizer ExbB [Escherichia coli TA280]
 gi|331073146|gb|EGI44469.1| TonB-system energizer ExbB [Escherichia coli H591]
 gi|332102526|gb|EGJ05872.1| membrane spanning protein in TonB-ExbB-ExbD complex [Shigella sp.
           D9]
          Length = 244

 Score =  148 bits (374), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|320087608|emb|CBY97372.1| Biopolymer transport protein exbB [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 239

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 49/223 (21%), Positives = 102/223 (45%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +      +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLADVRS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+             L+A  ++      +   +G+    GI++R    ++  +A     +
Sbjct: 63  LDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAAGRYM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 224


>gi|283787142|ref|YP_003367007.1| biopolymer transport protein [Citrobacter rodentium ICC168]
 gi|282950596|emb|CBG90266.1| biopolymer transport protein [Citrobacter rodentium ICC168]
          Length = 244

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 103/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV+F + RR+ +  +Q    
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVDFFSQRRRLKREQQQLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+       +     L    ++      +    G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDIAASFGAKSLNTQLLNEAQNELELS-AGSEDNEGIKERTGFRLERRVAAAG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F          +   A +   + SR  + + S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGGLKATLSDIAAQVLLLQSRDLDLDAS 229


>gi|170749570|ref|YP_001755830.1| MotA/TolQ/ExbB proton channel [Methylobacterium radiotolerans JCM
           2831]
 gi|170656092|gb|ACB25147.1| MotA/TolQ/ExbB proton channel [Methylobacterium radiotolerans JCM
           2831]
          Length = 229

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 100/222 (45%), Gaps = 10/222 (4%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A  D S   LF+Q    VK ++ LL I SI  W+V+ +K +     RRQ + F  L  SG
Sbjct: 10  AAHDFSFLGLFLQADPIVKGVMILLVIASIACWTVVFEKVIRLAAARRQAKAFANLVRSG 69

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
            S       L   H      +  +A+  W+      + +    +DRI+R M  A+  E++
Sbjct: 70  GS-------LDGEHRGIAGHVVKAAIDAWRD--QDSSETRAERRDRIERAMKGALTIEVK 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   LS L +  S    VG+ G V G+M  F SIA     ++  +   I E+L +  +G
Sbjct: 121 RLRTGLSLLATSGSTAPFVGLFGTVWGIMNSFSSIARSQDTSLAVVAPGIAEALFATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           L V+IP+ +AYNK   D          + +     L+R   G
Sbjct: 181 LVVAIPAVMAYNKLASDVSGIQSTFSSYISVLGNRLARDRAG 222


>gi|260568758|ref|ZP_05839226.1| ExbB family protein [Brucella suis bv. 4 str. 40]
 gi|261754080|ref|ZP_05997789.1| biopolymer transporter ExbB [Brucella suis bv. 3 str. 686]
 gi|260154142|gb|EEW89224.1| ExbB family protein [Brucella suis bv. 4 str. 40]
 gi|261743833|gb|EEY31759.1| biopolymer transporter ExbB [Brucella suis bv. 3 str. 686]
          Length = 319

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 85  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 144

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 145 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 204

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 205 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 264

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 265 VAAIPAVVIYNVFARSITGYRALLADASASVERLVSRDLDFRTA 308


>gi|56415100|ref|YP_152175.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197364029|ref|YP_002143666.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|56129357|gb|AAV78863.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197095506|emb|CAR61070.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
          Length = 244

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 103/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +     
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQLQLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+             L+A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFACQIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|158422882|ref|YP_001524174.1| biopolymer transport protein [Azorhizobium caulinodans ORS 571]
 gi|158329771|dbj|BAF87256.1| biopolymer transport protein [Azorhizobium caulinodans ORS 571]
          Length = 394

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 100/226 (44%), Gaps = 5/226 (2%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S + +FM   + VK +++ L + S+++W++ + K +   T  RQ R        
Sbjct: 163 LLPHDLSPWGMFMAADIVVKVVMSGLALASVITWTIWLVKVLELTTANRQVRRALHTLRE 222

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +L    ++L        A +  SA+ E + S    A    GI++R+   ++   A   
Sbjct: 223 SSNLLGSARALP-PRGGASARLIQSALGELEASR---ALPAEGIKERVAISLNRIEAAAG 278

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             ++     L ++ S    +G+ G V G+M  F  I+   + N+  +   I E+L++  +
Sbjct: 279 RRMSLGTGLLATIGSTAPFIGLFGTVWGIMNSFIGISKAQTTNLAVVAPGIAEALLATAI 338

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ I YN F      +   +   + E    LSR  +   S
Sbjct: 339 GLVAAIPAVIIYNVFARAISNYKASLSDASAEVMRHLSRDLDREAS 384


>gi|254719671|ref|ZP_05181482.1| tonB-system energizer ExbB [Brucella sp. 83/13]
 gi|306840053|ref|ZP_07472840.1| tonB-system energizer ExbB [Brucella sp. NF 2653]
 gi|306404867|gb|EFM61159.1| tonB-system energizer ExbB [Brucella sp. NF 2653]
          Length = 307

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKVIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 296


>gi|26249572|ref|NP_755612.1| biopolymer transport protein ExbB [Escherichia coli CFT073]
 gi|306816653|ref|ZP_07450785.1| biopolymer transport protein ExbB [Escherichia coli NC101]
 gi|26109980|gb|AAN82185.1|AE016766_273 Biopolymer transport exbB protein [Escherichia coli CFT073]
 gi|305850218|gb|EFM50677.1| biopolymer transport protein ExbB [Escherichia coli NC101]
          Length = 244

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLYLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|307545153|ref|YP_003897632.1| biopolymer transporter TolQ [Halomonas elongata DSM 2581]
 gi|307217177|emb|CBV42447.1| K03562 biopolymer transport protein TolQ [Halomonas elongata DSM
           2581]
          Length = 225

 Score =  148 bits (374), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 76/220 (34%), Positives = 115/220 (52%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  L M     V+ ++ LL I S+LSW VI Q++      R+  REFE  FWSG  L 
Sbjct: 1   MSIPHLIMNASGVVQAVMLLLLIGSLLSWVVIFQRTFVMRRARKAHREFEDRFWSGVDLN 60

Query: 71  TVCKSLKNHHNI-GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
            + +      +  G   IF +   E+ +   K  RSP  I D + R M VA +RE + + 
Sbjct: 61  ELYRETPAEQDTLGTEHIFRAGFREFNRLLPKT-RSPQAILDGVQRSMRVAWSREEDRLN 119

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L FL +++S+   +G+ G V G+MG FQS++      +    P I E+LI+  +GL  
Sbjct: 120 LHLVFLATVASSSPYIGLFGTVWGIMGSFQSLSMAQQATLATVAPWIAEALIATAMGLFA 179

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ I YN+   +S +   + E FA EF +IL R  +G 
Sbjct: 180 AIPAVIFYNRLSAESSRLLGKYEDFAEEFHSILHRNLQGR 219


>gi|312171024|emb|CBX79283.1| Biopolymer transport exbB protein [Erwinia amylovora ATCC BAA-2158]
          Length = 244

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 99/222 (44%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L  MD+S++ ++    + VK ++  L + S+ +W++   KS+   + R++ +  +    +
Sbjct: 5   LMQMDLSVWGMYQHADIVVKAVMIGLLLASVATWAIFFSKSIELRSARKRLKREQLSLAA 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SLE   +         L+ + +   +E +      +    GI++R    ++  +A   
Sbjct: 65  ARSLEEALQIGGGFQRQSLSTLLVKE-AENELELSANSDDNNGIKERTAFRLERRVAAIG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHAGRGNGFLATIGSIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARTIASYKASLGDVAAQVLLLQSRDLD 225


>gi|71275799|ref|ZP_00652083.1| MotA/TolQ/ExbB proton channel [Xylella fastidiosa Dixon]
 gi|71900398|ref|ZP_00682531.1| MotA/TolQ/ExbB proton channel [Xylella fastidiosa Ann-1]
 gi|170730221|ref|YP_001775654.1| TolQ protein [Xylella fastidiosa M12]
 gi|71163377|gb|EAO13095.1| MotA/TolQ/ExbB proton channel [Xylella fastidiosa Dixon]
 gi|71729830|gb|EAO31928.1| MotA/TolQ/ExbB proton channel [Xylella fastidiosa Ann-1]
 gi|167965014|gb|ACA12024.1| TolQ protein [Xylella fastidiosa M12]
          Length = 257

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL + S  SW +I +K+  F    R+  +FE  FWSG  L 
Sbjct: 35  INYIDLMLKASIPVKIIVLLLLLGSFTSWVIIFRKARVFKQANREADQFENRFWSGTDLS 94

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +  +   GL AIF     E+ +  ++    P    +   R+M     RE++++
Sbjct: 95  KLYASTNSRKHMVSGLEAIFEGGFREFTRLRERRRLDPRIQIEGAQRVMRTNFMREMDQL 154

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 155 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGDQAGIAAVAPGISEALFATAVGL 214

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            V+IP+  AYN+F    ++ +++ E FA EFSAIL RQ
Sbjct: 215 FVAIPAVWAYNRFTTRVERLSVRYETFAEEFSAILQRQ 252


>gi|301019984|ref|ZP_07184117.1| TonB-system energizer ExbB [Escherichia coli MS 196-1]
 gi|331664621|ref|ZP_08365527.1| TonB-system energizer ExbB [Escherichia coli TA143]
 gi|299881990|gb|EFI90201.1| TonB-system energizer ExbB [Escherichia coli MS 196-1]
 gi|331058552|gb|EGI30533.1| TonB-system energizer ExbB [Escherichia coli TA143]
          Length = 244

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 104/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|324114962|gb|EGC08927.1| tonB-system energizer ExbB [Escherichia fergusonii B253]
          Length = 239

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 102/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFTKSVEFFKQKRRLKREQQLLADARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+   +   +     L+   ++      +    G+    GI++R    ++ ++A     +
Sbjct: 63  LDQASEIAGDFGKYSLSLQLLNEAQNELELS-AGSDDNDGIKERTSFRLERSVAAVGRYM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAQSQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNIFARQIAGFKAMLGDVAAQVLLLQSRDLD 220


>gi|225628238|ref|ZP_03786272.1| tonB-system energizer ExbB [Brucella ceti str. Cudo]
 gi|237816045|ref|ZP_04595041.1| tonB-system energizer ExbB [Brucella abortus str. 2308 A]
 gi|260547212|ref|ZP_05822950.1| ExbB protein [Brucella abortus NCTC 8038]
 gi|260565827|ref|ZP_05836310.1| ExbB family protein [Brucella melitensis bv. 1 str. 16M]
 gi|260755371|ref|ZP_05867719.1| biopolymer transporter ExbB [Brucella abortus bv. 6 str. 870]
 gi|260758592|ref|ZP_05870940.1| biopolymer transporter ExbB [Brucella abortus bv. 4 str. 292]
 gi|260762424|ref|ZP_05874761.1| biopolymer transporter ExbB [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884387|ref|ZP_05896001.1| ExbB [Brucella abortus bv. 9 str. C68]
 gi|261219261|ref|ZP_05933542.1| biopolymer transporter ExbB [Brucella ceti M13/05/1]
 gi|261222797|ref|ZP_05937078.1| ExbB [Brucella ceti B1/94]
 gi|261315961|ref|ZP_05955158.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316176|ref|ZP_05955373.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322322|ref|ZP_05961519.1| ExbB [Brucella ceti M644/93/1]
 gi|261325712|ref|ZP_05964909.1| ExbB [Brucella neotomae 5K33]
 gi|261757325|ref|ZP_06001034.1| biopolymer transporter ExbB [Brucella sp. F5/99]
 gi|265987240|ref|ZP_06099797.1| ExbB [Brucella pinnipedialis M292/94/1]
 gi|265991707|ref|ZP_06104264.1| ExbB [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995544|ref|ZP_06108101.1| ExbB [Brucella melitensis bv. 3 str. Ether]
 gi|265998755|ref|ZP_06111312.1| ExbB [Brucella ceti M490/95/1]
 gi|297248943|ref|ZP_06932651.1| biopolymer transporter ExbB [Brucella abortus bv. 5 str. B3196]
 gi|12802721|gb|AAK08069.1| ExbB [Brucella melitensis]
 gi|225616084|gb|EEH13132.1| tonB-system energizer ExbB [Brucella ceti str. Cudo]
 gi|237788708|gb|EEP62920.1| tonB-system energizer ExbB [Brucella abortus str. 2308 A]
 gi|260095577|gb|EEW79455.1| ExbB protein [Brucella abortus NCTC 8038]
 gi|260151200|gb|EEW86295.1| ExbB family protein [Brucella melitensis bv. 1 str. 16M]
 gi|260668910|gb|EEX55850.1| biopolymer transporter ExbB [Brucella abortus bv. 4 str. 292]
 gi|260672850|gb|EEX59671.1| biopolymer transporter ExbB [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675479|gb|EEX62300.1| biopolymer transporter ExbB [Brucella abortus bv. 6 str. 870]
 gi|260873915|gb|EEX80984.1| ExbB [Brucella abortus bv. 9 str. C68]
 gi|260921381|gb|EEX88034.1| ExbB [Brucella ceti B1/94]
 gi|260924350|gb|EEX90918.1| biopolymer transporter ExbB [Brucella ceti M13/05/1]
 gi|261295012|gb|EEX98508.1| ExbB [Brucella ceti M644/93/1]
 gi|261295399|gb|EEX98895.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301692|gb|EEY05189.1| ExbB [Brucella neotomae 5K33]
 gi|261304987|gb|EEY08484.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261737309|gb|EEY25305.1| biopolymer transporter ExbB [Brucella sp. F5/99]
 gi|262553444|gb|EEZ09213.1| ExbB [Brucella ceti M490/95/1]
 gi|262766828|gb|EEZ12446.1| ExbB [Brucella melitensis bv. 3 str. Ether]
 gi|263002663|gb|EEZ15066.1| ExbB [Brucella melitensis bv. 1 str. Rev.1]
 gi|264659437|gb|EEZ29698.1| ExbB [Brucella pinnipedialis M292/94/1]
 gi|297174076|gb|EFH33433.1| biopolymer transporter ExbB [Brucella abortus bv. 5 str. B3196]
          Length = 319

 Score =  148 bits (373), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 85  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 144

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 145 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 204

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 205 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 264

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 265 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 308


>gi|50119317|ref|YP_048484.1| biopolymer transport protein [Pectobacterium atrosepticum SCRI1043]
 gi|49609843|emb|CAG73277.1| biopolymer transport protein [Pectobacterium atrosepticum SCRI1043]
          Length = 304

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 95/222 (42%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++      VK ++  L + S+++W++   KSV     +R+ R        
Sbjct: 65  LMKTDLSVWGMYQHADAVVKTVMIGLLLASVITWAIFFSKSVEMSGAKRRLRREYLALEQ 124

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            ++L+   ++        +A   ++          + +    GI++R    ++  +A   
Sbjct: 125 AKTLDDALETADAFKTGSVAQQLLADAQNELDLSAR-SDDNNGIKERTAFRLERRVAATG 183

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 184 RHMGRGNGYLATVGAVAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 243

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 244 GLVAAIPAVVIYNVFARSIAGYKATVGDVAAQVLLLQSRDLD 285


>gi|258591273|emb|CBE67570.1| TolQ protein [NC10 bacterium 'Dutch sediment']
          Length = 239

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 61/233 (26%), Positives = 107/233 (45%), Gaps = 20/233 (8%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +++ +L +Q G+  + ++ +L  FS++SW++I  K   F   RR+  +F  +F S ++L 
Sbjct: 1   MNVVSLVVQAGVVAQAVLLILLGFSLMSWTLIFMKFGVFRRGRRESAQFLHIFRSAKNLT 60

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSE-------------------WKKSCDKGARSPIGIQD 111
           TV +  K      + ++F     E                     +S    A       D
Sbjct: 61  TVFEESKRFTKSPVVSVFQEGYRELSQLVKGGQGPAAQWPTANEPRSAVPEAPLHKEPLD 120

Query: 112 RIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS 171
            I R +  A  +E+ +    L FL +  +    VG+ G V G+M  F SI    S N+ +
Sbjct: 121 LISRTLRHASMKEVAQQERYLIFLATTGNVTPFVGLFGTVWGIMNAFASIGQAGSANLGA 180

Query: 172 IPG-IIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           +   + E+LI+   GL  +IP+ +AYN F+   ++ A +ME F  EF  +  R
Sbjct: 181 VAPGVAEALITTAAGLGAAIPAVVAYNYFLNRVRRQATEMELFGLEFLTLAER 233


>gi|145868|gb|AAA23732.1| exbB peptide [Escherichia coli]
          Length = 244

 Score =  148 bits (373), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 104/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F  L+R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNLKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|265999347|ref|ZP_05465915.2| ExbB [Brucella melitensis bv. 2 str. 63/9]
 gi|263093380|gb|EEZ17449.1| ExbB [Brucella melitensis bv. 2 str. 63/9]
          Length = 319

 Score =  148 bits (373), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 85  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 144

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 145 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 204

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 205 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 264

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 265 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 308


>gi|260550124|ref|ZP_05824338.1| biopolymer transporter [Acinetobacter sp. RUH2624]
 gi|260406879|gb|EEX00358.1| biopolymer transporter [Acinetobacter sp. RUH2624]
          Length = 292

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 50/221 (22%), Positives = 89/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +I+ K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIVSKFLQQAKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+     L+                   KS        I     +   +  AI
Sbjct: 119 SFWEATSLDNATDGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|157162484|ref|YP_001459802.1| biopolymer transport protein ExbB [Escherichia coli HS]
 gi|157068164|gb|ABV07419.1| TonB-system energizer ExbB [Escherichia coli HS]
          Length = 244

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTANLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|163845249|ref|YP_001622904.1| hypothetical protein BSUIS_B1144 [Brucella suis ATCC 23445]
 gi|163675972|gb|ABY40082.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
          Length = 307

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASHLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRALLADASASVERLVSRDLDFRTA 296


>gi|15838498|ref|NP_299186.1| TolQ protein [Xylella fastidiosa 9a5c]
 gi|9106995|gb|AAF84706.1|AE004010_3 TolQ protein [Xylella fastidiosa 9a5c]
          Length = 257

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL + S  SW +I +K+  F    R+  +FE  FWSG  L 
Sbjct: 35  INYIDLMLKASIPVKIIVLLLLLGSFTSWVIIFRKARVFKQANREADQFENRFWSGTDLS 94

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +  +   GL AIF     E+ +  ++    P    +   R+M     RE++++
Sbjct: 95  KLYASTNSRKHMVSGLEAIFEGGFREFTRLRERRRLDPRIQIEGAQRVMRTNFMREMDQL 154

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 155 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGDQAGIAAVAPGISEALFATAVGL 214

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            V+IP+  AYN+F    ++ +++ E FA EFSAIL RQ
Sbjct: 215 FVAIPAVWAYNRFTTRVERLSVRYETFAEEFSAILQRQ 252


>gi|270156708|ref|ZP_06185365.1| protein TolQ [Legionella longbeachae D-4968]
 gi|289164844|ref|YP_003454982.1| TolQ, involved in the tonB-independent uptake of proteins
           [Legionella longbeachae NSW150]
 gi|269988733|gb|EEZ94987.1| protein TolQ [Legionella longbeachae D-4968]
 gi|288858017|emb|CBJ11877.1| putative TolQ, involved in the tonB-independent uptake of proteins
           [Legionella longbeachae NSW150]
          Length = 224

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 62/216 (28%), Positives = 111/216 (51%), Gaps = 7/216 (3%)

Query: 12  SIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLET 71
           ++   FMQ GL VK ++ LL   SI SW++I Q++  F   ++    F + FW    L  
Sbjct: 6   NVLMYFMQAGLVVKTVMLLLAAASITSWTLIFQRAWFFNQKKQLTDAFNRRFWESADLSR 65

Query: 72  VCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +   + ++ +    +AAIF S   E+ ++  +G      + + I R+M +  A+E E++ 
Sbjct: 66  LYADVDSNSDERQGMAAIFHSGFREFIRARKQGNV----VIEPIQRVMQITHAKEAEKLE 121

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L F  S+ S    VG+ G V G+M  FQ++       + +  PGI E+L++  LGL  
Sbjct: 122 RHLPFFASVGSIAPYVGLFGTVWGIMTSFQALGHAQQATIAMVAPGISEALVATALGLFT 181

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           +IP+ IAYN++   +     + + F  E  +++ +Q
Sbjct: 182 AIPAVIAYNRYTTRANDLLNRFDLFQEELISLIEQQ 217


>gi|301643625|ref|ZP_07243666.1| TonB-system energizer ExbB [Escherichia coli MS 146-1]
 gi|301078009|gb|EFK92815.1| TonB-system energizer ExbB [Escherichia coli MS 146-1]
          Length = 239

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|269468526|gb|EEZ80180.1| biopolymer transport protein TolQ [uncultured SUP05 cluster
           bacterium]
          Length = 222

 Score =  148 bits (372), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 57/217 (26%), Positives = 102/217 (47%), Gaps = 3/217 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SIF+L +  G  V+ ++ +L + SI SW++I+ K    +  +R  + F   F +   LE
Sbjct: 5   LSIFSLIISAGFVVQVVMFILVLMSIYSWTIILSKKKILMDAKRDIKTFHNNFLTDTDLE 64

Query: 71  TVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            + K +         +  IF S   E+        ++ I   +R  R M+     E++ +
Sbjct: 65  KLHKKIPKVVSKRSPMEHIFGSGYGEFTHFSSSSNQALIMNSERAYRAMNTTANNEVDRL 124

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
              LS L  ++S+   +G+ G V G+M  F  +A      +  +   I E+LI+   GL 
Sbjct: 125 DGGLSVLAMIASSSPYIGLFGTVWGIMHSFIGLASVKQATIAIVAPGIAEALIATAFGLF 184

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +IP+++AYN+ +   +  A +   F  E   IL RQ
Sbjct: 185 AAIPATMAYNRLVSQVEGIANKYTAFIEELFVILQRQ 221


>gi|332091439|gb|EGI96524.1| tonB-system energizer ExbB [Shigella boydii 3594-74]
          Length = 239

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 101/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+    +      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLFNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|302189466|ref|ZP_07266139.1| tolQ protein [Pseudomonas syringae pv. syringae 642]
          Length = 236

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 106/220 (48%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I+ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F S   L 
Sbjct: 8   MTIWGLISDASLLVKAVMLILLLASLVSWFLIIQRSLALRHYERSMDAFQQRFRSAAELA 67

Query: 71  TVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +     +       +  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  PLQAQASSAQRDAGGIGEVFAAGYAEYLQLKQRPGIEPDVVLSGVERSLQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            +IP+ IAYN+F    +    +   F NE    L+R  +G
Sbjct: 188 AAIPAVIAYNRFAARGQTLTARYYSFGNELQVRLNRTLQG 227


>gi|299770380|ref|YP_003732406.1| biopolymer transport protein [Acinetobacter sp. DR1]
 gi|298700468|gb|ADI91033.1| biopolymer transport protein [Acinetobacter sp. DR1]
          Length = 292

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKFLQQAKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+    +L+                   KS        I     +   +  AI
Sbjct: 119 SFWEATSLDNAADNLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKIQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|292486957|ref|YP_003529827.1| biopolymer transport exbb protein [Erwinia amylovora CFBP1430]
 gi|291552374|emb|CBA19419.1| Biopolymer transport exbB protein [Erwinia amylovora CFBP1430]
          Length = 239

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 46/219 (21%), Positives = 98/219 (44%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+S++ ++    + VK ++  L + S+ +W++   KS+   + R++ +  +    + +S
Sbjct: 3   MDLSVWGMYQHADIVVKAVMIGLLLASVATWAIFFSKSIELRSARKRLKREQLSLAAARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           LE   +         L+ + +   +E +      +    GI++R    ++  +A      
Sbjct: 63  LEEALQIGGGFQRQSLSTLLVKE-AENELELSANSDDNNGIKERTAFRLERQVAAIGRHA 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                FL ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGFLATIGSIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARTIASYKASLGDVAAQVLLLQSRDLD 220


>gi|110643244|ref|YP_670974.1| biopolymer transport protein ExbB [Escherichia coli 536]
 gi|110806907|ref|YP_690427.1| biopolymer transport protein ExbB [Shigella flexneri 5 str. 8401]
 gi|300818770|ref|ZP_07098976.1| TonB-system energizer ExbB [Escherichia coli MS 107-1]
 gi|300821591|ref|ZP_07101737.1| TonB-system energizer ExbB [Escherichia coli MS 119-7]
 gi|300901385|ref|ZP_07119471.1| TonB-system energizer ExbB [Escherichia coli MS 198-1]
 gi|300905865|ref|ZP_07123598.1| TonB-system energizer ExbB [Escherichia coli MS 84-1]
 gi|300916885|ref|ZP_07133588.1| TonB-system energizer ExbB [Escherichia coli MS 115-1]
 gi|300923665|ref|ZP_07139692.1| TonB-system energizer ExbB [Escherichia coli MS 182-1]
 gi|300931892|ref|ZP_07147189.1| TonB-system energizer ExbB [Escherichia coli MS 187-1]
 gi|300935666|ref|ZP_07150638.1| TonB-system energizer ExbB [Escherichia coli MS 21-1]
 gi|300950785|ref|ZP_07164672.1| TonB-system energizer ExbB [Escherichia coli MS 116-1]
 gi|300958391|ref|ZP_07170531.1| TonB-system energizer ExbB [Escherichia coli MS 175-1]
 gi|300973363|ref|ZP_07172163.1| TonB-system energizer ExbB [Escherichia coli MS 45-1]
 gi|300993145|ref|ZP_07180231.1| TonB-system energizer ExbB [Escherichia coli MS 200-1]
 gi|301048179|ref|ZP_07195215.1| TonB-system energizer ExbB [Escherichia coli MS 185-1]
 gi|301304190|ref|ZP_07210306.1| TonB-system energizer ExbB [Escherichia coli MS 124-1]
 gi|309785160|ref|ZP_07679791.1| tonB-system energizer ExbB [Shigella dysenteriae 1617]
 gi|309793571|ref|ZP_07687997.1| TonB-system energizer ExbB [Escherichia coli MS 145-7]
 gi|312968660|ref|ZP_07782869.1| tonB-system energizer ExbB [Escherichia coli 2362-75]
 gi|312972731|ref|ZP_07786904.1| tonB-system energizer ExbB [Escherichia coli 1827-70]
 gi|331659287|ref|ZP_08360229.1| TonB-system energizer ExbB [Escherichia coli TA206]
 gi|331684650|ref|ZP_08385242.1| TonB-system energizer ExbB [Escherichia coli H299]
 gi|110344836|gb|ABG71073.1| biopolymer transport ExbB protein [Escherichia coli 536]
 gi|110616455|gb|ABF05122.1| Biopolymer transport exbB protein [Shigella flexneri 5 str. 8401]
 gi|300299937|gb|EFJ56322.1| TonB-system energizer ExbB [Escherichia coli MS 185-1]
 gi|300305160|gb|EFJ59680.1| TonB-system energizer ExbB [Escherichia coli MS 200-1]
 gi|300314900|gb|EFJ64684.1| TonB-system energizer ExbB [Escherichia coli MS 175-1]
 gi|300355157|gb|EFJ71027.1| TonB-system energizer ExbB [Escherichia coli MS 198-1]
 gi|300402334|gb|EFJ85872.1| TonB-system energizer ExbB [Escherichia coli MS 84-1]
 gi|300410792|gb|EFJ94330.1| TonB-system energizer ExbB [Escherichia coli MS 45-1]
 gi|300415855|gb|EFJ99165.1| TonB-system energizer ExbB [Escherichia coli MS 115-1]
 gi|300420032|gb|EFK03343.1| TonB-system energizer ExbB [Escherichia coli MS 182-1]
 gi|300449955|gb|EFK13575.1| TonB-system energizer ExbB [Escherichia coli MS 116-1]
 gi|300459139|gb|EFK22632.1| TonB-system energizer ExbB [Escherichia coli MS 21-1]
 gi|300460315|gb|EFK23808.1| TonB-system energizer ExbB [Escherichia coli MS 187-1]
 gi|300525729|gb|EFK46798.1| TonB-system energizer ExbB [Escherichia coli MS 119-7]
 gi|300528555|gb|EFK49617.1| TonB-system energizer ExbB [Escherichia coli MS 107-1]
 gi|300840603|gb|EFK68363.1| TonB-system energizer ExbB [Escherichia coli MS 124-1]
 gi|307555099|gb|ADN47874.1| TonB-dependent enterochelin uptake protein [Escherichia coli ABU
           83972]
 gi|308122528|gb|EFO59790.1| TonB-system energizer ExbB [Escherichia coli MS 145-7]
 gi|308926280|gb|EFP71756.1| tonB-system energizer ExbB [Shigella dysenteriae 1617]
 gi|310332673|gb|EFP99886.1| tonB-system energizer ExbB [Escherichia coli 1827-70]
 gi|312286878|gb|EFR14789.1| tonB-system energizer ExbB [Escherichia coli 2362-75]
 gi|315256907|gb|EFU36875.1| TonB-system energizer ExbB [Escherichia coli MS 85-1]
 gi|315288761|gb|EFU48159.1| TonB-system energizer ExbB [Escherichia coli MS 110-3]
 gi|315295040|gb|EFU54377.1| TonB-system energizer ExbB [Escherichia coli MS 153-1]
 gi|315297741|gb|EFU57018.1| TonB-system energizer ExbB [Escherichia coli MS 16-3]
 gi|315615009|gb|EFU95647.1| tonB-system energizer ExbB [Escherichia coli 3431]
 gi|323154705|gb|EFZ40904.1| tonB-system energizer ExbB [Escherichia coli EPECa14]
 gi|323163060|gb|EFZ48893.1| tonB-system energizer ExbB [Escherichia coli E128010]
 gi|323168150|gb|EFZ53837.1| tonB-system energizer ExbB [Shigella sonnei 53G]
 gi|323178714|gb|EFZ64290.1| tonB-system energizer ExbB [Escherichia coli 1180]
 gi|323183595|gb|EFZ68992.1| tonB-system energizer ExbB [Escherichia coli 1357]
 gi|323935990|gb|EGB32285.1| tonB-system energizer ExbB [Escherichia coli E1520]
 gi|323941893|gb|EGB38072.1| tonB-system energizer ExbB [Escherichia coli E482]
 gi|323946747|gb|EGB42767.1| tonB-system energizer ExbB [Escherichia coli H120]
 gi|323951473|gb|EGB47348.1| tonB-system energizer ExbB [Escherichia coli H252]
 gi|323957845|gb|EGB53559.1| tonB-system energizer ExbB [Escherichia coli H263]
 gi|323960945|gb|EGB56564.1| tonB-system energizer ExbB [Escherichia coli H489]
 gi|323971866|gb|EGB67091.1| tonB-system energizer ExbB [Escherichia coli TA007]
 gi|323978920|gb|EGB74000.1| tonB-system energizer ExbB [Escherichia coli TW10509]
 gi|324005413|gb|EGB74632.1| TonB-system energizer ExbB [Escherichia coli MS 57-2]
 gi|324011898|gb|EGB81117.1| TonB-system energizer ExbB [Escherichia coli MS 60-1]
 gi|324018149|gb|EGB87368.1| TonB-system energizer ExbB [Escherichia coli MS 117-3]
 gi|324119620|gb|EGC13501.1| tonB-system energizer ExbB [Escherichia coli E1167]
 gi|331053869|gb|EGI25898.1| TonB-system energizer ExbB [Escherichia coli TA206]
 gi|331078265|gb|EGI49471.1| TonB-system energizer ExbB [Escherichia coli H299]
 gi|332088502|gb|EGI93619.1| tonB-system energizer ExbB [Shigella dysenteriae 155-74]
 gi|332998949|gb|EGK18540.1| tonB-system energizer ExbB [Shigella flexneri VA-6]
 gi|332999759|gb|EGK19343.1| tonB-system energizer ExbB [Shigella flexneri K-272]
 gi|333015625|gb|EGK34964.1| tonB-system energizer ExbB [Shigella flexneri K-227]
          Length = 239

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|320354284|ref|YP_004195623.1| cell division and transport-associated protein TolQ [Desulfobulbus
           propionicus DSM 2032]
 gi|320122786|gb|ADW18332.1| Cell division and transport-associated protein TolQ [Desulfobulbus
           propionicus DSM 2032]
          Length = 230

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 62/226 (27%), Positives = 106/226 (46%), Gaps = 9/226 (3%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           M +SIF +    G+  K I+ +L IFS+ SWS++I K + F   R    +F   FW  ++
Sbjct: 1   MSLSIFEIMKHAGMMGKLIMLILLIFSVASWSIVIMKFLMFRKARNASLDFLDAFWDSKT 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKK--------SCDKGARSPIGIQDRIDRMMDVA 120
           L     + + +     A +F++  +E KK               + +   D + R +  A
Sbjct: 61  LNEAYDAAREYPLSPEATVFVTGYNELKKISAARSAGQALATLETQLATMDNLKRAVRKA 120

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
              E + +   +S L +  SA   +G+ G V G+M  FQSI    S ++  +   I E+L
Sbjct: 121 QFLESDRLASYISVLATTGSATPFIGLFGTVWGIMASFQSIGERGSASLAVVAPGISEAL 180

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           ++   GL V+IP+ I YN F     +F   +E F+ +F  ++ R  
Sbjct: 181 VATAAGLAVAIPAVIFYNYFSNKVAEFDSNVESFSTDFINLIERDI 226


>gi|227358185|ref|ZP_03842526.1| ExbB protein [Proteus mirabilis ATCC 29906]
 gi|227161521|gb|EEI46558.1| ExbB protein [Proteus mirabilis ATCC 29906]
          Length = 336

 Score =  148 bits (372), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 50/218 (22%), Positives = 104/218 (47%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+  ++    L VK ++  L + SI++W++   K    + LRR+ R         +SL
Sbjct: 113 DLSVMGMYRNADLVVKSVMIGLLLASIVTWALFFAKGSYLLALRRRLRNESAQLVEAKSL 172

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +      +   N    A+F +  +E +++  + +    GI++R++  M+  +A  + E+ 
Sbjct: 173 KEALAISQKFGNKSATAVFFN-DAELERTYSQDSHVASGIKERVEMRMERRVAAIIRELG 231

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
               +L ++ +    +G+ G V G+M  F  IA   + N+  +   I E+L++  +GL  
Sbjct: 232 RGNGYLATIGAISPFIGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATAIGLIA 291

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ I YN F      +  ++   A     ++SR  +
Sbjct: 292 AIPAVIIYNIFARMISGYRGEIGDIATGVVTLVSRDLD 329


>gi|331654615|ref|ZP_08355615.1| TonB-system energizer ExbB [Escherichia coli M718]
 gi|331047997|gb|EGI20074.1| TonB-system energizer ExbB [Escherichia coli M718]
          Length = 244

 Score =  148 bits (372), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQSELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|331010851|gb|EGH90907.1| tolQ protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 236

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 57/220 (25%), Positives = 106/220 (48%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           ++I+ L     L VK ++ +L + S++SW +IIQ+S+      R    F+Q F +   L 
Sbjct: 8   MTIWGLISDASLLVKAVMLILLLASLVSWYLIIQRSLALGHYERTLDAFQQRFRAEAELA 67

Query: 71  TVCK--SLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           T+            G+  +F +  +E+ +   +    P  +   ++R + VAI+ +  ++
Sbjct: 68  TLYAESHSAQEGADGIERVFNAGYAEYVQLKPRPGIEPDVVPSGVERALQVAISEQELQL 127

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
            + L FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  +GL 
Sbjct: 128 EKGLQFLATVGSVSPYIGLFGTVWGIMNSFIGLSQVQQATLSTVAPGIAEALIATAIGLF 187

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
            ++P+ IAYN F    +    +   F NE    L+R  +G
Sbjct: 188 AALPAVIAYNCFAARGQTLTARYYSFGNELQVRLNRTLQG 227


>gi|307730278|ref|YP_003907502.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1003]
 gi|307584813|gb|ADN58211.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1003]
          Length = 242

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 91/228 (39%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L + S+LSWSVI+ K  N + L R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALALLVMSVLSWSVIVVKGWNVVRLNRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMS------AMSEWKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L    +      F++        ++            + + D + 
Sbjct: 54  QAFWHSDDLADGVKKLGAGSSTPQDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAIVAKLSRFAHGLHAFF 221


>gi|182677234|ref|YP_001831380.1| tonB-system energizer ExbB [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182633117|gb|ACB93891.1| tonB-system energizer ExbB [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 355

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 97/224 (43%), Gaps = 7/224 (3%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
              D+S + +F    + V+ ++  L   S+++W++ I K +  +   R  R    +    
Sbjct: 115 IPHDLSPWGMFTHADIIVQGVMLGLLFASLVTWTIGIAKCLELMAGDRNARRGLNILSGA 174

Query: 67  QSLETVCKSLK---NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           QSL     +L+         +A +  +A++E ++S         G+++R   ++     R
Sbjct: 175 QSLRLADSALEGTLGRGKGVVAKLVSAAIAEAERSQ---GLPADGVKERAAALLSRIEIR 231

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISI 182
               +T     L ++ + G  VG+ G V G+M  F  I+   + N+  +   I E+L++ 
Sbjct: 232 ASRAMTRGTGLLATIGATGPFVGLFGTVWGIMNSFIGISKSNTTNLAVVAPGIAEALLAT 291

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             GL  +IP+ I YN F      +   +   + E    LSR  +
Sbjct: 292 ACGLVAAIPAVIIYNVFSRAIAGYKGILGDASTEVLRHLSRDLD 335


>gi|261214638|ref|ZP_05928919.1| biopolymer transporter ExbD [Brucella abortus bv. 3 str. Tulya]
 gi|260916245|gb|EEX83106.1| biopolymer transporter ExbD [Brucella abortus bv. 3 str. Tulya]
          Length = 319

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 85  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 144

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 145 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 204

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 205 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 264

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 265 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 308


>gi|224584956|ref|YP_002638755.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|224469484|gb|ACN47314.1| biopolymer transport ExbB protein [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
          Length = 248

 Score =  147 bits (371), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 102/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F T + + +  +     
Sbjct: 5   LMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKLRLKREQLQLAD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+             L+A  ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|301325646|ref|ZP_07219110.1| TonB-system energizer ExbB [Escherichia coli MS 78-1]
 gi|300847564|gb|EFK75324.1| TonB-system energizer ExbB [Escherichia coli MS 78-1]
 gi|323966535|gb|EGB61968.1| tonB-system energizer ExbB [Escherichia coli M863]
 gi|327251789|gb|EGE63475.1| tonB-system energizer ExbB [Escherichia coli STEC_7v]
          Length = 239

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 103/219 (47%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAQARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++   +  +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLLNEAQDELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|261819732|ref|YP_003257838.1| tonB-system energizer ExbB [Pectobacterium wasabiae WPP163]
 gi|261603745|gb|ACX86231.1| tonB-system energizer ExbB [Pectobacterium wasabiae WPP163]
          Length = 332

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 46/222 (20%), Positives = 98/222 (44%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++      VK ++  L + S+++WS+   KSV     +R+ R        
Sbjct: 93  LMKTDLSVWGMYQHADAVVKTVMIGLLLASVITWSIFFSKSVEMSGAKRRLRREYLALEQ 152

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            ++L+   ++  +     +A   +       +   + +    GI++R    ++  +A   
Sbjct: 153 AKTLDDALETADSFKAGSVALQLLEDAQNELELSAR-SDDNNGIKERTAFRLERRVAATG 211

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  + PGI E+L++  +
Sbjct: 212 RHMGRGNGYLATVGAVAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 271

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 272 GLVAAIPAVVIYNVFARSIAGYKATVGDVAAQVLLLQSRDLD 313


>gi|301017299|ref|ZP_07182063.1| TonB-system energizer ExbB [Escherichia coli MS 69-1]
 gi|300400272|gb|EFJ83810.1| TonB-system energizer ExbB [Escherichia coli MS 69-1]
          Length = 239

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/219 (22%), Positives = 103/219 (47%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F T +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|184157951|ref|YP_001846290.1| biopolymer transport protein [Acinetobacter baumannii ACICU]
 gi|183209545|gb|ACC56943.1| Biopolymer transport protein [Acinetobacter baumannii ACICU]
          Length = 292

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 119 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|161619600|ref|YP_001593487.1| tonB-system energizer ExbB [Brucella canis ATCC 23365]
 gi|254703450|ref|ZP_05165278.1| tonB-system energizer ExbB [Brucella suis bv. 3 str. 686]
 gi|161336411|gb|ABX62716.1| tonB-system energizer ExbB [Brucella canis ATCC 23365]
          Length = 307

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRALLADASASVERLVSRDLDFRTA 296


>gi|39995139|ref|NP_951090.1| tolQ protein [Geobacter sulfurreducens PCA]
 gi|39981901|gb|AAR33363.1| tolQ protein [Geobacter sulfurreducens PCA]
 gi|298504169|gb|ADI82892.1| TolQ-related biopolymer transport membrane proton channel
           [Geobacter sulfurreducens KN400]
          Length = 225

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/225 (27%), Positives = 101/225 (44%), Gaps = 10/225 (4%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
             LF   GL VK ++ +L  FS++SW++I  K +       +   F   FW  +  + + 
Sbjct: 1   MTLFAGTGLVVKLVLVVLIFFSVVSWAIIFFKLLQINRANGESDRFLDFFWKTKRFDAIS 60

Query: 74  KSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPI---------GIQDRIDRMMDVAIARE 124
             L    N  L+ +F    +E ++  DKG              G  D I R +  A   E
Sbjct: 61  SQLDRFGNSPLSVLFNEGYAELRRLLDKGGEQRDEPGVVSTDLGGIDNIARALRRATTSE 120

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
           +  + + ++FL +  S    +G+ G V G+M  F+ I    S ++  +   I E+LI+  
Sbjct: 121 ITRLEKYVTFLATTGSTAPFIGLFGTVWGIMNAFKGIGETGSASLAVVAPGIAEALIATA 180

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +GL  +IP+ +AYN F    K     M+ F+ EF  I+ R   G 
Sbjct: 181 IGLVAAIPAVMAYNHFQHKIKVLIASMDNFSTEFLNIVQRTFAGK 225


>gi|320539417|ref|ZP_08039086.1| membrane spanning protein in TonB-ExbB-ExbD complex [Serratia
           symbiotica str. Tucson]
 gi|320030542|gb|EFW12552.1| membrane spanning protein in TonB-ExbB-ExbD complex [Serratia
           symbiotica str. Tucson]
          Length = 304

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 101/227 (44%), Gaps = 2/227 (0%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           +       MD+S++ ++    + VK ++  L + SI++W+++  K       +R+    +
Sbjct: 60  IQPPATGNMDLSVWGMYQHADIVVKVVMIGLVLASIVTWTILFAKGSELFCAKRRLLREQ 119

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
            L     SL+   K  ++     ++A+ ++       +    +    GI++R    ++  
Sbjct: 120 WLLAEVHSLDEASKLAQSFSEQSISAVLLNDAQNEL-ALSAKSNDNSGIKERTGFRLERR 178

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
           +A    ++     FL ++ +    +G+ G V G+M  F  IA   + N+  +   I E+L
Sbjct: 179 VAAYSRDMARGSGFLATIGAISPFIGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEAL 238

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           ++  LGLC +IP+ + YN F         Q+   A +   + SR  +
Sbjct: 239 LATALGLCAAIPAVVIYNIFARVISSHRAQVSDVAAQVMLLQSRDLD 285


>gi|239502172|ref|ZP_04661482.1| biopolymer transport protein [Acinetobacter baumannii AB900]
          Length = 292

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 119 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|306844657|ref|ZP_07477242.1| tonB-system energizer ExbB [Brucella sp. BO1]
 gi|306274829|gb|EFM56599.1| tonB-system energizer ExbB [Brucella sp. BO1]
          Length = 307

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGMKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRGLLADASAGVERLVSRDLDFRTA 296


>gi|62290541|ref|YP_222334.1| biopolymer transport protein ExbB [Brucella abortus bv. 1 str.
           9-941]
 gi|189024761|ref|YP_001935529.1| MotA/TolQ/ExbB proton channel [Brucella abortus S19]
 gi|225853130|ref|YP_002733363.1| TonB-system energizer ExbB [Brucella melitensis ATCC 23457]
 gi|254689838|ref|ZP_05153092.1| tonB-system energizer ExbB [Brucella abortus bv. 6 str. 870]
 gi|254697986|ref|ZP_05159814.1| tonB-system energizer ExbB [Brucella abortus bv. 2 str. 86/8/59]
 gi|254708464|ref|ZP_05170292.1| tonB-system energizer ExbB [Brucella pinnipedialis M163/99/10]
 gi|254708684|ref|ZP_05170495.1| tonB-system energizer ExbB [Brucella pinnipedialis B2/94]
 gi|254714531|ref|ZP_05176342.1| tonB-system energizer ExbB [Brucella ceti M644/93/1]
 gi|254717429|ref|ZP_05179240.1| tonB-system energizer ExbB [Brucella ceti M13/05/1]
 gi|254730872|ref|ZP_05189450.1| tonB-system energizer ExbB [Brucella abortus bv. 4 str. 292]
 gi|256030210|ref|ZP_05443824.1| tonB-system energizer ExbB [Brucella pinnipedialis M292/94/1]
 gi|256045279|ref|ZP_05448173.1| tonB-system energizer ExbB [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061708|ref|ZP_05451845.1| tonB-system energizer ExbB [Brucella neotomae 5K33]
 gi|256114238|ref|ZP_05454983.1| tonB-system energizer ExbB [Brucella melitensis bv. 3 str. Ether]
 gi|256160384|ref|ZP_05458074.1| tonB-system energizer ExbB [Brucella ceti M490/95/1]
 gi|256255592|ref|ZP_05461128.1| tonB-system energizer ExbB [Brucella ceti B1/94]
 gi|256258091|ref|ZP_05463627.1| tonB-system energizer ExbB [Brucella abortus bv. 9 str. C68]
 gi|260167886|ref|ZP_05754697.1| tonB-system energizer ExbB [Brucella sp. F5/99]
 gi|294850922|ref|ZP_06791598.1| biopolymer transporter ExbB [Brucella sp. NVSL 07-0026]
 gi|62196673|gb|AAX74973.1| ExbB, biopolymer transport protein ExbB [Brucella abortus bv. 1
           str. 9-941]
 gi|189020333|gb|ACD73055.1| MotA/TolQ/ExbB proton channel [Brucella abortus S19]
 gi|225641495|gb|ACO01409.1| tonB-system energizer ExbB [Brucella melitensis ATCC 23457]
 gi|294821565|gb|EFG38561.1| biopolymer transporter ExbB [Brucella sp. NVSL 07-0026]
 gi|326409679|gb|ADZ66744.1| MotA/TolQ/ExbB proton channel [Brucella melitensis M28]
          Length = 307

 Score =  147 bits (371), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 296


>gi|296162470|ref|ZP_06845261.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. Ch1-1]
 gi|295887283|gb|EFG67110.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. Ch1-1]
          Length = 243

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 92/228 (40%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L I S++SW+VI+ K  N + L+R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALTLLIMSVMSWTVIVIKGWNVMRLKRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMS------AMSEWKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L    +      F++        ++            + + D + 
Sbjct: 54  QAFWHSDDLADGVKKLGAGSSTPQDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAVVAKLSRFAHGLHAFF 221


>gi|300724564|ref|YP_003713889.1| ExbB [Xenorhabdus nematophila ATCC 19061]
 gi|297631106|emb|CBJ91794.1| ExbB [Xenorhabdus nematophila ATCC 19061]
          Length = 333

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/220 (22%), Positives = 101/220 (45%), Gaps = 2/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S++ ++      VK ++  L I S+++W++   K    +  RR+ R+ +    +  
Sbjct: 103 ATDLSVWGMYQNADAVVKSVMVGLVIASVITWALFFSKGTELLMARRRLRKEQLSLANVA 162

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +LE   K  +N     ++ + +S     +++    +    GI++R    M+ A+A     
Sbjct: 163 NLEAAAKIAENFDKQSISRLLLSEAQ-SERALSAASTDKEGIKERTSFRMERAVAAISRH 221

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL
Sbjct: 222 MGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGL 281

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      +  Q+   A +   +L R  +
Sbjct: 282 MAAIPAVVIYNIFARVISSYRGQVGDMAAQAILLLGRDLD 321


>gi|332086664|gb|EGI91804.1| tonB-system energizer ExbB [Shigella boydii 5216-82]
          Length = 239

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLINEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|197283944|ref|YP_002149816.1| biopolymer transport protein [Proteus mirabilis HI4320]
 gi|194681431|emb|CAR40269.1| biopolymer transport protein [Proteus mirabilis HI4320]
          Length = 336

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 52/218 (23%), Positives = 105/218 (48%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S+  ++    L VK ++  L + SI++W++   K    + LRR+ R         +SL
Sbjct: 113 DLSVMGMYRNADLVVKSVMIGLLLASIVTWALFFAKGSYLLALRRRLRNESAQLVEAKSL 172

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +      +   N    A F +  +E +++  + +    GI++R++  M+  +A  + E+ 
Sbjct: 173 KEALAISQKFGNKSATADFFN-DAELERTYSQDSHVASGIKERVEMRMERRVAAIIRELG 231

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISILLGLCV 188
               +L ++ +    +G+ G V G+M  F  IA   + N+  + PGI E+L++  +GL  
Sbjct: 232 RGNGYLATIGAISPFIGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATAIGLIA 291

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ I YN F      +  ++   A     ++SR  +
Sbjct: 292 AIPAVIIYNIFARMISGYRGEIGDIATGVVTLVSRDLD 329


>gi|262394687|ref|YP_003286541.1| MotA/TolQ/ExbB proton channel family protein [Vibrio sp. Ex25]
 gi|262338281|gb|ACY52076.1| MotA/TolQ/ExbB proton channel family protein [Vibrio sp. Ex25]
          Length = 211

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/201 (30%), Positives = 101/201 (50%), Gaps = 3/201 (1%)

Query: 28  ITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG--LA 85
           +  L   SI+SW++II++S       +   +FE  FWSG  L  + + +K   +      
Sbjct: 1   MLTLLGMSIVSWAMIIKRSKVLSQASKNAEQFEDKFWSGTDLSQLYQKVKARKDEIEGTE 60

Query: 86  AIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLV 145
            IF +  +E+ +     A SP  I +   R M VA++RE++E+   L FL ++ S    +
Sbjct: 61  EIFYAGFTEFARLRKSNANSPAYIMEGTGRAMRVAVSREVDELETSLPFLATVGSISPYI 120

Query: 146 GILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSK 204
           G+ G V G+M  F ++       + +  PGI E+LI+  +GL  +IP+ +AYN+      
Sbjct: 121 GLFGTVWGIMHAFIALGEVKQATLSMVAPGIAEALIATAMGLFAAIPAVMAYNRLSNKVS 180

Query: 205 KFAMQMEGFANEFSAILSRQT 225
           K       F+ EF +IL RQ 
Sbjct: 181 KLEHTYATFSEEFHSILHRQA 201


>gi|218887452|ref|YP_002436773.1| protein TolQ [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218758406|gb|ACL09305.1| protein TolQ [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 231

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 56/219 (25%), Positives = 105/219 (47%), Gaps = 2/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I ++  Q  L  K I+ LL + SI SW+++ QK       +R+  +    F   + L 
Sbjct: 1   MDILSILAQATLVAKFILVLLVLMSIGSWTLMFQKWFALKAAQRKAADGLDRFQKARDLR 60

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
              +SL       L  +    ++E+ +  + G+ S   + D + R +   +  E+  ++ 
Sbjct: 61  EAVQSLGGDAASPLYHVAQQGVAEFNRLKEAGS-SGDVVADNVRRSLRQGVGNEMTRLSA 119

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVS 189
            LSFL + ++    +G+ G V G+M  F +I    S ++    PGI E+LI+  +GL V+
Sbjct: 120 SLSFLATAANTAPFIGLFGTVWGIMYSFHAIGQMKSASLATVAPGISEALIATAIGLFVA 179

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP+++ YN F+       +Q+  FA  F   + R+   +
Sbjct: 180 IPATVGYNIFLGMISSIEVQLVNFAGAFLNRVQREINAH 218


>gi|253686750|ref|YP_003015940.1| tonB-system energizer ExbB [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753328|gb|ACT11404.1| tonB-system energizer ExbB [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 336

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 94/222 (42%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++      VK ++  L + S+++W++   KSV     +R+ R        
Sbjct: 97  LMKTDLSVWGMYQHADAVVKTVMIGLLLASVITWAIFFSKSVEMSGAKRRLRREYLALEQ 156

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            ++L+   ++        +A   +       +   +      GI++R    ++  +A   
Sbjct: 157 AKTLDDALETADAFKTGSVAQQLLVDAQNELELSARS-DDNNGIKERTAFRLERRVAATG 215

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 216 RHMGRGNGYLATVGAVAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 275

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 276 GLVAAIPAVVIYNVFARSIASYKAMVGDVAAQVLLLQSRDLD 317


>gi|301347557|ref|ZP_07228298.1| biopolymer transport protein [Acinetobacter baumannii AB056]
 gi|301513106|ref|ZP_07238343.1| biopolymer transport protein [Acinetobacter baumannii AB058]
 gi|301597536|ref|ZP_07242544.1| biopolymer transport protein [Acinetobacter baumannii AB059]
          Length = 292

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 119 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|193077254|gb|ABO12032.2| biopolymer transport protein [Acinetobacter baumannii ATCC 17978]
          Length = 292

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 119 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|148550415|ref|YP_001270517.1| TonB-system energizer ExbB type-1 [Pseudomonas putida F1]
 gi|148514473|gb|ABQ81333.1| TonB-system energizer ExbB type-1 [Pseudomonas putida F1]
          Length = 324

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 99/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R     
Sbjct: 89  SLGMA-HDLSPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQ 147

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                +L+   +         LA   +    E  +     AR   GI++R+   ++  + 
Sbjct: 148 LKKSTTLKEASEVSN--KEGTLAHTLVHDALEEMRLST-NAREKEGIKERVSFRLERLVH 204

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 205 ASGRTMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 264

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 265 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 309


>gi|312796625|ref|YP_004029547.1| TolQ protein [Burkholderia rhizoxinica HKI 454]
 gi|312168400|emb|CBW75403.1| TolQ protein [Burkholderia rhizoxinica HKI 454]
          Length = 244

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 57/228 (25%), Positives = 91/228 (39%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYG+A        ++ Q     + I   L I S+LSWSVI+ K  N + LRR  R  E
Sbjct: 1   MQNYGMA-------HVWAQGDFVTRGIAITLLIMSVLSWSVILIKGWNVLRLRRLTRNTE 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMS------AMSEWKKSCDKGARSPIGIQDRID 114
           Q FW           L +  +      F++        ++            + I D I 
Sbjct: 54  QQFWHSDDFTEGLVKLGSTGSGAADNPFVALALSGKEAADHHHKSQPHLHDRMDISDWIT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIP 173
           R +   +   + ++   L+ L S+ S    VG+ G V G+     +I      ++     
Sbjct: 114 RCLKDTMDDCVAQMQSGLAVLASIGSTAPFVGLFGTVWGIYHALLTIGATGDTSIDKVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + ESLI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGESLIMTAFGLFVAIPAVLGYNALTRSNKAVVTKLNRFAHGLHAYF 221


>gi|261750827|ref|ZP_05994536.1| biopolymer transporter ExbB [Brucella suis bv. 5 str. 513]
 gi|261740580|gb|EEY28506.1| biopolymer transporter ExbB [Brucella suis bv. 5 str. 513]
          Length = 319

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 93/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 85  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 144

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G ++R+   +    A+    
Sbjct: 145 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGFKERVASRLSRIEAKAGRR 204

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 205 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 264

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 265 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 308


>gi|24114312|ref|NP_708822.1| biopolymer transport protein ExbB [Shigella flexneri 2a str. 301]
 gi|30064360|ref|NP_838531.1| biopolymer transport protein ExbB [Shigella flexneri 2a str. 2457T]
 gi|24053470|gb|AAN44529.1| enterochelin transporter (uptake) [Shigella flexneri 2a str. 301]
 gi|30042617|gb|AAP18341.1| enterochelin transporter (uptake) [Shigella flexneri 2a str. 2457T]
 gi|281602396|gb|ADA75380.1| Biopolymer transport protein exbB [Shigella flexneri 2002017]
          Length = 244

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 103/222 (46%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYQYADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL        +  +  L+   ++      +   +G+    GI++R    ++  +A   
Sbjct: 65  ARSLNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 184 GLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 225


>gi|332344963|gb|AEE58297.1| tonB-system energizer ExbB [Escherichia coli UMNK88]
          Length = 239

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNLANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|295701103|ref|YP_003608996.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1002]
 gi|295440316|gb|ADG19485.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1002]
          Length = 256

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 94/228 (41%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M +YGLA        ++       + I+ +L I S+LSW+V+I K    I LRR   + +
Sbjct: 1   MQHYGLA-------NVWDSGDFVTRGILGVLVIMSVLSWTVLIVKLWQVIRLRRVTSQSD 53

Query: 61  QLFWSGQSLETVCKSLKNH----HNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRID 114
             FWS    +    +L       H+  L A+ ++        +   +     I + D I 
Sbjct: 54  ARFWSADRFDDGLHALGYPDSSAHDNPLLALALAGHEAATHHRQTQQQLHDRIDVSDWIT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+      I      ++     
Sbjct: 114 RRLQDTMDETIARLQSGLAILASIGSTAPFVGLFGTVWGIYHALIVIGETGQTSIDHVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + ESLI    GL V+IP+ + YN     ++    +++ FA+   A  
Sbjct: 174 PVGESLIMTAFGLFVAIPAVLGYNGLTRANRSIVARLKRFAHGLHAYF 221


>gi|332974346|gb|EGK11276.1| TolQ colicin import protein [Psychrobacter sp. 1501(2011)]
          Length = 246

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 61/222 (27%), Positives = 114/222 (51%), Gaps = 3/222 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I++ +L     L V+ ++ +L + S+L W +I + S    T +RQ + FE  FWSG+ L 
Sbjct: 8   INLISLVTNASLLVQVVMGILLLASVLCWVLIFRLSARLGTAKRQDQHFENWFWSGEDLA 67

Query: 71  TVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
            + + ++N  +  GLA IF    SE+ +  +K  +    I D ++R + V + R+ + + 
Sbjct: 68  KMYQGIQNSPDRHGLANIFYVGFSEFLRM-NKKRQPKDHIIDGVERKLRVGLGRQQQSLE 126

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
             L+ L S+ S    +G+ G V G+M  F  ++     ++ ++   I E+LI+  +GL  
Sbjct: 127 SGLAVLASIGSVSPYIGLFGTVWGIMNAFIGLSEASQVSLSAVAPGIAEALIATAMGLFA 186

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           +IP+ +AYN F   +         F +E + +L R+T    +
Sbjct: 187 AIPAVLAYNHFTAKAAGIYDSRALFCDEMTGMLQRETHETAT 228


>gi|311278071|ref|YP_003940302.1| tonB-system energizer ExbB [Enterobacter cloacae SCF1]
 gi|308747266|gb|ADO47018.1| tonB-system energizer ExbB [Enterobacter cloacae SCF1]
          Length = 243

 Score =  147 bits (370), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 99/222 (44%), Gaps = 2/222 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VK ++  L + S+++W++   KS   I+ +R+ +  +QL   
Sbjct: 5   LMQTDLSVWGMYHHADIVVKVVMIGLVLASVVTWAIFFSKSAELISHKRRLKREQQLLGD 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL              L+   +S     ++    GA    GI++R    ++  +A   
Sbjct: 65  ARSLNQASDIAGAFEAKSLSRQLISEAQN-ERELSAGAEDYEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ + YN F      +   +   A +   + SR  +
Sbjct: 184 GLFAAIPAVVIYNVFARMIGSYKALLGDVAAQVLLLQSRDLD 225


>gi|307579946|gb|ADN63915.1| protein TolQ [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 256

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL + S  SW +I +K+  F    R+  +FE  FWSG  L 
Sbjct: 34  INYIDLMLKASIPVKIIVLLLLLGSFTSWLIIFRKARVFKQANREADQFENRFWSGTDLS 93

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +  +   GL AIF     E+ +  ++    P    +   R+M     RE++++
Sbjct: 94  KLYASTNSRKHMVSGLEAIFEGGFREFTRLRERRRLDPRIQIEGAQRVMRTNFMREMDQL 153

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 154 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGDQAGIAAVAPGISEALFATAVGL 213

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            V+IP+  AYN+F    ++ +++ E FA EFSAIL RQ
Sbjct: 214 FVAIPAVWAYNRFTTRLERLSVRYETFAEEFSAILQRQ 251


>gi|295676102|ref|YP_003604626.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1002]
 gi|295435945|gb|ADG15115.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1002]
          Length = 243

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 57/228 (25%), Positives = 92/228 (40%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L I S++SWSVI+ K  N + L+R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALALLIMSVMSWSVIVVKGWNVVRLKRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLK----NHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L       H+    A+ +S                  + + D I 
Sbjct: 54  QAFWHSDDLADGVKKLGGGASTPHDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWIT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAIVAKLSRFAHGLHAFF 221


>gi|288550403|ref|ZP_05970300.2| TonB-system energizer ExbB [Enterobacter cancerogenus ATCC 35316]
 gi|288315079|gb|EFC54017.1| TonB-system energizer ExbB [Enterobacter cancerogenus ATCC 35316]
          Length = 238

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 103/223 (46%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VK ++  L + S+++W++   KSV  I+ +R+ +  +Q     +S
Sbjct: 3   TDLSVWGMYHHADIVVKIVMIGLILASVVTWAIFFSKSVELISQKRRLKREQQQLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+       + H   L ++ ++      +    G+    GI++R    ++  +A     +
Sbjct: 63  LDQASDMTSSFHAKSLTSLLVNEAQNELELS-AGSEDNEGIKERTGFRLERRVAAVGRHM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNIFARMIGSYKATLGDVAAQVLLLQSRDLDLNAS 224


>gi|262373303|ref|ZP_06066582.1| TolQ [Acinetobacter junii SH205]
 gi|262313328|gb|EEY94413.1| TolQ [Acinetobacter junii SH205]
          Length = 291

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 87/221 (39%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +I+ K      ++R   E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKTTLFILVLMSIGTWYIILSKLFQQSKIKRHGTEAER 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   +L +  +SL                    K  D      I     +   +  AI
Sbjct: 119 NFWEADTLNSAKESL---DPSSTYRYIAEKGIHSTKHHDGTLLERIDFNTWVTISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 DKVQSHLGNGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMDNVRSFGSDLHAVL 276


>gi|153873820|ref|ZP_02002274.1| MotA/TolQ/ExbB proton channel [Beggiatoa sp. PS]
 gi|152069718|gb|EDN67730.1| MotA/TolQ/ExbB proton channel [Beggiatoa sp. PS]
          Length = 236

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 65/228 (28%), Positives = 117/228 (51%), Gaps = 4/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +  +++S   L ++  L V+ ++ LL + SI SW++I +KS      RR    FE  FW 
Sbjct: 1   MPELNLSFIQLILEASLLVQMVMLLLLLISIYSWTLIFRKSRFLKRARRTSDHFEDRFWK 60

Query: 66  GQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
            + L  +   +  +     G+A IF S   E+ K   +   +P  + +   R M VA+ R
Sbjct: 61  FKDLNALYNRIVSEEEEPKGMANIFTSGYMEFVKLRKQPNITPTTLLEGSQRAMRVALHR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLIS 181
           E++E+   L+ L ++ S    +G+ G V G+M  F ++          +  PGI E+LI+
Sbjct: 121 EMDELDANLATLATVGSVSPYIGLFGTVWGIMNSFHALGTMEQQVTLAMVAPGISEALIA 180

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNI 229
             +GL  +IP+ +AYN +++D  +   + + F +EF++IL RQ    +
Sbjct: 181 TAMGLFAAIPAVMAYNNYVDDVDRLITRYDTFLDEFTSILQRQAHSML 228


>gi|300718399|ref|YP_003743202.1| Biopolymer transport ExbB protein [Erwinia billingiae Eb661]
 gi|299064235|emb|CAX61355.1| Biopolymer transport ExbB protein [Erwinia billingiae Eb661]
          Length = 238

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/219 (21%), Positives = 96/219 (43%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VK ++  L + S+++W++   KS      +R+ +  +      +S
Sbjct: 3   TDLSVWGMYQHADIVVKVVMIGLLLASVVTWAIFFSKSFELSAAKRRLKNEQNALAGARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+   +   +     L   F+   +E +     G+    GI++R    ++  +A      
Sbjct: 63  LQEAAQISASFKAGSLTTQFLKE-AENELELSAGSDDDNGIKERTSFRLERRVAFFSRHA 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGFLATIGAIAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      +   M   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARLIGNYKASMGDVAAQVMLLQSRDLD 220


>gi|253999469|ref|YP_003051532.1| MotA/TolQ/ExbB proton channel [Methylovorus sp. SIP3-4]
 gi|313201498|ref|YP_004040156.1| mota/tolq/exbb proton channel [Methylovorus sp. MP688]
 gi|253986148|gb|ACT51005.1| MotA/TolQ/ExbB proton channel [Methylovorus sp. SIP3-4]
 gi|312440814|gb|ADQ84920.1| MotA/TolQ/ExbB proton channel [Methylovorus sp. MP688]
          Length = 247

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/215 (24%), Positives = 90/215 (41%), Gaps = 2/215 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + +  A     G+    +   L + S+ SW +II K +  + LR   R + Q FW   SL
Sbjct: 6   EFNSLAFITDGGVVSITVALCLLVMSVASWYLIIVKGIQSLRLRAASRNYSQRFWDASSL 65

Query: 70  ETVCKSLKN-HHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           E   +          LA   + A    ++   K         + + R M   I+ E   +
Sbjct: 66  EVAIRENGVSTPMSRLANQAVEAAEHHQRHASKRLADACNQDEFVARSMRRVISDEGARL 125

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGLC 187
              L+ L S+ S    VG+ G V G+     SI+      +      + E+LI    GL 
Sbjct: 126 ENGLTILASVGSVSPFVGLFGTVWGIYHALASISMSGQATLDKVAGPVGEALIMTAFGLA 185

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILS 222
           V+IP+ +AYN  +  ++    Q++ FAN+   +L+
Sbjct: 186 VAIPAVLAYNALVRSNRVLMAQLDSFANDLHVLLT 220


>gi|325122037|gb|ADY81560.1| putative biopolymer transport protein ExbB [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 293

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 67  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 119

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 120 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 176

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 177 EKIQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 236

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 237 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 277


>gi|293608231|ref|ZP_06690534.1| ExbB protein [Acinetobacter sp. SH024]
 gi|292828804|gb|EFF87166.1| ExbB protein [Acinetobacter sp. SH024]
          Length = 292

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 119 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKIQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|300310025|ref|YP_003774117.1| biopolymer transport transmembrane protein [Herbaspirillum
           seropedicae SmR1]
 gi|300072810|gb|ADJ62209.1| biopolymer transport transmembrane protein [Herbaspirillum
           seropedicae SmR1]
          Length = 243

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 87/222 (39%), Gaps = 8/222 (3%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           ++ YGL        +L+ Q     K +  LL   SI SW VII K++  + LR+      
Sbjct: 3   VSPYGLE-------SLWAQGDFVTKGVAVLLLAMSIASWYVIITKALQLLRLRKASAAAG 55

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
             FW   +L     +L   +     A           +        + + D +   +  A
Sbjct: 56  HQFWDTTNLPEGVATLGQDNPFAEVAKAGVTAMSHHTAHKGHLHDQLSVSDWVTLSLRQA 115

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESL 179
           I     ++   ++ L S+ S    VG+ G V G+     SI      ++      + E+L
Sbjct: 116 IDEASGKLQAGMAVLASVGSTAPFVGLFGTVWGIYHALVSIGTTGQASIDKVAGPVGEAL 175

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           I   LGL V+IP++  YN  +  +K    ++  F  +  A+ 
Sbjct: 176 IMTALGLAVAIPATFGYNALVRGNKTILAKLNKFGFDLHALF 217


>gi|91775230|ref|YP_544986.1| MotA/TolQ/ExbB proton channel [Methylobacillus flagellatus KT]
 gi|91775374|ref|YP_545130.1| MotA/TolQ/ExbB proton channel [Methylobacillus flagellatus KT]
 gi|91709217|gb|ABE49145.1| outer membrane transport energization protein ExbB [Methylobacillus
           flagellatus KT]
 gi|91709361|gb|ABE49289.1| outer membrane transport energization protein ExbB [Methylobacillus
           flagellatus KT]
          Length = 249

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 50/215 (23%), Positives = 90/215 (41%), Gaps = 2/215 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + +     +  G     +  +L   S+ SW +++ K    +T+R   RE+   FW   S+
Sbjct: 6   EFNSLDFILDGGPVSILVAVVLVFMSVASWYLMVVKFYQALTIRSANREYSNSFWQASSI 65

Query: 70  ETVCKS-LKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           E+  +          +A   + A    +              + I R M   I+ E E +
Sbjct: 66  ESALRHDSGETIVSRVANQAVDAAEHHQSHVGSNVEDACNKDEFIARAMRRQISAESERL 125

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGLC 187
              L+ L S+ S    VG+ G V G+     SI+      +      + E+LI   LGL 
Sbjct: 126 DYGLTMLASVGSVAPFVGLFGTVWGIYHALASISQSGQATLDKVAGPVGEALIMTALGLA 185

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILS 222
           V+IP+ +AYN  +  ++    ++E FAN+   +L+
Sbjct: 186 VAIPAVLAYNALVRRNRLILSEVEAFANDLHILLT 220


>gi|299769118|ref|YP_003731144.1| protein TolQ [Acinetobacter sp. DR1]
 gi|298699206|gb|ADI89771.1| protein TolQ [Acinetobacter sp. DR1]
          Length = 232

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  +++    ++   F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMSYKKAHQEDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   +SE+ K   + A     I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRQAPVSQTI-EGTERILRVGLSRDQSHLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 YGLGTLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F   S+        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTSKSESVYSDRALFAEEMIALLQRQSVGS 227


>gi|317049560|ref|YP_004117208.1| tonB-system energizer ExbB [Pantoea sp. At-9b]
 gi|316951177|gb|ADU70652.1| tonB-system energizer ExbB [Pantoea sp. At-9b]
          Length = 247

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 99/227 (43%), Gaps = 3/227 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VK ++  L + S+++W++   K     + +R+ +        
Sbjct: 6   LMQTDLSVWGMYHHADIVVKVVMIGLLLASVVTWAIFFGKFAELSSAKRRLKREHLALSD 65

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+    +  +      +A+ ++      +    G     GI++R    ++  +A   
Sbjct: 66  ARSLDDAASTAASFKGNSHSAVLLNDAQNELELS-AGVEDTDGIKERTSFRLERRVAAFS 124

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
                   FL ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 125 RHAGRGNGFLATIGSVAPFIGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 184

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE-GNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + GN++
Sbjct: 185 GLVAAIPAVVIYNVFARMIAGYKASLGDVAAQVLLLQSRDLDLGNVT 231


>gi|330957280|gb|EGH57540.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 287

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I S+++W++ I K    +  +R+ R    
Sbjct: 47  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASVITWTIWISKGFELLGAKRRLRGEIV 105

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     S        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 106 NLKKARSLNEASASAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 162

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 163 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 222

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 223 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 268


>gi|254694330|ref|ZP_05156158.1| tonB-system energizer ExbB [Brucella abortus bv. 3 str. Tulya]
          Length = 307

 Score =  146 bits (369), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 296


>gi|91777657|ref|YP_552865.1| bipolymer transport protein MotA/TolQ/ExbB family [Burkholderia
           xenovorans LB400]
 gi|91690317|gb|ABE33515.1| outer membrane transport energization protein ExbB [Burkholderia
           xenovorans LB400]
          Length = 262

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 93/229 (40%), Gaps = 15/229 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M +YGLA        ++    +  +CI+  L I S+LSW+VI+ K    + +RR  R+ E
Sbjct: 1   MQHYGLA-------NVWESGDIVTRCILGTLLIMSVLSWTVILVKLWTIVRIRRVTRQAE 53

Query: 61  QLFWSGQSLETVCKSLK-------NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRI 113
             FW     E   KSL          + +   A+     +   +         I + D I
Sbjct: 54  AQFWRADRFEDGLKSLGAEASKSVRDNPLLALALAGEEAAAHHRQTQSHLHDRIDVSDWI 113

Query: 114 DRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSI 172
            R +   +   +  +   L+ L S+ S    VG+ G V G+      I      ++    
Sbjct: 114 TRRLQDTMDDAIARMQSGLAVLASIGSTAPFVGLFGTVWGIYHALILIGETGQTSIDHVA 173

Query: 173 PGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
             + ESLI    GL V+IP+ + YN     +K    +++ FA+   A  
Sbjct: 174 GPVGESLIMTAFGLFVAIPAVLGYNGLTRANKSVVTRLKRFAHGLHAYF 222


>gi|330964243|gb|EGH64503.1| TonB system transport protein ExbB [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 318

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 78  NSLGMA-HDLSPWGMYQNADIVVKIVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 136

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 137 NLKKARSLTEASATAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 193

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 194 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 253

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 254 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 299


>gi|87198415|ref|YP_495672.1| MotA/TolQ/ExbB proton channel [Novosphingobium aromaticivorans DSM
           12444]
 gi|87134096|gb|ABD24838.1| Cell division and transport-associated protein TolQ
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 227

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 103/222 (46%), Gaps = 1/222 (0%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A+ D S  ALF Q  + VK I+  L   SI +W++I+ + +           FE      
Sbjct: 5   AVTDFSPIALFAQADIVVKVIMLGLLAASIWTWAIIVAQILKNRRAHATSDLFEAEIREA 64

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
                  K L    +   A    +     K    + +      ++RI  +++ AI  E++
Sbjct: 65  GFTGESSKHLARDASPAAALFKAAMAEWSKSVRARASLDKDAARERIADVLEGAIEGEVD 124

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            ++E+L++L ++ S    VG+ G V G+M  F SIA   + ++  +   I E+L++  +G
Sbjct: 125 RLSERLNYLATIGSIAPFVGLFGTVWGIMRSFTSIAASQNTSLSVVAPGIAEALLATAIG 184

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           L  +IP+ IAYN+F     +F  ++  FA      LSR+ + 
Sbjct: 185 LFAAIPAVIAYNRFGHSLNRFEARLVRFARYLRGNLSRELDA 226


>gi|209520630|ref|ZP_03269383.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. H160]
 gi|209498913|gb|EDZ99015.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. H160]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 92/228 (40%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L + S++SWSVI+ K  N + L+R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALALLLMSVMSWSVIVVKGWNVMRLKRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLK----NHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L       H+    A+ +S                  + + D I 
Sbjct: 54  QAFWHSDDLADGVKKLGGGAPTPHDNPFVALALSGQEAADHHHQTQPHLHDRMDVSDWIT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASSQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAIVAKLSRFAHGLHAFF 221


>gi|260555170|ref|ZP_05827391.1| TolQ [Acinetobacter baumannii ATCC 19606]
 gi|260411712|gb|EEX05009.1| TolQ [Acinetobacter baumannii ATCC 19606]
 gi|322508270|gb|ADX03724.1| MotA/TolQ/ExbB proton channel [Acinetobacter baumannii 1656-2]
 gi|323517896|gb|ADX92277.1| biopolymer transport protein [Acinetobacter baumannii TCDC-AB0715]
          Length = 293

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 67  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 119

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 120 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 176

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 177 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 236

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 237 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 277


>gi|262278155|ref|ZP_06055940.1| tolerance protein to group A colicins [Acinetobacter calcoaceticus
           RUH2202]
 gi|262258506|gb|EEY77239.1| tolerance protein to group A colicins [Acinetobacter calcoaceticus
           RUH2202]
          Length = 232

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  +++    ++   F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMSYKKAHQEDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   +SE+ K   + A     I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRQAPVSQTI-EGTERILRVGLSRDQSHLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 YGLGSLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F   S+        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTSKSESVYSDRALFAEEMIALLQRQSVGS 227


>gi|237797794|ref|ZP_04586255.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|331020644|gb|EGI00701.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 313

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 73  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIA 131

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     S        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 132 NLKKARSLNEASASAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 188

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 189 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 248

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 249 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 294


>gi|51597681|ref|YP_071872.1| MotA/TolQ/ExbB proton channel family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|145597776|ref|YP_001161852.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Pestoides F]
 gi|186896821|ref|YP_001873933.1| tonB-system energizer ExbB [Yersinia pseudotuberculosis PB1/+]
 gi|51590963|emb|CAH22621.1| Possible MotA/TolQ/ExbB proton channel family protein [Yersinia
           pseudotuberculosis IP 32953]
 gi|145209472|gb|ABP38879.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Pestoides F]
 gi|186699847|gb|ACC90476.1| tonB-system energizer ExbB [Yersinia pseudotuberculosis PB1/+]
          Length = 345

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 100/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 108 AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 167

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 168 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 226

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL
Sbjct: 227 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGL 286

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 287 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 317


>gi|37222145|gb|AAP49338.1| ExbB [uncultured bacterium]
          Length = 238

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 47/222 (21%), Positives = 87/222 (39%), Gaps = 11/222 (4%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
            YG+A       +++ Q    +K +  +L I SI SW VI+ ++     LRR  +     
Sbjct: 4   PYGIA-------SIWQQGDALIKGVAIILLIMSIASWWVIVVRAWGLWRLRRPSQG-LND 55

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRIDRMMDVA 120
           FW  QS     ++L    +     +     +      +        + + + +   +  +
Sbjct: 56  FWHAQSFAEGLRTLGEDRSTPFRHLAEEGQAALDHHSNHKDDLHGHLPLAEWLTACLRGS 115

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESL 179
           I    E +   L+ L S+ S    VG+ G V G+      I      ++      + E+L
Sbjct: 116 IDESAERLQRGLAILASVGSTAPFVGLFGTVWGIYHALVGIGISGQASIDKVAGPVGEAL 175

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           I    GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 176 IMTAFGLAVAIPAVLGYNALTRANKGVLNKLNRFAHQLHAYF 217


>gi|332286929|ref|YP_004418840.1| putative TolQ-like translocation protein [Pusillimonas sp. T7-7]
 gi|330430882|gb|AEC22216.1| putative TolQ-like translocation protein [Pusillimonas sp. T7-7]
          Length = 224

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 60/209 (28%), Positives = 106/209 (50%), Gaps = 4/209 (1%)

Query: 19  QMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKN 78
              + V+ ++ +L   SILSW+ I  K         Q R FE  FW+G  L  + +++  
Sbjct: 15  DASVPVQFVMLVLLGISILSWAYIFSKRAALKRANEQTRRFEDDFWAGGDLSVLQQAIAT 74

Query: 79  HH--NIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLG 136
               +  LA IF + M+E+ K+  + + +   + D   R M     RE++ +   L+FL 
Sbjct: 75  RRAEHGALARIFDAGMTEFIKAR-RNSSNGDAVLDGPRRAMRATYQREMDSLESHLNFLA 133

Query: 137 SMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIA 195
           S  S    +G+LG V G+M  F  ++      + ++   I E+LI+  +GL  +IP+ IA
Sbjct: 134 SAGSVSPYIGLLGTVWGIMHAFIGLSSMQQATLSAVAPGIAEALIATAIGLFAAIPAVIA 193

Query: 196 YNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           YN++  +  + +++ + F +EF  IL RQ
Sbjct: 194 YNRYTNEIDRLSIRFDSFIDEFLNILQRQ 222


>gi|91782684|ref|YP_557890.1| biopolymer transport transmembrane protein, MotA/TolQ/ExbB like
           [Burkholderia xenovorans LB400]
 gi|91686638|gb|ABE29838.1| outer membrane transport energization protein ExbB [Burkholderia
           xenovorans LB400]
          Length = 242

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 54/228 (23%), Positives = 92/228 (40%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L I S++SWSVI+ K  N + L+R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALTLLIMSVMSWSVIVIKGWNVMRLKRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMS------AMSEWKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L    +      F++        ++            + + D + 
Sbjct: 54  QAFWHSDDLADGVKKLGAGSSTPQDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAVVAKLSRFAHGLHAFF 221


>gi|320016755|gb|ADW00327.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 345

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 45/211 (21%), Positives = 100/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 108 AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 167

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 168 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 226

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS-IPGIIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  I    + N+    PGI E+L++  LGL
Sbjct: 227 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGITHSQTTNLAVIAPGIAEALLATALGL 286

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 287 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 317


>gi|313648123|gb|EFS12569.1| tonB-system energizer ExbB [Shigella flexneri 2a str. 2457T]
 gi|332752681|gb|EGJ83066.1| tonB-system energizer ExbB [Shigella flexneri K-671]
 gi|332753066|gb|EGJ83450.1| tonB-system energizer ExbB [Shigella flexneri 4343-70]
 gi|332754574|gb|EGJ84940.1| tonB-system energizer ExbB [Shigella flexneri 2747-71]
 gi|332765487|gb|EGJ95705.1| tonB-system energizer ExbB [Shigella flexneri 2930-71]
 gi|333000327|gb|EGK19910.1| tonB-system energizer ExbB [Shigella flexneri K-218]
 gi|333014917|gb|EGK34262.1| tonB-system energizer ExbB [Shigella flexneri K-304]
          Length = 239

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F   +R+ +  +QL    +S
Sbjct: 3   TDLSVWGMYQYADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L        +  +  L+   ++      +   +G+    GI++R    ++  +A    ++
Sbjct: 63  LNQANDIAADFGSKSLSLHLLNEAQNELELS-EGSDDNEGIKERTSFRLERRVAAVGRQM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      F   +   A +   + SR  +
Sbjct: 182 AAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLD 220


>gi|62181671|ref|YP_218088.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|62129304|gb|AAX67007.1| uptake of enterochelin; tonB-dependent uptake of B colicins
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|322716155|gb|EFZ07726.1| biopolymer transport protein ExbB [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 243

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 101/223 (45%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VKC++  L + S+++W++   KSV F T + + +  +      +S
Sbjct: 3   TDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFTQKLRLKREQLQLADARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+             L+A  ++      +   +G+    GI++R    ++  +A     +
Sbjct: 63  LDQASDIAAGFSAKSLSAQLINEAQNELELS-QGSEDNEGIKERTGFRLERRVAAIGRYM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLV 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 182 AAIPAVVIYNIFARQIGSYKATLGDVAAQVLLLQSRDLDLNAS 224


>gi|332162965|ref|YP_004299542.1| MotA/TolQ/ExbB proton channel family protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325667195|gb|ADZ43839.1| MotA/TolQ/ExbB proton channel family protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 336

 Score =  146 bits (368), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 46/216 (21%), Positives = 100/216 (46%), Gaps = 3/216 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             GLA MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ ++  ++
Sbjct: 95  PQGLA-MDLSVWGMYQHADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLQQEHEV 153

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
             +   L+T  +         ++ + +      ++     +    GI++R    ++  +A
Sbjct: 154 IGAVTDLDTASERAAAFSPESISGLLLREAQN-ERLLSAESNDNNGIKERTAFRLERRVA 212

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
               ++ +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 213 AISRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 272

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             LGL  +IP+ + YN F      +  Q+   A + 
Sbjct: 273 TALGLVAAIPAVVIYNIFARLIGSYRAQVGDVAAQV 308


>gi|298484814|ref|ZP_07002914.1| MotA/TolQ/ExbB proton channel family protein [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298160668|gb|EFI01689.1| MotA/TolQ/ExbB proton channel family protein [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 317

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 102/226 (45%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 77  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 135

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 136 NLKKARSLNEASSTAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 192

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 193 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 252

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 253 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 298


>gi|153003578|ref|YP_001377903.1| Tol-Pal system TolQ [Anaeromyxobacter sp. Fw109-5]
 gi|152027151|gb|ABS24919.1| Tol-Pal system TolQ [Anaeromyxobacter sp. Fw109-5]
          Length = 245

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/222 (23%), Positives = 106/222 (47%), Gaps = 8/222 (3%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +  F +    G     ++ LL   S +SW++I++K +     + +  +F + FW  + L+
Sbjct: 21  LDYFEIAKNSGPIGIGVLLLLLGASAVSWAIIVKKWLQIRRAQDESVKFLETFWQSKRLD 80

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDK-------GARSPIGIQDRIDRMMDVAIAR 123
            + ++ ++     ++ +F +   E  K   +            +G  + ++R +  A A 
Sbjct: 81  AIYQAAESLSASPISQVFRAGYVELSKVTAQKKEGGEGSMSDELGGIENVERALKRAAAS 140

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E+  +  ++ FLG+ +SA   VG+ G V G+M  F  I    + N+      I E+LI+ 
Sbjct: 141 EVTHLEAQVPFLGTTASAAPFVGLFGTVWGIMRAFHDIYQAGNANLATVAKPISEALIAT 200

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            +GL  +IP+ +AYN F+   +    +M  F+N+F  I+ R 
Sbjct: 201 AVGLFAAIPAVVAYNYFVSKIRVLDSEMTNFSNDFLNIVRRH 242


>gi|184159153|ref|YP_001847492.1| biopolymer transport protein [Acinetobacter baumannii ACICU]
 gi|183210747|gb|ACC58145.1| Biopolymer transport protein [Acinetobacter baumannii ACICU]
          Length = 232

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 111/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  +++   R+    F+++FWSG    
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMSYKKARQDDEHFQKMFWSGAEFN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   +SE+ K   + A +   I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRQAPTSQMI-EGTERILRVGLSRDQGSLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 YGLGTLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F   S+        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTAKSESVYSDRALFAEEMIALLQRQSVGS 227


>gi|169796121|ref|YP_001713914.1| putative transporter; putative MotA/TolQ/ExbB proton channel
           [Acinetobacter baumannii AYE]
 gi|213157146|ref|YP_002319191.1| biopolymer transport protein [Acinetobacter baumannii AB0057]
 gi|215483575|ref|YP_002325796.1| MotA/TolQ/ExbB proton channel family protein [Acinetobacter
           baumannii AB307-0294]
 gi|169149048|emb|CAM86925.1| putative transporter; putative MotA/TolQ/ExbB proton channel
           [Acinetobacter baumannii AYE]
 gi|213056306|gb|ACJ41208.1| biopolymer transport protein [Acinetobacter baumannii AB0057]
 gi|213988205|gb|ACJ58504.1| MotA/TolQ/ExbB proton channel family protein [Acinetobacter
           baumannii AB307-0294]
          Length = 293

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 67  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 119

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 120 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 176

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 177 EKVQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 236

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 237 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 277


>gi|113460405|ref|YP_718467.1| biopolymer transport protein [Haemophilus somnus 129PT]
 gi|112822448|gb|ABI24537.1| Cell division and transport-associated protein TolQ [Haemophilus
           somnus 129PT]
          Length = 227

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 65/222 (29%), Positives = 112/222 (50%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++    LF++  + V+ +I +L  FSI+SW++IIQ+S       +    FE+ FWSG+ L
Sbjct: 4   ELDFLELFLKASIVVQIVIVILISFSIISWAIIIQRSRILTRALKDSTLFEERFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   L N  N       IF     E+ +       +P  I     R M++A+ RE+E+
Sbjct: 64  YKLYDGLSNRRNGLNSSERIFYVGFKEFNRLKQANPDAPEAIIQGSSRAMNLAMNREVED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G 
Sbjct: 184 FAAIPAVMAYNRLSLRVNKLEQNYANFIDEFTTILHRQAFGK 225


>gi|148559259|ref|YP_001259522.1| ExbB protein [Brucella ovis ATCC 25840]
 gi|148370516|gb|ABQ60495.1| ExbB [Brucella ovis ATCC 25840]
          Length = 310

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 44/224 (19%), Positives = 94/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G+++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGLKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + Y+ F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYDVFARSITGYRALLADASAGVERLVSRDLDFRTA 296


>gi|297539697|ref|YP_003675466.1| MotA/TolQ/ExbB proton channel [Methylotenera sp. 301]
 gi|297259044|gb|ADI30889.1| MotA/TolQ/ExbB proton channel [Methylotenera sp. 301]
          Length = 247

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 53/214 (24%), Positives = 96/214 (44%), Gaps = 2/214 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + +  A     G     +  +L   S+ SW +I+ KS+    +R+ F+ + Q FW+  +L
Sbjct: 6   EFNSLAFITAGGPVSIGVALILLAMSVASWYLIVSKSLQAWRVRQAFKVYAQHFWNAPNL 65

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
               K         LA   ++A +E  K+        +   + + R ++ +IA E  ++ 
Sbjct: 66  AVAMKQNNKTALASLAKNAIAA-AEHHKTHVSKNSEKVAQDEFVARALNRSIAEENTKME 124

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGLCV 188
             LS L S+ S    VG+ G V G+     SI+      +      + E+LI   LGL V
Sbjct: 125 NGLSVLASVGSVSPFVGLFGTVWGIYHALASISQSGQATLDKVAGPVGEALIMTALGLAV 184

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILS 222
           +IP+ +AYN  +  ++  A ++E F      +L+
Sbjct: 185 AIPAVLAYNALVRSNRLLAAELEDFGYTLHTLLT 218


>gi|254700331|ref|ZP_05162159.1| tonB-system energizer ExbB [Brucella suis bv. 5 str. 513]
          Length = 307

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 45/224 (20%), Positives = 93/224 (41%), Gaps = 1/224 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM     VK ++  L I S+ +W+V + KS+     RR+  +  ++     
Sbjct: 73  PHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKSLELAGARRRANKALKIIGHSA 132

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     +L      G A +  +                 G ++R+   +    A+    
Sbjct: 133 TLNDAVHALDGAKGPGAAFVRAAEDEVRLSGPALARAGGEGFKERVASRLSRIEAKAGRR 192

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +GL
Sbjct: 193 LAKGTGILATIGSVAPFVGLFGTVWGIMNSFINISEAQTTNLAVVAPGIAEALLATAIGL 252

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 253 VAAIPAVVIYNVFARSITGYRALLADASAGVERLVSRDLDFRTA 296


>gi|157803962|ref|YP_001492511.1| hypothetical protein A1E_03995 [Rickettsia canadensis str. McKiel]
 gi|157785225|gb|ABV73726.1| hypothetical protein A1E_03995 [Rickettsia canadensis str. McKiel]
          Length = 242

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 73/206 (35%), Positives = 118/206 (57%), Gaps = 3/206 (1%)

Query: 24  VKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG 83
            K ++ +LFI SI SW++I+ K    + ++R+ R FE +FWSG+ LE +  S+K   N  
Sbjct: 33  GKSVMLILFIASIWSWAIILNKIFKLMQVQRRMRAFENVFWSGRVLEQLYDSIKRSVNNP 92

Query: 84  LAAIFMSAMSEWKKSCDKGARS--PIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSA 141
           LA IF+SAM E K    KG         + RI  +M +A  RE+E++ + LSFL ++ S+
Sbjct: 93  LALIFVSAMDECKSLNSKGLSDALKNNHKGRITGVMYLAQNREIEKLEKNLSFLATVGSS 152

Query: 142 GLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFI 200
              +G+ G V G+M  FQSIA   + ++  +   I E+L++  +GL  +IP+ I YN  I
Sbjct: 153 SPFIGLFGTVWGIMHSFQSIATSKNTSLAVVAPGIAEALLATAIGLFAAIPAVIFYNYLI 212

Query: 201 EDSKKFAMQMEGFANEFSAILSRQTE 226
                   ++E F +E ++ILS+  +
Sbjct: 213 SRIILINNKIEDFISELNSILSKAID 238


>gi|50085689|ref|YP_047199.1| group A colicins tolerance protein [Acinetobacter sp. ADP1]
 gi|49531665|emb|CAG69377.1| tolerance to group A colicins, single-stranded DNA filamentous
           phage, required for OM integrity [Acinetobacter sp.
           ADP1]
          Length = 232

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 112/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  +++    +Q   F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQAVMLILLLASIYSWYLIAKLHLSYKKSAQQDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   + E+ K   + A S   I +  +R++ V ++R+  ++ 
Sbjct: 69  TLYNNAQLNSKRTGLEDIFYHGLGEFFKLKKRQATSTQTI-EGTERILRVGLSRDQSQLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L  L S+ S    VG+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 QGLGTLASIGSVAPYVGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F    +        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTSKGEAIYSDRALFAEEMVALLQRQSVGS 227


>gi|170719354|ref|YP_001747042.1| tonB-system energizer ExbB [Pseudomonas putida W619]
 gi|169757357|gb|ACA70673.1| tonB-system energizer ExbB [Pseudomonas putida W619]
          Length = 323

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 99/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R     
Sbjct: 88  SLGMA-HDLSPWGMYKNADVVVKAVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQ 146

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                SL+   +         LA   +    E  +     AR   GI++R+   ++  + 
Sbjct: 147 LKKSASLKEASEVSN--KEGTLAHTLVHDALEEMRLS-ANAREKEGIKERVSFRLERLVH 203

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 204 ASGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 263

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 264 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 308


>gi|169633460|ref|YP_001707196.1| putative transporter; MotA/TolQ/ExbB proton channel [Acinetobacter
           baumannii SDF]
 gi|169152252|emb|CAP01157.1| putative transporter; MotA/TolQ/ExbB proton channel [Acinetobacter
           baumannii]
          Length = 293

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 67  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKLLQQGKVKRQGKEAEK 119

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   + L+                   KS        I     +   +  AI
Sbjct: 120 HFWEATSLDNAAEGLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 176

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 177 EKVQSHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 236

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 237 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 277


>gi|28198793|ref|NP_779107.1| TolQ protein [Xylella fastidiosa Temecula1]
 gi|182681492|ref|YP_001829652.1| protein TolQ [Xylella fastidiosa M23]
 gi|28056884|gb|AAO28756.1| TolQ protein [Xylella fastidiosa Temecula1]
 gi|182631602|gb|ACB92378.1| protein TolQ [Xylella fastidiosa M23]
          Length = 257

 Score =  146 bits (367), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL + S  SW +I +K+  F    R+  +FE  FWSG  L 
Sbjct: 35  INYIDLMLKASIPVKIIVLLLLLGSFTSWLIIFRKARVFKQANREADQFENRFWSGTDLS 94

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +  +   GL AIF     E+ +  ++    P    +   R+M     RE++++
Sbjct: 95  KLYASTNSRKHMVSGLEAIFEGGFREFTRLRERRRLDPRIQIEGAQRVMRTNFMREMDQL 154

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 155 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGDQAGIAAVAPGISEALFATAVGL 214

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            V+IP+  AYN+F    ++ +++ E FA EFSAIL RQ
Sbjct: 215 FVAIPAVWAYNRFTTRLERLSVRYETFAEEFSAILQRQ 252


>gi|108809101|ref|YP_653017.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Antiqua]
 gi|108810704|ref|YP_646471.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Nepal516]
 gi|150260288|ref|ZP_01917016.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           CA88-4125]
 gi|165939887|ref|ZP_02228426.1| tonB-system energizer ExbB [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166008741|ref|ZP_02229639.1| tonB-system energizer ExbB [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166212089|ref|ZP_02238124.1| tonB-system energizer ExbB [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167419105|ref|ZP_02310858.1| tonB-system energizer ExbB [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425209|ref|ZP_02316962.1| tonB-system energizer ExbB [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167466386|ref|ZP_02331090.1| TonB complex protein [Yersinia pestis FV-1]
 gi|229837364|ref|ZP_04457527.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis Pestoides A]
 gi|229840576|ref|ZP_04460735.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229842874|ref|ZP_04463026.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229900902|ref|ZP_04516026.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis Nepal516]
 gi|270487724|ref|ZP_06204798.1| TonB-system energizer ExbB [Yersinia pestis KIM D27]
 gi|108774352|gb|ABG16871.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Nepal516]
 gi|108781014|gb|ABG15072.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Antiqua]
 gi|149289696|gb|EDM39773.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           CA88-4125]
 gi|165912198|gb|EDR30836.1| tonB-system energizer ExbB [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165992080|gb|EDR44381.1| tonB-system energizer ExbB [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166206835|gb|EDR51315.1| tonB-system energizer ExbB [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166963099|gb|EDR59120.1| tonB-system energizer ExbB [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167055972|gb|EDR65753.1| tonB-system energizer ExbB [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|229682241|gb|EEO78333.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis Nepal516]
 gi|229690141|gb|EEO82198.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696942|gb|EEO86989.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229705487|gb|EEO91497.1| membrane spanning protein in TonB-ExbB-ExbD complex [Yersinia
           pestis Pestoides A]
 gi|262360780|gb|ACY57501.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           D106004]
 gi|262364725|gb|ACY61282.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           D182038]
 gi|270336228|gb|EFA47005.1| TonB-system energizer ExbB [Yersinia pestis KIM D27]
          Length = 345

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 108 AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 167

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 168 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 226

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS-IPGIIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+    PGI E+L++  LGL
Sbjct: 227 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLATALGL 286

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 287 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 317


>gi|271498917|ref|YP_003331942.1| tonB-system energizer ExbB [Dickeya dadantii Ech586]
 gi|270342472|gb|ACZ75237.1| tonB-system energizer ExbB [Dickeya dadantii Ech586]
          Length = 311

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 41/223 (18%), Positives = 101/223 (45%), Gaps = 2/223 (0%)

Query: 5   GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFW 64
           GL   D+S+  ++    + VK ++  L + S+++W++   KS + +  +++ R   Q   
Sbjct: 71  GLMNTDLSVLGMYQHADVVVKTVMIGLLLASVVTWAIFFSKSASLMGAKKRIRREYQALE 130

Query: 65  SGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             ++L+             ++ + +   +  +++  + +    GI++R     +  +A  
Sbjct: 131 DARTLDDAVDIAAVFKPGSVS-LQLLTDARNEQALSERSDDNGGIKERTAFRFERRVAAT 189

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
             ++     +L ++ +    +G+ G V G+M  F  IA   + N+  +   I E+L++  
Sbjct: 190 GRQMGRGTGYLATVGAIAPFIGLFGTVWGIMNSFIGIAQSQTTNLAVVAPGIAEALLATA 249

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +GL  +IP+ + YN F   +  +   +   A +   + SR  +
Sbjct: 250 IGLVAAIPAVVIYNVFARWTASYKAMVGDVAAQILLLQSRDLD 292


>gi|254447611|ref|ZP_05061077.1| MotA/TolQ/ExbB proton channel [gamma proteobacterium HTCC5015]
 gi|198262954|gb|EDY87233.1| MotA/TolQ/ExbB proton channel [gamma proteobacterium HTCC5015]
          Length = 305

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 98/220 (44%), Gaps = 3/220 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   ++ Q    VK ++  L   S+++W+V   K++  +T++R  +E  Q     +
Sbjct: 69  PHDLSPMGMYRQADWVVKAVMLGLLFASVVTWTVWAVKALQLMTVKRHAKEAVQHLQQAK 128

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SL+    +L++        +   A           A S  G+++R    +    A    +
Sbjct: 129 SLKEALLALQSSKGAI--PMLAKAAQHELHLSSDRAMSKDGVKERTFSRLQDIEAITGRQ 186

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +    L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL
Sbjct: 187 LNQGTGLLATIGSTAPFVGLFGTVWGIMNSFIGIAAANTTNLAVVAPGIAEALLATAIGL 246

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ I YN F      F  Q+   ++E   ++SR  +
Sbjct: 247 LAAIPAVIIYNHFARGMGAFRGQLGNASSEVLRLVSRDLD 286


>gi|121595092|ref|YP_986988.1| MotA/TolQ/ExbB proton channel [Acidovorax sp. JS42]
 gi|222111435|ref|YP_002553699.1| protein tolq [Acidovorax ebreus TPSY]
 gi|120607172|gb|ABM42912.1| Cell division and transport-associated protein TolQ [Acidovorax sp.
           JS42]
 gi|221730879|gb|ACM33699.1| protein TolQ [Acidovorax ebreus TPSY]
          Length = 233

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 74/228 (32%), Positives = 115/228 (50%), Gaps = 3/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L +     V+ ++ LL   S+ SW+ I +K      ++    +FE+ FWS
Sbjct: 1   MNSQDMSILSLVLNASWVVQLVMLLLLAVSVASWAAIFRKLFALKRVKALNEDFERDFWS 60

Query: 66  GQSLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S  ++      +  IF S M E++K  ++    P  + D   R M  +  R
Sbjct: 61  GTSLNDLYASATHNAKSAGPMERIFASGMREYQKLRERRISDPGTLLDGARRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++ I   LSFLGS++S    VG+ G V G+M  F   AG     +    PGI E+L++ 
Sbjct: 121 EMDVIESSLSFLGSVASVSPYVGLFGTVWGIMHAFTGFAGMEQVTLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +GL  +IP+ IAYN+F  D  + A   E F  EFS IL R    + +
Sbjct: 181 AIGLFAAIPAVIAYNRFARDIDRVATHQETFIEEFSNILQRNLGAHPA 228


>gi|92119098|ref|YP_578827.1| MotA/TolQ/ExbB proton channel [Nitrobacter hamburgensis X14]
 gi|91801992|gb|ABE64367.1| outer membrane transport energization protein ExbB [Nitrobacter
           hamburgensis X14]
          Length = 366

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 50/221 (22%), Positives = 103/221 (46%), Gaps = 4/221 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   +++   +FM     VK ++  L + S+++WSV + K++  ++ R +     +    
Sbjct: 136 ILPHELTPIGMFMAADYIVKSVMIGLALASVMTWSVWLAKTIELLSARSKLLRDLRSVEG 195

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SLE    +L+      +A +  +A  E ++S  + A +  GI++R+  +     A   
Sbjct: 196 VRSLEEANNTLQ-RAGSDIAILTHAARDEIRRS--QDAMNHDGIKERVASLFSRIEAAAA 252

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +T   S L ++ S    VG+ G V G+M  F  I+   + N+  +   I E+L++  +
Sbjct: 253 RRMTRGTSILATIGSTAPFVGLFGTVWGIMNAFIGISKSQTTNLAVVAPGIAEALLATAM 312

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ + YN F      +   +   + E   ++SR  
Sbjct: 313 GLVAAIPAVMIYNMFSRSITGYRGLLGDGSAELMRMVSRDL 353


>gi|294502748|ref|YP_003566810.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Z176003]
 gi|294353207|gb|ADE63548.1| MotA/TolQ/ExbB proton channel family protein [Yersinia pestis
           Z176003]
          Length = 343

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 106 AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 165

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 166 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 224

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS-IPGIIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+    PGI E+L++  LGL
Sbjct: 225 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLATALGL 284

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 285 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 315


>gi|149375114|ref|ZP_01892886.1| Biopolymer transport protein [Marinobacter algicola DG893]
 gi|149360478|gb|EDM48930.1| Biopolymer transport protein [Marinobacter algicola DG893]
          Length = 229

 Score =  145 bits (366), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 68/220 (30%), Positives = 116/220 (52%), Gaps = 4/220 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++S++ L    G+ V+ ++ LL + SI+SW++I Q+   F   ++    FE+ FWSG  L
Sbjct: 4   EVSVWYLIANAGVLVQLVMLLLALASIISWALIFQRLKVFRKAKQAQYAFEERFWSGMDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + + ++     G+ ++F +   E+ +   +  R    + +   R M VA +RE E 
Sbjct: 64  GQLYREVNSNPTPFSGMESLFRAGFKEFSRLRQQS-RDADAVMEGTQRAMRVAFSREQER 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL
Sbjct: 123 LEMHLPFLATVGSTSPYVGLFGTVWGIMNSFRGLAQVQQATLATVAPGISEALIATAMGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ IAYN+F   S       E FA+EFS+IL R+  
Sbjct: 183 FAAIPAVIAYNRFSAISDALLKNYETFADEFSSILHRRVH 222


>gi|262278935|ref|ZP_06056720.1| biopolymer transporter [Acinetobacter calcoaceticus RUH2202]
 gi|262259286|gb|EEY78019.1| biopolymer transporter [Acinetobacter calcoaceticus RUH2202]
          Length = 292

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 90/221 (40%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  L  K  + +L + SI +W +II K +    ++RQ +E E+
Sbjct: 66  NPYGLEA-------LWREGDLVAKSTLFILVLMSIGTWYIIISKFLQQAKVKRQGKEAEK 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+    +L+                   KS        I     +   +  AI
Sbjct: 119 SFWEATSLDNAADTLEQ---SSAYRFIAEKGINSTKSHGGSLLERIDFNTWVSISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKIQNHLGGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMENVRSFGSDLHAVL 276


>gi|170717554|ref|YP_001783485.1| Tol-Pal system TolQ [Haemophilus somnus 2336]
 gi|168825683|gb|ACA31054.1| Tol-Pal system TolQ [Haemophilus somnus 2336]
          Length = 227

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/222 (28%), Positives = 111/222 (50%), Gaps = 3/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++    LF++  + V+ +I +L  FSI+SW++IIQ+S       +    FE+ FWSG+ L
Sbjct: 4   ELDFLELFLKASIVVQIVIVILISFSIISWAIIIQRSRILTRALKDSTLFEERFWSGEDL 63

Query: 70  ETVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             +   L N  N       IF     E+ +       +P  I     R M++ + RE+E+
Sbjct: 64  YKLYDGLSNRRNGLNSSERIFYVGFKEFNRLKQANPDAPEAIIQGSSRAMNLTMNREVED 123

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  ++ FL +++S    +G+ G V G+M  F +++G     +  +   I E+LI+  +GL
Sbjct: 124 LETRVPFLATVASISPYIGLFGTVWGIMHAFMALSGAKQATLQMVAPGIAEALIATAIGL 183

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ +AYN+      K       F +EF+ IL RQ  G 
Sbjct: 184 FAAIPAVMAYNRLSLRVNKLEQNYANFIDEFTTILHRQAFGK 225


>gi|78060438|ref|YP_367013.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. 383]
 gi|77964988|gb|ABB06369.1| outer membrane transport energization protein ExbB [Burkholderia
           sp. 383]
          Length = 311

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 87/221 (39%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+       + ++ LL + S+ SW V++ K +       + +  ++
Sbjct: 75  NPYGLGA-------LWANGDFVARFVLALLVVMSLGSWYVMVTKFIEQARANSRAKSADE 127

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
             W+  +   + +      +            E  +  D      +     I+  ++ +I
Sbjct: 128 QVWNAPT---LAEGTAQLDDASPFRFIAENAIEAGEHHDSALLDSVDRNTWIELNIERSI 184

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
                 + + L+FLG++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 185 TNVSNRLQDGLAFLGTVGSTAPFVGLFGTVWGIYHALTAIGIAGQASIDKVAGPVGEALI 244

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN  +  +K    ++  F  +   +L
Sbjct: 245 MTAIGLAVAVPAVLGYNFLVRRNKSVMERVRNFGAQLHTVL 285


>gi|91780432|ref|YP_555639.1| putative MotA/TolQ/ExbB proton channel [Burkholderia xenovorans
           LB400]
 gi|91693092|gb|ABE36289.1| outer membrane transport energization protein ExbB [Burkholderia
           xenovorans LB400]
          Length = 309

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+    L  + ++ LL I S+ SW ++I K +  +   R+ +  ++
Sbjct: 84  NPYGLGA-------LWKNGDLVARFVLILLVIMSMGSWYIMITKFLEQLRANRRAKSADE 136

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
             WS  SL    + L    N     I    + E     ++     +     ID  +D AI
Sbjct: 137 QLWSAPSLAQGAEQL--DGNSPFRFIAQVGI-EAGAHHEEALLEAVDRNTWIDVSIDRAI 193

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
                 + + L+FLG++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 194 TNVSNRLQDGLAFLGTVGSTAPFVGLFGTVWGIYHALTAIGIAGQASIDKVAGPVGEALI 253

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN  +  +K    ++  F  +   +L
Sbjct: 254 MTAIGLAVAVPAVLGYNFLVRRNKSVMERVRAFGAQLHTVL 294


>gi|294651069|ref|ZP_06728407.1| TonB family auxiliary protein TolQ [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823048|gb|EFF81913.1| TonB family auxiliary protein TolQ [Acinetobacter haemolyticus ATCC
           19194]
          Length = 232

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW VI +  ++F    +    F+++FWSG  L 
Sbjct: 9   MHISDLILQASPVVQLVMLILLLASIYSWYVIAKLHMSFKKTGQDDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  +F   +SE+ K   + A +   I +  +RM+ V ++RE   + 
Sbjct: 69  TLYNNAQLNSKRNGLEDVFYQGLSEFFKLKKRKADTTQTI-EGTERMLRVGLSREQGGLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 QNLGVLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           +IP+ +A+N F    +        FA E  A+L RQ+ G
Sbjct: 188 AIPAVLAFNHFTAKGEAIYSDRALFAEEMVALLQRQSIG 226


>gi|150396365|ref|YP_001326832.1| TonB-system energizer ExbB type-1 [Sinorhizobium medicae WSM419]
 gi|150027880|gb|ABR59997.1| TonB-system energizer ExbB type-1 [Sinorhizobium medicae WSM419]
          Length = 325

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 92/220 (41%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   +F+   + VK ++  L + S+ +W++ I K++     + + +       S  
Sbjct: 81  PHDLSPVGMFLAADIVVKAVMIALALASVATWAIFIVKTLELAYAKSRLKRAVANLVSAN 140

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L  V   L+    +    +  +     +           G+++R+  ++     R  + 
Sbjct: 141 GLAEVHSKLERRSGVAGNMVTAAIDEMTRSEAVLDLTPSAGVKERVSSLLTRIEVRAGKR 200

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           ++     L S+ S G  VG+ G V G+M  F  I+   + N+  +   I E+L++  +GL
Sbjct: 201 MSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQTTNLAIVAPGIAEALLATAIGL 260

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      + + +         ++SR  +
Sbjct: 261 VAAIPAVVIYNYFARSVGGYKLILADAGAAVERLVSRDLD 300


>gi|118579668|ref|YP_900918.1| MotA/TolQ/ExbB proton channel [Pelobacter propionicus DSM 2379]
 gi|118502378|gb|ABK98860.1| Cell division and transport-associated protein TolQ [Pelobacter
           propionicus DSM 2379]
          Length = 223

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 105/223 (47%), Gaps = 8/223 (3%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
            AL +  G+ VK ++ LL  FS++SW++I+ K        R+   F  LFW     +T+ 
Sbjct: 1   MALLLNAGVVVKLVLILLLFFSVVSWAIILFKLFQVHRANRESERFMDLFWKSSRFDTIA 60

Query: 74  KSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPI-------GIQDRIDRMMDVAIARELE 126
             L    +  L+ +F  A +E  K  DKGA S         G  + + R +  A   EL 
Sbjct: 61  SQLDRFSSSPLSVLFNEAYAELNKLMDKGATSSGTGLSTDLGGIENVSRALRRATNSELT 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L+FL +  S    +G+ G V G+M  F+ I    S ++  +   I E+LI+  +G
Sbjct: 121 RLERYLTFLATTGSTSPFIGLFGTVWGIMTAFEGIGRTGSASLAVVAPGIAEALIATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP+ +AYN F    +     M+ F+ EF  I+ R   G 
Sbjct: 181 LVAAIPAVMAYNHFQHKIRVLTNDMDSFSTEFLNIVQRTVAGR 223


>gi|330862283|emb|CBX72444.1| biopolymer transport protein exbB [Yersinia enterocolitica W22703]
          Length = 340

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 46/216 (21%), Positives = 100/216 (46%), Gaps = 3/216 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             GLA MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ ++  ++
Sbjct: 99  PQGLA-MDLSVWGMYQHADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLQQEHEV 157

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
             +   L+T  +         ++ + +      ++     +    GI++R    ++  +A
Sbjct: 158 IGAVTDLDTASERAAAFSPESISGLLLREAQN-ERLLSAESNDNNGIKERTAFRLERRVA 216

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
               ++ +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 217 AISRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 276

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             LGL  +IP+ + YN F      +  Q+   A + 
Sbjct: 277 TALGLVAAIPAVVIYNIFARLIGSYRAQVGDVAAQV 312


>gi|169632717|ref|YP_001706453.1| tolerance to group A colicins, single-stranded DNA filamentous
           phage, required for OM integrity [Acinetobacter
           baumannii SDF]
 gi|169795061|ref|YP_001712854.1| tolerance to group A colicins, single-stranded DNA filamentous
           phage, required for OM integrity [Acinetobacter
           baumannii AYE]
 gi|213158277|ref|YP_002320328.1| protein TolQ [Acinetobacter baumannii AB0057]
 gi|215482610|ref|YP_002324802.1| protein TolQ [Acinetobacter baumannii AB307-0294]
 gi|239501029|ref|ZP_04660339.1| protein TolQ [Acinetobacter baumannii AB900]
 gi|260556545|ref|ZP_05828763.1| TolQ [Acinetobacter baumannii ATCC 19606]
 gi|301344813|ref|ZP_07225554.1| protein TolQ [Acinetobacter baumannii AB056]
 gi|301510232|ref|ZP_07235469.1| protein TolQ [Acinetobacter baumannii AB058]
 gi|301595125|ref|ZP_07240133.1| protein TolQ [Acinetobacter baumannii AB059]
 gi|332851091|ref|ZP_08433200.1| protein TolQ [Acinetobacter baumannii 6013150]
 gi|332869660|ref|ZP_08438848.1| protein TolQ [Acinetobacter baumannii 6013113]
 gi|332875981|ref|ZP_08443767.1| protein TolQ [Acinetobacter baumannii 6014059]
 gi|169147988|emb|CAM85851.1| tolerance to group A colicins, single-stranded DNA filamentous
           phage, required for OM integrity [Acinetobacter
           baumannii AYE]
 gi|169151509|emb|CAP00272.1| tolerance to group A colicins, single-stranded DNA filamentous
           phage, required for OM integrity [Acinetobacter
           baumannii]
 gi|193078073|gb|ABO13008.2| tolerance to group A colicins single-stranded DNA filamentous phage
           [Acinetobacter baumannii ATCC 17978]
 gi|213057437|gb|ACJ42339.1| protein TolQ [Acinetobacter baumannii AB0057]
 gi|213987830|gb|ACJ58129.1| protein TolQ [Acinetobacter baumannii AB307-0294]
 gi|260409804|gb|EEX03104.1| TolQ [Acinetobacter baumannii ATCC 19606]
 gi|322509066|gb|ADX04520.1| tolQ [Acinetobacter baumannii 1656-2]
 gi|323519047|gb|ADX93428.1| group A colicins tolerance protein [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332730255|gb|EGJ61580.1| protein TolQ [Acinetobacter baumannii 6013150]
 gi|332732562|gb|EGJ63795.1| protein TolQ [Acinetobacter baumannii 6013113]
 gi|332735847|gb|EGJ66888.1| protein TolQ [Acinetobacter baumannii 6014059]
          Length = 232

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 64/220 (29%), Positives = 112/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  +++   R+    F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMSYKKARQDDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   +SE+ K   + A +   I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRQAPTSQMI-EGTERILRVGLSRDQGSLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 YGLGTLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F   S+        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTAKSESVYSDRALFAEEMIALLQRQSVGS 227


>gi|118581726|ref|YP_902976.1| MotA/TolQ/ExbB proton channel [Pelobacter propionicus DSM 2379]
 gi|118504436|gb|ABL00919.1| Cell division and transport-associated protein TolQ [Pelobacter
           propionicus DSM 2379]
          Length = 223

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 66/223 (29%), Positives = 106/223 (47%), Gaps = 8/223 (3%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
            AL +  G+ VK ++ LL  FS++SW++I+ K        R+   F  LFW     +T+ 
Sbjct: 1   MALLLNAGIVVKLVLILLLFFSVVSWAIILFKLFQVHRANRESERFMDLFWKSSRFDTIA 60

Query: 74  KSLKNHHNIGLAAIFMSAMSEWKKSCDKGARS-------PIGIQDRIDRMMDVAIARELE 126
             L    +  L+ +F  A +E  K  DKGA S        +G  + + R +  A   EL 
Sbjct: 61  SQLDRFSSSPLSVLFNEAYAELNKLMDKGATSNGGGLSTDLGGIENVSRALRRATNSELT 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L+FL +  S    +G+ G V G+M  F+ I    S ++  +   I E+LI+  +G
Sbjct: 121 RLERYLTFLATTGSTSPFIGLFGTVWGIMTAFEGIGRTGSASLAVVAPGIAEALIATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP+ +AYN F    +     M+ F+ EF  I+ R   G 
Sbjct: 181 LVAAIPAVMAYNHFQHKIRVLTNDMDSFSTEFLNIVQRTVAGR 223


>gi|146313054|ref|YP_001178128.1| biopolymer transport protein ExbB [Enterobacter sp. 638]
 gi|145319930|gb|ABP62077.1| outer membrane transport energization protein ExbB [Enterobacter
           sp. 638]
          Length = 238

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/223 (21%), Positives = 102/223 (45%), Gaps = 2/223 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+S++ ++    + VK ++  L + S+++W++   KSV  I+ +R+ +  +Q     +S
Sbjct: 3   TDLSVWGMYQHADIVVKIVMIGLILASVITWAIFFSKSVELISQKRRLKREQQQLAEARS 62

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+         H   L ++ ++      +    G+    GI++R    ++  +A     +
Sbjct: 63  LDQANDMTSAFHAKSLTSMLVNEAQNELELS-AGSEDNEGIKERTGFRLERRVAAVGRHM 121

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 122 GRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLI 181

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +IP+ + YN F      F   +   A +   + SR  + + S
Sbjct: 182 AAIPAVVIYNVFARMIGSFKATLGDVAAQVLLLQSRDLDLSAS 224


>gi|90423486|ref|YP_531856.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisB18]
 gi|90105500|gb|ABD87537.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris BisB18]
          Length = 288

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 51/222 (22%), Positives = 99/222 (44%), Gaps = 6/222 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S +A+F+     VK +I  L + S+ +W+V + K V   + +R+ R   +      
Sbjct: 48  PHDLSPWAMFLAADNIVKAVIVGLALASLATWTVWLVKIVELTSAKRRARSAVRKLQRAD 107

Query: 68  SLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           SL    + +      +  +A +  +A+ E ++S      S  G+++R+   +    A   
Sbjct: 108 SLVQARQQIDADWTRDGPVADLAQAALRETERS---NDLSAEGVKERLAIALSRIEAEAG 164

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
            ++      L ++ +    +G+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 165 RDMARGTGLLATIGATAPFIGLFGTVWGIMNSFVGIAQTKTTNLAVVAPGIAEALLATAI 224

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ I YN F      +   +   + E    LSR  E
Sbjct: 225 GLVAAIPAVIIYNVFARAIAGYRALLSDASGEVLQHLSRDLE 266


>gi|318604211|emb|CBY25709.1| mota/TolQ/ExbB proton channel family protein [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 336

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 45/216 (20%), Positives = 99/216 (45%), Gaps = 3/216 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             GLA MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ ++  ++
Sbjct: 95  PQGLA-MDLSVWGMYQHADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLQQEHEV 153

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
             +   L+   +         ++ + +      ++     +    GI++R    ++  +A
Sbjct: 154 IGAVTDLDIASERAAAFSPESISGLLLREAQN-ERLLSAESNDNNGIKERTAFRLERRVA 212

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
               ++ +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 213 AISRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 272

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             LGL  +IP+ + YN F      +  Q+   A + 
Sbjct: 273 TALGLVAAIPAVVIYNIFARLIGSYRAQVGDVAAQV 308


>gi|226953479|ref|ZP_03823943.1| transporter; MotA/TolQ/ExbB proton channel [Acinetobacter sp. ATCC
           27244]
 gi|226835764|gb|EEH68147.1| transporter; MotA/TolQ/ExbB proton channel [Acinetobacter sp. ATCC
           27244]
          Length = 291

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 50/221 (22%), Positives = 88/221 (39%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL         L+ +  +  K  + +L + SI +W +I  K      ++R   E E+
Sbjct: 66  NPYGLEA-------LWREGDVIAKTTLFILVLMSIGTWYIIFSKVFQQSKVKRHGIEAER 118

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   +L +   SL    N     I    +    K  D      I     +   +  AI
Sbjct: 119 NFWEADTLNSAKDSLA--PNSSYRYIAEKGI-HSTKHHDGTLLERIDFNTWVTISIQRAI 175

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    +   L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 176 EKVQSHLGNGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGISGQASIDKVAGPVGEALI 235

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K     +  F ++  A+L
Sbjct: 236 MTAIGLAVAVPAVLGYNWLTRRNKAVMDNVRSFGSDLHAVL 276


>gi|92113973|ref|YP_573901.1| MotA/TolQ/ExbB proton channel [Chromohalobacter salexigens DSM
           3043]
 gi|91797063|gb|ABE59202.1| Cell division and transport-associated protein TolQ
           [Chromohalobacter salexigens DSM 3043]
          Length = 225

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 106/219 (48%), Gaps = 1/219 (0%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           +SI  L M   L V+ ++ LL   S+ SW VI Q+        + +R+FE  FWSG  L 
Sbjct: 1   MSIPHLIMNASLVVQLVMLLLLAASVASWIVIFQRGFALRRAEKAYRDFEDRFWSGVDLN 60

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            + + L        A     +            +S   + + + R   VA++RE + +  
Sbjct: 61  ELYRELPAEQESLGAEHVFRSGFREFNRLMAKTQSTEAVLEGVQRGQRVALSREEDRLQL 120

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVS 189
            L+FL +++SA   +G+ G V G+MG FQS++      +    P I E+L++  +GL  +
Sbjct: 121 HLTFLATVASATPYIGLFGTVWGIMGSFQSLSMAQQATLSTVAPWIAEALVATAMGLFAA 180

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           IP+ I YN+    + +   + E FA EF AIL R  +G 
Sbjct: 181 IPAVIFYNRLSAHATRLLGKYENFAEEFHAILHRNLQGR 219


>gi|307317028|ref|ZP_07596469.1| tonB-system energizer ExbB [Sinorhizobium meliloti AK83]
 gi|306897116|gb|EFN27861.1| tonB-system energizer ExbB [Sinorhizobium meliloti AK83]
          Length = 328

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/220 (19%), Positives = 95/220 (43%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   +F+   + VK ++  L + S+ +W++ + K++  I  + + +       S  
Sbjct: 83  PHDLSPVGMFLAADIVVKAVMVALALASVATWAIFLVKTLELIYAKSRLKRAVAALVSAN 142

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L  V   L+    +    +  +     +          +G+++R+  ++     R  + 
Sbjct: 143 GLAEVQPKLERRAGVAGEMVAAAIDEMTRSEAVLDLAPAVGVKERVSSLLTRIEVRAGKR 202

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           ++     L S+ S G  VG+ G V G+M  F  I+   + N+  +   I E+L++  +GL
Sbjct: 203 MSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQTTNLAIVAPGIAEALLATAIGL 262

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      + + +   A     ++SR  +
Sbjct: 263 VAAIPAVVIYNYFARSVGGYKLILADAAAAVERLVSRDLD 302


>gi|330876516|gb|EGH10665.1| TonB system transport protein ExbB [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|331018570|gb|EGH98626.1| TonB system transport protein ExbB [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 318

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 78  NSLGMA-HDLSPWGMYQNADIVVKIVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 136

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 137 NLKKARSLTEASATAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 193

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 194 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 253

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 254 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 299


>gi|311694929|gb|ADP97802.1| MotA/TolQ/ExbB proton channel [marine bacterium HP15]
          Length = 229

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 69/222 (31%), Positives = 115/222 (51%), Gaps = 4/222 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++S++ L    G+ V+ ++ LL + SI+SW++I Q+   F   +R    FE+ FWSG  L
Sbjct: 4   ELSVWYLIANAGVLVQLVMLLLALASIMSWALIFQRLQVFRKAKRAQLAFEERFWSGMDL 63

Query: 70  ETVCKSLK--NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
             + + +        G+ ++F +   E+ +   +  R    + +   R M VA +RE E 
Sbjct: 64  GQLYREVNADPTPFSGMESLFRAGFKEFSRLRQQS-RDADAVMEGTQRAMRVAFSREHER 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           +   L FL ++ S    VG+ G V G+M  F+ +A      +    PGI E+LI+  +GL
Sbjct: 123 LEASLPFLATVGSTSPYVGLFGTVWGIMNSFRGLAQVQQATLATVAPGISEALIATAMGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ IAYN+F   S       E FA+EFS+IL R+   +
Sbjct: 183 FAAIPAVIAYNRFSAMSDALLKNYETFADEFSSILHRRVHQS 224


>gi|28867309|ref|NP_789928.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213970702|ref|ZP_03398827.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           T1]
 gi|301382589|ref|ZP_07231007.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063044|ref|ZP_07254585.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           K40]
 gi|302133608|ref|ZP_07259598.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28850543|gb|AAO53623.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213924536|gb|EEB58106.1| TonB system transport protein ExbB [Pseudomonas syringae pv. tomato
           T1]
          Length = 318

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 78  NSLGMA-HDLSPWGMYQNADIVVKIVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 136

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 137 NLKKARSLTEASATAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 193

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 194 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 253

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 254 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 299


>gi|296104662|ref|YP_003614808.1| biopolymer transport protein ExbB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295059121|gb|ADF63859.1| biopolymer transport protein ExbB [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 243

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 102/226 (45%), Gaps = 2/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           L   D+S++ ++    + VK ++  L + S+++W++   KS   I+ +R+ +  +Q    
Sbjct: 5   LMQTDLSVWGMYHHADIVVKIVMIGLILASVITWAIFFGKSAELISQKRRLKREQQQLAE 64

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+       + H   L  + ++      +    G+    GI++R    ++  +A   
Sbjct: 65  ARSLDQASDMTSSFHAKSLTTLLVNEAQNELELS-AGSEDNEGIKERTGFRLERRVAAVG 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +
Sbjct: 124 RHMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   A +   + SR  + N S
Sbjct: 184 GLVAAIPAVVIYNVFARMIGSYKATLGDVAAQVLLLQSRDLDLNAS 229


>gi|153008585|ref|YP_001369800.1| TonB-system energizer ExbB type-1 [Ochrobactrum anthropi ATCC
           49188]
 gi|151560473|gb|ABS13971.1| TonB-system energizer ExbB type-1 [Ochrobactrum anthropi ATCC
           49188]
          Length = 338

 Score =  145 bits (366), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 95/226 (42%), Gaps = 1/226 (0%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+S + +FM     VK ++  L I S+ +W+V + K++     RR+  +  ++   
Sbjct: 102 ILPHDLSPWGMFMAADWVVKAVMIGLAIASLATWTVWVAKTLELAGARRRATKALKVIGH 161

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
             +L     +L      G   +  +                 G+++R+   +    A+  
Sbjct: 162 SATLAEAVHALDGAKGPGAVLVRAAEDEVRLSGPALARAGGEGLKERVSSRLSRIEAKAG 221

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +++    L ++ S    VG+ G V G+M  F +I+   + N+  +   I E+L++  +
Sbjct: 222 RRLSKGTGILATIGSVAPFVGLFGTVWGIMNSFINISQAQTTNLAVVAPGIAEALLATAI 281

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           GL  +IP+ + YN F      +   +   +     ++SR  +   +
Sbjct: 282 GLVAAIPAVVIYNVFARSITGYRSLLADASAGVERLVSRDLDFRTA 327


>gi|170022923|ref|YP_001719428.1| tonB-system energizer ExbB [Yersinia pseudotuberculosis YPIII]
 gi|169749457|gb|ACA66975.1| tonB-system energizer ExbB [Yersinia pseudotuberculosis YPIII]
          Length = 345

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 44/211 (20%), Positives = 100/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 108 AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 167

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 168 DLDTASERAEDFGQGSVSSLLLREALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 226

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL
Sbjct: 227 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGL 286

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 287 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 317


>gi|293394345|ref|ZP_06638645.1| TonB system transporter ExbB [Serratia odorifera DSM 4582]
 gi|291423323|gb|EFE96552.1| TonB system transporter ExbB [Serratia odorifera DSM 4582]
          Length = 317

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 46/210 (21%), Positives = 97/210 (46%), Gaps = 2/210 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+S++ ++    + VK ++  L + SI++W+++  K       +R+ R   Q     +S
Sbjct: 81  MDLSVWGMYQHADVVVKTVMIGLVLASIITWTILFAKGSELTRAKRRLRREHQALSEARS 140

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+   +  ++  N  ++A  ++      +   + +    GI++R     +  +A    ++
Sbjct: 141 LDEATEMAQSFQNDSISATLLNDAQNELELSAE-SNDNNGIKERAGFRFERRVAAYGRQL 199

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 200 GKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGLV 259

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
            +IP+ + YN F         Q+   A + 
Sbjct: 260 AAIPAVVIYNIFARVIGGHRAQVGDVAAQV 289


>gi|226939428|ref|YP_002794501.1| ExbB-like biopolymer transport [Laribacter hongkongensis HLHK9]
 gi|226714354|gb|ACO73492.1| probable ExbB-like biopolymer transport [Laribacter hongkongensis
           HLHK9]
          Length = 224

 Score =  145 bits (365), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 53/215 (24%), Positives = 107/215 (49%), Gaps = 4/215 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           MD+S+     Q    +  +  LL   S+ SW +I+Q+S+    L RQ R++ + FW+  S
Sbjct: 1   MDVSLV--MQQGDAVLIGVFALLLAMSLGSWWLILQRSLVLARLSRQARQWSRQFWAADS 58

Query: 69  LETVCKSLKNH-HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           L++    L     +  +A   +  +  +++   +   +  G+ + + R + +A++RE   
Sbjct: 59  LDSARGQLDTPLPHARIATAGLEGLDHYRQHAQRSLGAACGLDEFLVRTIRMALSRETGR 118

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIP-GIIESLISILLGL 186
           +   L++L ++ S    VG+ G V G+      IA     ++ ++   I E+L++   GL
Sbjct: 119 LESGLTWLATVGSIAPFVGLFGTVWGIYHALVGIAAEGQVSIGTVSGPIGEALVATAAGL 178

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
             +IP+ +AYN F   ++  +  M+ FA++  A L
Sbjct: 179 FAAIPAVVAYNAFTRVNRVLSQDMDSFAHDLHAQL 213


>gi|293609861|ref|ZP_06692163.1| hypothetical protein HMPREF0013_02011 [Acinetobacter sp. SH024]
 gi|292828313|gb|EFF86676.1| hypothetical protein HMPREF0013_02011 [Acinetobacter sp. SH024]
          Length = 232

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  +++    +    F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMSYKKAHQDDEHFQKMFWSGAELS 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   +SE+ K   + A     I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRQAPVSQTI-EGTERILHVGLSRDQSHLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 YGLGTLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F   S+        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTAKSESVYSDRALFAEEMIALLQRQSVGS 227


>gi|238789157|ref|ZP_04632945.1| TonB complex protein [Yersinia frederiksenii ATCC 33641]
 gi|238722689|gb|EEQ14341.1| TonB complex protein [Yersinia frederiksenii ATCC 33641]
          Length = 333

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 46/216 (21%), Positives = 101/216 (46%), Gaps = 3/216 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             GLA MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ ++  ++
Sbjct: 92  PEGLA-MDLSVWGMYQHADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLQQEHEV 150

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
             +   L+T  +  +      ++ + +      ++     +    GI++R    ++  +A
Sbjct: 151 IGAVTDLDTASERAEAFSTDSISGLLLREAQN-ERLLSAESNDNNGIKERTAFRLERRVA 209

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
               ++ +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 210 AISRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 269

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             LGL  +IP+ + YN F      +  Q+   A + 
Sbjct: 270 TALGLVAAIPAVVIYNIFARLIGSYRAQVGDVAAQV 305


>gi|237745916|ref|ZP_04576396.1| MotA/TolQ/ExbB proton channel family protein [Oxalobacter
           formigenes HOxBLS]
 gi|229377267|gb|EEO27358.1| MotA/TolQ/ExbB proton channel family protein [Oxalobacter
           formigenes HOxBLS]
          Length = 251

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 51/218 (23%), Positives = 94/218 (43%), Gaps = 5/218 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           +I       Q     K I+ +L   S++SW++II K +     +R  +EF Q FW+  SL
Sbjct: 7   NIGFSHFIAQSDFLGKTILAILIGMSVVSWTLIIVKGIAGWRRKRHSKEFLQFFWNATSL 66

Query: 70  ETVCKSLK----NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
           +TV   ++          L A    A                 +Q+ + R M + +  + 
Sbjct: 67  DTVRHEIQTHGIKCPFSHLTAHAQHAKEHHVHYGAAKLSEAGTMQEFVTRTMRMVMDEDA 126

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
             +   L+ L ++ S    +G+ G V G+     +I+   +  + +    + E+LI   +
Sbjct: 127 ARLENGLTVLATIGSTAPFIGLFGTVWGIYNALINISASGAGTLDMVAGPVGEALIMTGI 186

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILS 222
           GL V+IP+ I YN  +  +     +++ FANE    L+
Sbjct: 187 GLAVAIPAVIGYNWLVRSNNVMMSKLDTFANELLTFLT 224


>gi|119356687|ref|YP_911331.1| MotA/TolQ/ExbB proton channel [Chlorobium phaeobacteroides DSM 266]
 gi|119354036|gb|ABL64907.1| Cell division and transport-associated protein TolQ [Chlorobium
           phaeobacteroides DSM 266]
          Length = 225

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 58/220 (26%), Positives = 108/220 (49%), Gaps = 4/220 (1%)

Query: 13  IFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETV 72
           IF +    G AV  ++ +L  FS++SW++I  K        ++ REF   F+   S++ +
Sbjct: 8   IFFMLSDAGPAVLAVLIVLLGFSVVSWAIIAFKFGYVNKSIKESREFLDCFFELSSVDKI 67

Query: 73  CKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKL 132
               + + +  LA +F SA  E++   ++       +++R+ R +   +  E + +   +
Sbjct: 68  FVESEKYRSSSLARVFRSAYIEYRALVERNGE--RHVEERVARAVKREVNAESKRLVYLV 125

Query: 133 SFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVSIP 191
            FL ++ +    +G+ G V G+M  FQ I    S ++    PGI E+L++   GL  +IP
Sbjct: 126 PFLATVGNTAPFIGLFGTVWGIMTSFQQIGLTQSASLASVAPGISEALVATAAGLVAAIP 185

Query: 192 SSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE-GNIS 230
           + IAYN F +        +E F+ EF     R  + G++S
Sbjct: 186 AVIAYNYFTQQIALIDRDLEDFSGEFVTACIRNIQKGSVS 225


>gi|241767252|ref|ZP_04764992.1| protein TolQ [Acidovorax delafieldii 2AN]
 gi|241362086|gb|EER58205.1| protein TolQ [Acidovorax delafieldii 2AN]
          Length = 233

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 74/226 (32%), Positives = 113/226 (50%), Gaps = 3/226 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L +     V+ ++ LL   S+ SW+ I +K      ++    EFE+ FWS
Sbjct: 1   MNSQDMSILSLVLHASWVVQLVMLLLLGVSVASWAAIFRKLFALKRVKNLNEEFERDFWS 60

Query: 66  GQSLETVCKSLKNHHNI--GLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  S   +      +  IF S M E++K  ++    P  + D   R M  +  R
Sbjct: 61  GTSLNDLYASAAQNAKNAGPMERIFASGMREYQKLRERRITDPGTLLDGARRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++ +   LSFLGS++S    VG+ G V G+M  F   AG     +    PGI E+L++ 
Sbjct: 121 EMDVVESSLSFLGSVASVSPYVGLFGTVWGIMHAFTGFAGMEQVTLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
            +GL  +IP+ IAYN+F  D  + A   E F  EFS IL R    +
Sbjct: 181 AIGLFAAIPAVIAYNRFARDIDRVATHQETFIEEFSNILQRNLGAH 226


>gi|167036340|ref|YP_001671571.1| tonB-system energizer ExbB [Pseudomonas putida GB-1]
 gi|166862828|gb|ABZ01236.1| tonB-system energizer ExbB [Pseudomonas putida GB-1]
          Length = 326

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 99/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R     
Sbjct: 91  SLGMA-HDLSPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQ 149

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                +L+   +         LA   +    E  +     AR   GI++R+   ++  + 
Sbjct: 150 LKKSTTLKEASEVSN--KEGTLAHTLVHDALEEMRLS-ANAREKEGIKERVSFRLERLVH 206

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 207 ASGRTMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 266

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 267 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 311


>gi|14595284|gb|AAK70856.1|AF315582_1 ExbB [Pseudomonas putida]
          Length = 320

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 99/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R     
Sbjct: 85  SLGMA-HDLSPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQ 143

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                +L+   +         LA   +    E  +     AR   GI++R+   ++  + 
Sbjct: 144 LKKSTTLKEASEVSN--KEGTLAHTLVHDALEEMRLS-ANAREKEGIKERVSFRLERLVH 200

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 201 ASGRTMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 260

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 261 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 305


>gi|22127369|ref|NP_670792.1| TonB complex protein [Yersinia pestis KIM 10]
 gi|45442759|ref|NP_994298.1| TonB complex protein [Yersinia pestis biovar Microtus str. 91001]
 gi|21960454|gb|AAM87043.1|AE013952_10 TonB complex protein [Yersinia pestis KIM 10]
 gi|45437625|gb|AAS63175.1| TonB complex protein [Yersinia pestis biovar Microtus str. 91001]
          Length = 353

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 116 AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 175

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 176 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 234

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS-IPGIIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+    PGI E+L++  LGL
Sbjct: 235 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLATALGL 294

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 295 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 325


>gi|182677523|ref|YP_001831669.1| MotA/TolQ/ExbB proton channel [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182633406|gb|ACB94180.1| MotA/TolQ/ExbB proton channel [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 246

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/223 (25%), Positives = 106/223 (47%), Gaps = 4/223 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
           A   +S   LF+Q    VK ++ LL + S   W VI  K +    L+++  +  +    G
Sbjct: 12  AAHVLSPVELFLQADSVVKTVMILLVLASAWGWVVIFNKLIRLSVLQKRAAKLLKSVQEG 71

Query: 67  QSLETVCKSLKNHH-NIGLAAIFMSAMSEWKKS--CDKGARSPIGIQDRIDRMMDVAIAR 123
             + T+ +S      N    +++ + + E  +S            +Q+RI R+  +A + 
Sbjct: 72  LPVATLAESFDKAPANDPFVSVYKAMIEEHARSADLIYTDGQRDSLQERIHRVAHLASSH 131

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISI 182
            ++++  +L  L ++ +    VG+ G V G+M  FQ IA   + ++  +   I E+L + 
Sbjct: 132 AIDQLQSQLPGLATIGAVAPFVGLFGTVWGIMNSFQGIAASNNTSLSVVAPGIAEALFAT 191

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
            LGL  +IP+ + YN+   D  K++ ++  F N F   LSRQ 
Sbjct: 192 ALGLVAAIPAVVFYNRIGTDISKYSKKLSAFINVFEIELSRQL 234


>gi|313501280|gb|ADR62646.1| TonB-system energizer ExbB type-1 [Pseudomonas putida BIRD-1]
          Length = 324

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 99/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R     
Sbjct: 89  SLGMA-HDLSPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQ 147

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                +L+   +         LA   +    E  +     AR   GI++R+   ++  + 
Sbjct: 148 LKKSTTLKEASEVSN--KEGTLAHTLVHDALEEMRLS-ANAREKEGIKERVSFRLERLVH 204

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 205 ASGRTMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 264

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 265 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 309


>gi|88800182|ref|ZP_01115750.1| TolQ protein [Reinekea sp. MED297]
 gi|88777028|gb|EAR08235.1| TolQ protein [Reinekea sp. MED297]
          Length = 213

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 61/202 (30%), Positives = 98/202 (48%), Gaps = 3/202 (1%)

Query: 28  ITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHN--IGLA 85
           +  L   S+ +W  I ++         +   FE+ FWSG  L  + + +  + +      
Sbjct: 1   MLTLVALSVATWVFIFERRNVMNQAASKLAAFEERFWSGIDLAHLYRQVNANPDEANCGE 60

Query: 86  AIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLV 145
           +IF +   E+ +   +      GI     R M VA+++E + +   LSF+ ++ S    +
Sbjct: 61  SIFRAGFKEFSRMRQQNVTDADGIMAGCQRAMRVAVSKENDRLDSHLSFMATVGSTSPYI 120

Query: 146 GILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVSIPSSIAYNKFIEDSK 204
           G+ G V G+M  F  +A     ++    PGI E+LI+  +GL  +IP+ IAYN+F   S 
Sbjct: 121 GLFGTVWGIMHSFLGLATVTQVSLSTVAPGIAEALIATAMGLFAAIPAVIAYNRFSARSD 180

Query: 205 KFAMQMEGFANEFSAILSRQTE 226
           K    ME FA EFSAIL RQ  
Sbjct: 181 KILTGMEMFAEEFSAILHRQAH 202


>gi|260551458|ref|ZP_05825642.1| hypothetical protein HMPREF0014_02656 [Acinetobacter sp. RUH2624]
 gi|260405452|gb|EEW98945.1| hypothetical protein HMPREF0014_02656 [Acinetobacter sp. RUH2624]
          Length = 232

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 3/220 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  + +   R+    F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIFSWYLIAKLHMGYKKARQGDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   +SE+ K   + A +   I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLSEFFKLKKRNASTSQTI-EGTERILRVGLSRDQGTLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
             L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 YGLGTLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           +IP+ +A+N F    +        FA E  A+L RQ+ G+
Sbjct: 188 AIPAVLAFNHFTAKGESVYSDRALFAEEMIALLQRQSVGS 227


>gi|42521815|ref|NP_967195.1| adventurous gliding motility protein X [Bdellovibrio bacteriovorus
           HD100]
 gi|39574345|emb|CAE77849.1| Adventurous gliding motility protein X [Bdellovibrio bacteriovorus
           HD100]
          Length = 245

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 108/224 (48%), Gaps = 8/224 (3%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            ++ S      Q    V+  + +L + S+  W++   K V F  +++    F   FW   
Sbjct: 16  SVNTSSIDAIAQASPIVQLTLLMLIVMSVFCWAIGYSKYVTFKNMKQSDELFLSKFWKVN 75

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKK-------SCDKGARSPIGIQDRIDRMMDVA 120
           SL+T+ + +  + +  +A +F +   E KK       S  +G +  +   D ++R+++ A
Sbjct: 76  SLDTLFEDIDQYKDSSVARVFKAVYLEMKKISESPLLSKTEGDKPILSGIDNLERVLNKA 135

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESL 179
              E+ ++  +L+ L +  S G  +G+ G V G+MG F  I    + ++  +   I E+L
Sbjct: 136 TESEISKLESRLTVLATTGSTGPFIGLFGTVWGIMGSFHKIGQTGTASLAVVAPGISEAL 195

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           I+  +GL  +IP+ + YN FI   +K  + +  F  +F  I+ R
Sbjct: 196 IATAIGLATAIPAVVLYNNFISKIRKQEIVLNNFGADFLNIVKR 239


>gi|220904135|ref|YP_002479447.1| protein TolQ [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868434|gb|ACL48769.1| protein TolQ [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 231

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 58/221 (26%), Positives = 103/221 (46%), Gaps = 2/221 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           M+ S F++  Q  L  K ++ LL + SI SW ++IQK         +  E    F    +
Sbjct: 1   MEFSFFSMIAQASLVAKAVLALLVVMSITSWGLMIQKFFALSAANNKALEGTTGFEKAPN 60

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L    +SL +  +  L  I    + E+ +S + G  S   + D + R +   +  EL  +
Sbjct: 61  LREAVQSLGSDPSSPLYYIAHQGVLEFNRSKELG-NSSEVVVDNVRRALRQGVGSELSRL 119

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLC 187
              LS L + ++    +G+ G V G+M  F SI    S ++    PGI E+L++  +GL 
Sbjct: 120 QRSLSLLATTANTAPFIGLFGTVWGIMSSFHSIGMLKSASLATVAPGISEALVATAIGLA 179

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           V++P++I +N F+    +    +  FA  F   + R+   +
Sbjct: 180 VAVPATIGFNVFMGKLSQVDTLLVNFAGVFLNRVQRELNAH 220


>gi|71901738|ref|ZP_00683810.1| MotA/TolQ/ExbB proton channel [Xylella fastidiosa Ann-1]
 gi|71728510|gb|EAO30669.1| MotA/TolQ/ExbB proton channel [Xylella fastidiosa Ann-1]
          Length = 257

 Score =  145 bits (365), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 67/218 (30%), Positives = 108/218 (49%), Gaps = 4/218 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I+   L ++  + VK I+ LL + S  SW +I +K+  F    R+  +FE  FWSG  L 
Sbjct: 35  INYIDLMLKASIPVKIIVLLLLLGSFTSWLIIFRKARVFKQANREADQFENRFWSGTDLS 94

Query: 71  TVCKSLKNHHN--IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
            +  S  +  +   GL AIF     E+ +  ++    P    +   R+M     RE++++
Sbjct: 95  KLYASTNSRKHMVSGLEAIFEGGFREFTRLRERRRLDPRIQIEGAQRVMRTNFMREMDQL 154

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNN--VVSIPGIIESLISILLGL 186
              L  L ++ S    VG++G V G+M     +             PGI E+L +  +GL
Sbjct: 155 ERNLELLANIGSTAPYVGLVGTVFGIMVTMHDMISSGDQAGIAAVAPGISEALFATAVGL 214

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
            V+IP+  AYN+F    ++ +++ E FA EFSAIL RQ
Sbjct: 215 FVAIPAVWAYNRFTTRLERLSVRYETFAEEFSAILQRQ 252


>gi|162419125|ref|YP_001604886.1| tonB-system energizer ExbB [Yersinia pestis Angola]
 gi|162351940|gb|ABX85888.1| tonB-system energizer ExbB [Yersinia pestis Angola]
          Length = 330

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 93  AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 152

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 153 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 211

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS-IPGIIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+    PGI E+L++  LGL
Sbjct: 212 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLATALGL 271

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 272 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 302


>gi|15965264|ref|NP_385617.1| biopolymer transport transmembrane protein [Sinorhizobium meliloti
           1021]
 gi|15074444|emb|CAC46090.1| Probable biopolymer transport transmembrane protein [Sinorhizobium
           meliloti 1021]
          Length = 328

 Score =  145 bits (365), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 43/220 (19%), Positives = 95/220 (43%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   +F+   + VK ++  L + S+ +W++ + K++  I  + + +       S  
Sbjct: 83  PHDLSPVGMFLAADIVVKAVMVALALASVATWAIFLVKTLELIYAKSRLKRAVAALVSAN 142

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L  V   L+    +    +  +     +          +G+++R+  ++     R  + 
Sbjct: 143 GLAEVQSKLERRAGVAGEMVAAAIDEMTRSEAVLDLAPAVGVKERVSSLLTRIEVRAGKR 202

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           ++     L S+ S G  VG+ G V G+M  F  I+   + N+  +   I E+L++  +GL
Sbjct: 203 MSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQTTNLAIVAPGIAEALLATAIGL 262

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      + + +   A     ++SR  +
Sbjct: 263 VAAIPAVVIYNYFARSVGGYKLILADAAAAVERLVSRDLD 302


>gi|255320818|ref|ZP_05361993.1| protein TolQ [Acinetobacter radioresistens SK82]
 gi|262379407|ref|ZP_06072563.1| TolQ [Acinetobacter radioresistens SH164]
 gi|255302195|gb|EET81437.1| protein TolQ [Acinetobacter radioresistens SK82]
 gi|262298864|gb|EEY86777.1| TolQ [Acinetobacter radioresistens SH164]
          Length = 232

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 61/219 (27%), Positives = 109/219 (49%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW +I +  ++    ++    F+++FWSG  L 
Sbjct: 9   LHISDLILQASPVVQLVMLILLLASIYSWYLIAKLYMSHKKAQKDDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  IF   + E+ K   + A +   I +  +R++ V ++R+   + 
Sbjct: 69  TLYNNAQLNSKRSGLEDIFYQGLGEFFKLNKRHASTTQSI-EGTERILRVGLSRDQGNLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 QGLGALASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           +IP+ +A+N F    +        FA E  A+L RQ+ G
Sbjct: 188 AIPAVLAFNHFTAKGEALYSDRALFAEEMVALLQRQSVG 226


>gi|323525501|ref|YP_004227654.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1001]
 gi|323382503|gb|ADX54594.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. CCGE1001]
          Length = 242

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 91/228 (39%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L + S++SWSVI+ K  N + L R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALALLVMSVMSWSVIVIKGWNVMRLNRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLK----NHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L       H+    A+ +S                  + + D + 
Sbjct: 54  QAFWHSDDLADGVKKLGAGSSTPHDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAIVAKLSRFAHGLHAFF 221


>gi|254284318|ref|ZP_04959286.1| protein TolQ [gamma proteobacterium NOR51-B]
 gi|219680521|gb|EED36870.1| protein TolQ [gamma proteobacterium NOR51-B]
          Length = 234

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 58/222 (26%), Positives = 106/222 (47%), Gaps = 6/222 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           ++ +  L +   + V+ ++ LL + S+ SW +I+Q+ +          +FE+ FWSG  L
Sbjct: 4   ELGLIELILGASITVQLVMLLLVLASVTSWYMIVQRMILLRRTDDALLDFEEQFWSGVDL 63

Query: 70  ETVCKSLKN-----HHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             + +             G+ +IF +   E+ +   +       + +   R M VA  RE
Sbjct: 64  AELYREGNQAVNDGQPPTGIESIFRAGFKEFSRLSQQSDIDADAVLEGARRAMRVATLRE 123

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
            + +   L FL S+ S    +G+ G V G+M  F+ +A      + ++   I E+LI+  
Sbjct: 124 GDRLEMHLPFLASVGSTSPYIGLFGTVWGIMHSFRGLANATQATLAAVAPGISEALIATA 183

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +GL  +IP+ +AYN+F         + + F +EFS IL RQ+
Sbjct: 184 MGLFAAIPAVLAYNRFAARVDGLINRYDTFVDEFSGILQRQS 225


>gi|299139859|ref|ZP_07033031.1| MotA/TolQ/ExbB proton channel [Acidobacterium sp. MP5ACTX8]
 gi|298598213|gb|EFI54379.1| MotA/TolQ/ExbB proton channel [Acidobacterium sp. MP5ACTX8]
          Length = 249

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 62/220 (28%), Positives = 111/220 (50%), Gaps = 5/220 (2%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREF---EQLFWSGQ 67
            SI  L+ QMG   KC++ +LFI SI S +VII +++ F   R+Q REF           
Sbjct: 30  FSIPQLWAQMGWPAKCVVIILFIMSIWSLAVIIDRALYFSAARKQSREFAPKVAGALKEG 89

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+   K         LA +  + +SE++     GA +P  + +   R ++ A +    +
Sbjct: 90  RLDEAIKVADRSKKSHLAEVVTAGLSEFRSFGSGGAITPEQV-ESSKRALERAESITHAK 148

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGL 186
           + + LS L ++ S    +G+ G V+G++  F+SIA   S+ +     GI E+L++   GL
Sbjct: 149 LKKGLSGLATIGSTAPFIGLFGTVIGILNAFRSIASSKSSGIGQVAGGISEALVTTAFGL 208

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            V+IP+ + +N F    + F ++M+  ++E      +Q+ 
Sbjct: 209 LVAIPAVMCFNYFTSKVEAFDVEMDNSSSELVDYFIKQSH 248


>gi|192362375|ref|YP_001981791.1| ExbB [Cellvibrio japonicus Ueda107]
 gi|190688540|gb|ACE86218.1| ExbB [Cellvibrio japonicus Ueda107]
          Length = 239

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 88/222 (39%), Gaps = 11/222 (4%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
            YGLA       +L+ Q  L +K +  +L I SI SW VI+ ++     LR+  +     
Sbjct: 4   PYGLA-------SLWAQGDLLIKGVAIMLLIMSIASWWVIVVRAWGLWRLRKSSQG-LND 55

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRIDRMMDVA 120
           FW  QS     ++L    +     +     +      +        + + D +   +  +
Sbjct: 56  FWHAQSFAEGLRTLGEDRHSPFRHLAEEGQAALDHHTNHKTDLHGHLPLADWLTACLRGS 115

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESL 179
           I    E +   L+ L S+ S    +G+ G V G+      I      ++      + E+L
Sbjct: 116 IDESAERLQRGLAILASVGSTSPFIGLFGTVWGIYHALVGIGVSGQASIDKVAGPVGEAL 175

Query: 180 ISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           I    GL V+IP+ + YN     +K    ++  FA++  A  
Sbjct: 176 IMTAFGLAVAIPAVLGYNALTRANKGVLNKLHRFAHQLHAYF 217


>gi|330986877|gb|EGH84980.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 317

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 77  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 135

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 136 NLKKARSLNEASSTAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 192

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 193 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 252

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 253 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 298


>gi|307309287|ref|ZP_07588955.1| tonB-system energizer ExbB [Sinorhizobium meliloti BL225C]
 gi|306900288|gb|EFN30905.1| tonB-system energizer ExbB [Sinorhizobium meliloti BL225C]
          Length = 328

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 43/220 (19%), Positives = 95/220 (43%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   +F+   + VK ++  L + S+ +W++ + K++  I  + + +       S  
Sbjct: 83  PHDLSPVGMFLAADIVVKAVMVALALASVATWAIFLVKTLELIYAKSRLKRAVAALVSAN 142

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L  V   L+    +    +  +     +          +G+++R+  ++     R  + 
Sbjct: 143 GLAEVQSKLERRAGVAGEMVAAAIDEMTRSEAVLDLAPAVGVKERVSSLLTRIEVRAGKR 202

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           ++     L S+ S G  VG+ G V G+M  F  I+   + N+  +   I E+L++  +GL
Sbjct: 203 MSAGTGILASIGSVGPFVGLFGTVWGIMNSFIGISKAQTTNLAIVAPGIAEALLATAIGL 262

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      + + +   A     ++SR  +
Sbjct: 263 VAAIPAVVIYNYFARSVGGYKLILADAAAAVERLVSRDLD 302


>gi|289625454|ref|ZP_06458408.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646380|ref|ZP_06477723.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330866519|gb|EGH01228.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 317

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 77  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 135

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 136 NLKKARSLNEASSTAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 192

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 193 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 252

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 253 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 298


>gi|262165951|ref|ZP_06033688.1| MotA/TolQ/ExbB proton channel family protein [Vibrio mimicus VM223]
 gi|262025667|gb|EEY44335.1| MotA/TolQ/ExbB proton channel family protein [Vibrio mimicus VM223]
          Length = 208

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 57/203 (28%), Positives = 98/203 (48%), Gaps = 3/203 (1%)

Query: 26  CIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIG-- 83
            ++  L   S+ SW+ II++S       ++   FE  FWSG  L  + + +K   +    
Sbjct: 1   MVMLTLLGMSVASWAAIIKRSKVISAAEKEADTFEDRFWSGIDLGALYQDVKKRKDDIYG 60

Query: 84  LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGL 143
           +  IF +  +E+ +       +P  + +   R M VA+ARE++ +   L FL ++ S   
Sbjct: 61  IEEIFYAGFTEFARLRKTNPSAPDFVMEGTGRAMRVAVAREVDSLETSLPFLATVGSISP 120

Query: 144 LVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCVSIPSSIAYNKFIED 202
            +G+ G V G+M  F ++       + +  PGI E+LI+  +GL  +IP+ +AYN+    
Sbjct: 121 YIGLFGTVWGIMHAFIALGEVKQATLAMVAPGIAEALIATAIGLFAAIPAVMAYNRLSNK 180

Query: 203 SKKFAMQMEGFANEFSAILSRQT 225
             K       F+ EF  IL RQ 
Sbjct: 181 VSKLEHNYATFSEEFHTILHRQA 203


>gi|165924876|ref|ZP_02220708.1| tonB-system energizer ExbB [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|167398853|ref|ZP_02304377.1| tonB-system energizer ExbB [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|165923076|gb|EDR40227.1| tonB-system energizer ExbB [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|167051357|gb|EDR62765.1| tonB-system energizer ExbB [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 332

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 46/211 (21%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
            MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ R+  ++  +  
Sbjct: 95  AMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVIGAVT 154

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+T  +  ++     ++++ +      ++     +    GI++R    ++  +A    +
Sbjct: 155 DLDTASERAEDFGQGSVSSLLLHEALN-ERLLSIESNDNNGIKERTAFRLERRVAAIGRQ 213

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVS-IPGIIESLISILLGL 186
           + +   FL ++ +    VG+ G V G+M  F  IA   + N+    PGI E+L++  LGL
Sbjct: 214 MGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVIAPGIAEALLATALGL 273

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             +IP+ + YN F      +  Q+   A + 
Sbjct: 274 VAAIPAVVIYNIFARQIGNYRAQVGDVAAQV 304


>gi|260219673|emb|CBA26518.1| Biopolymer transport protein exbB [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 239

 Score =  144 bits (364), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 47/215 (21%), Positives = 82/215 (38%), Gaps = 4/215 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
            + +  L+ Q     K +  LL   S+ SW VI+ K+++ +  +      E  FW     
Sbjct: 4   QLGLITLWTQGDWVTKSVAVLLLGMSLASWIVILIKTLDILKFKSLAARTE-YFWHSAEF 62

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           E    +L    +     +  +        ++        + I D I R +  +I      
Sbjct: 63  EEGIDTLGAPTDNPFVQLARAGQEATAHHRNTQTQLHDALDISDWISRSLRNSIDDSTAR 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGL 186
               L+ L S+ S    VG+ G V G+      I       +      I E+LI   LGL
Sbjct: 123 FQSGLAVLASVGSTAPFVGLFGTVWGIYHALMGIGASGQATIDKVAGPIGEALIMTALGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            V+IP+ + YN  +  +K    ++  FA++  A  
Sbjct: 183 AVAIPAVLGYNALVRGNKSILTKLNRFAHDLHAYF 217


>gi|296283274|ref|ZP_06861272.1| TolQ, tolQ protein [Citromicrobium bathyomarinum JL354]
          Length = 237

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 67/220 (30%), Positives = 116/220 (52%), Gaps = 2/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
              +    LFM   + VK ++  L + SI SW +II  ++     +++ R+FEQ FW+ +
Sbjct: 17  PTRLEPVKLFMDADIVVKAVMAALLLASIWSWMIIISVAMKIGGAKKRARKFEQDFWASE 76

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           + E        + ++  A I   A++EWKKS   G +   G Q RI  +MD  +A E + 
Sbjct: 77  NYEETLD-AYRNQDVAPARIAWGAITEWKKSTKGGVKDVRGAQGRIAAVMDSHVAEEADR 135

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +  +L+FL ++ S    VG+ G V G+M  F  I    ++++  +   I E+L +  +GL
Sbjct: 136 MANRLTFLATLGSVAPFVGLFGTVWGIMNSFFQIGAQNNSSLAVVAPGISEALFATAIGL 195

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ IAYN+F     ++   ++ FA+ F+A L R+ E
Sbjct: 196 FAAIPAVIAYNRFSASVNRYEAILQRFADRFNANLGRELE 235


>gi|170691328|ref|ZP_02882493.1| protein TolQ [Burkholderia graminis C4D1M]
 gi|295675615|ref|YP_003604139.1| protein TolQ [Burkholderia sp. CCGE1002]
 gi|307728554|ref|YP_003905778.1| protein TolQ [Burkholderia sp. CCGE1003]
 gi|323524841|ref|YP_004226994.1| protein TolQ [Burkholderia sp. CCGE1001]
 gi|170143533|gb|EDT11696.1| protein TolQ [Burkholderia graminis C4D1M]
 gi|295435458|gb|ADG14628.1| protein TolQ [Burkholderia sp. CCGE1002]
 gi|307583089|gb|ADN56487.1| protein TolQ [Burkholderia sp. CCGE1003]
 gi|323381843|gb|ADX53934.1| protein TolQ [Burkholderia sp. CCGE1001]
          Length = 225

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 75/222 (33%), Positives = 115/222 (51%), Gaps = 3/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI +L +   L  + ++ LL + S+LSW+ I +K       R Q   FE+ FWSG 
Sbjct: 4   TQDLSIVSLVLNASLLAQAVMALLLLLSLLSWTFIFRKWFAIRRARAQTERFERDFWSGG 63

Query: 68  SLETVCKSLKNHHNIG--LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            L+ + +S  N+ +    L  IF S M E+ K  +K    P  I D   R M  A  RE+
Sbjct: 64  DLQALYQSAANNRHTIGALERIFESGMREFLKGKEKRLNDPGAILDGARRAMRAAFQREM 123

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILL 184
           + +   L+FL S+ S    +G+ G V G+M  F+ +A      +    PGI E+L +  +
Sbjct: 124 DVLEANLAFLASVGSVSPYIGLFGTVWGIMNAFRGLANVQQATLANVAPGIAEALTATAI 183

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           GL  +IP+ +AYN++  D  + A++ E F  EFS IL RQ  
Sbjct: 184 GLFAAIPAVVAYNRYAHDIDRLAIRFETFIEEFSNILQRQAH 225


>gi|91788751|ref|YP_549703.1| MotA/TolQ/ExbB proton channel [Polaromonas sp. JS666]
 gi|91697976|gb|ABE44805.1| Cell division and transport-associated protein TolQ [Polaromonas
           sp. JS666]
          Length = 230

 Score =  144 bits (364), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 71/223 (31%), Positives = 113/223 (50%), Gaps = 3/223 (1%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SI +L +     V+ ++ LL   SI SW+ I +K V    +++   +F++ FWSG S
Sbjct: 3   QDLSIVSLILNASWVVQLVVALLVGVSIASWAAIFRKIVALKKVQKLNDDFDREFWSGTS 62

Query: 69  LETVCKSLKNH--HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           L  +      +  H+  +  IF S M E++K  ++       + D   R M  +  REL+
Sbjct: 63  LNDLFAGAAQNAKHSGAMERIFASGMREYQKLRERRIADTGTLLDGARRAMRASYQRELD 122

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            I   LSFL ++ S    VG+ G V G+M  F  +A      +    PGI E+L++  +G
Sbjct: 123 AIEVNLSFLATVGSVSPYVGLFGTVWGIMHAFTGLAALEQVTLATVAPGIAEALVATAIG 182

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
           L  +IP+ +AYN+F  D  + A ++E F  EFS IL R     
Sbjct: 183 LFAAIPAVVAYNRFAHDIDRVANRLETFIEEFSNILQRNLGAQ 225


>gi|264679183|ref|YP_003279090.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni CNB-2]
 gi|299533538|ref|ZP_07046914.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni S44]
 gi|262209696|gb|ACY33794.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni CNB-2]
 gi|298718444|gb|EFI59425.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni S44]
          Length = 240

 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 45/215 (20%), Positives = 86/215 (40%), Gaps = 4/215 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
              I  ++ Q     K +  +L + S+ SW VII K+++ +  ++   + +   W    L
Sbjct: 4   QFGIAHVWTQGDFVTKGVAIILLVMSVASWLVIILKALDIVKFKKFATQAQDF-WHSPDL 62

Query: 70  ETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            T  + L +        + +     S   +         + I D + R +   I      
Sbjct: 63  ATGLEKLGDDKQNPFRFMVLEGREASAHHRKTSVHLHDTLDISDWVTRCLRNGINEFTAR 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGL 186
           +   L+ L S+ S    +G+ G V G+     +I     +++      I E+LI   LGL
Sbjct: 123 LQSGLAILASVGSTAPFIGLFGTVWGIYHALVAIGMSGQSSIDKVAGPIGEALIMTALGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            V+IP+ + YN  +  +K     +  FA++  A  
Sbjct: 183 AVAIPAVLGYNALVRGNKGILNALNSFAHDVHAYF 217


>gi|37527796|ref|NP_931141.1| biopolymer transport protein ExbB [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787232|emb|CAE16313.1| Biopolymer transport protein ExbB [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 344

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 43/220 (19%), Positives = 98/220 (44%), Gaps = 2/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI+ ++    + VK ++  L I S+++W++   K    +   R+ R+        +
Sbjct: 119 ATDLSIWGMYQNADIVVKTVMIGLVIASVITWALFFSKGTELLASGRRLRKERLALTDVK 178

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SL+   +  +  +   ++ + +S +   ++     +      ++R    ++ ++A     
Sbjct: 179 SLDQAAEIAEGFNKHSISRLLLSEVQA-ERQLSSESTDLNSTKERAAFRLERSVAAISRH 237

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL
Sbjct: 238 MGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGL 297

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ + YN F      +  Q+   A +   +L R  +
Sbjct: 298 VAAIPAVVIYNIFARMIVAYRGQVGDMAAQSILLLGRDLD 337


>gi|85714503|ref|ZP_01045491.1| exbB, uptake of enterochelin; tonB-dependent uptake of B colicins
           [Nitrobacter sp. Nb-311A]
 gi|85698950|gb|EAQ36819.1| exbB, uptake of enterochelin; tonB-dependent uptake of B colicins
           [Nitrobacter sp. Nb-311A]
          Length = 296

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/221 (22%), Positives = 101/221 (45%), Gaps = 4/221 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   +++   +FM     VK ++  L + S+++WSV + K++  +  R +          
Sbjct: 66  ILPHELTPIGMFMAADAIVKAVMIGLALASVVTWSVWLAKTIELLGARSRLLRDLHSVED 125

Query: 66  GQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAREL 125
            +SL+   K L+   N  +A +  +A  E  +S  + A +  G+++R+  +     A   
Sbjct: 126 VRSLDEASKILQ-RSNSDIAILTNAARDEIHRS--QDAMNHDGVKERVASLFSRIEAAAA 182

Query: 126 EEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILL 184
             +T   S L ++ S    VG+ G V G+M  F  I+   + N+  +   I E+L++  +
Sbjct: 183 RRMTRGTSILATIGSTAPFVGLFGTVWGIMNAFIGISKTQTTNLAVVAPGIAEALLATAM 242

Query: 185 GLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           GL  +IP+ + YN F      +   +   + E   ++SR  
Sbjct: 243 GLVAAIPAVMIYNVFSRSITGYRGLLGDGSAELMRMVSRDL 283


>gi|262368711|ref|ZP_06062040.1| TolQ protein [Acinetobacter johnsonii SH046]
 gi|262316389|gb|EEY97427.1| TolQ protein [Acinetobacter johnsonii SH046]
          Length = 236

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 54/220 (24%), Positives = 110/220 (50%), Gaps = 3/220 (1%)

Query: 7   AIMD-ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           A MD +S++ L     + VK ++ +L + S++SW +I++  +      + +  F + F  
Sbjct: 7   ATMDQMSVWMLISHASVLVKVVMLILVLSSVVSWYLIVRHGMLLRGQEQLWNRFLKNFRQ 66

Query: 66  GQSLETVCKSLKNHHNIG-LAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
            + L  + +  +       + +IF   + E+ +       +   + D ++R +  +I+ E
Sbjct: 67  QKDLNLLQQDYQQPEQQKGVVSIFQHGIDEYHQLIKDEQLTTSDVIDGVERRLLSSISEE 126

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISIL 183
            E++ + L+FL ++ S    +G+ G V G+M  F  ++      +    PGI E+LI+  
Sbjct: 127 EEKLQQNLTFLATVGSVSPYIGLFGTVWGIMNAFIGLSAVEQATLNTVAPGIAEALIATA 186

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           +GL  +IP+ +AYN+F   + K + +  GFANE    + R
Sbjct: 187 IGLFAAIPAVVAYNRFSARADKLSSRYYGFANELQTRIYR 226


>gi|222054201|ref|YP_002536563.1| protein TolQ [Geobacter sp. FRC-32]
 gi|221563490|gb|ACM19462.1| protein TolQ [Geobacter sp. FRC-32]
          Length = 224

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 52/199 (26%), Positives = 91/199 (45%), Gaps = 9/199 (4%)

Query: 34  FSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMS 93
           FS++SW++I  K +       +   F + FW  +  + +   L    N  L  +F     
Sbjct: 21  FSVVSWAIIFYKLLQVHRANNESERFLEFFWKAKRFDAINAQLDRFANSPLTVLFNEGYG 80

Query: 94  EWKKSCDKGAR--------SPIGIQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLV 145
           E KK  +KG          + +   D I R +  A   E+  + + L+FL +  S    +
Sbjct: 81  ELKKLMEKGEEKQDPNVISTDLAGIDNITRALRRATTSEITRLEKYLTFLATTGSTAPFI 140

Query: 146 GILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVSIPSSIAYNKFIEDSK 204
           G+ G V G+M  F+ I    S ++  +   I E+LI+  +GL  +IP+ + YN F +  +
Sbjct: 141 GLFGTVWGIMTAFKGIGETGSASLAVVAPGIAEALIATAIGLVAAIPAVMGYNHFQQKIR 200

Query: 205 KFAMQMEGFANEFSAILSR 223
               +M+ F+ EF  I+ R
Sbjct: 201 VLIGEMDSFSTEFLNIVQR 219


>gi|323698028|ref|ZP_08109940.1| protein TolQ [Desulfovibrio sp. ND132]
 gi|323699567|ref|ZP_08111479.1| protein TolQ [Desulfovibrio sp. ND132]
 gi|323457960|gb|EGB13825.1| protein TolQ [Desulfovibrio desulfuricans ND132]
 gi|323459499|gb|EGB15364.1| protein TolQ [Desulfovibrio desulfuricans ND132]
          Length = 233

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 65/220 (29%), Positives = 107/220 (48%), Gaps = 5/220 (2%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D SI  L     LAVK ++  L   S+ SW++I  K     T R++  +  + F +   L
Sbjct: 6   DNSILTLLSGATLAVKLVMLFLGCMSLWSWTIIFLKFFTIGTARKKVIQGYEAFVAAGDL 65

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWK---KSCDKGARSPIGIQDRIDRMMDVAIARELE 126
               KSL +     LA +   A+ E++   K+     R  + ++D + R++   I++E+ 
Sbjct: 66  AKGIKSLGD-QESPLARVASLAIKEFRLLEKAGVNRERKRLLVKDTLRRVLKQGISKEMR 124

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLG 185
            +T  L FL + ++A   +G+ G V G+M  F SI    S  +    PGI E+LI+  +G
Sbjct: 125 SLTRNLPFLATCANAAPFIGLFGTVWGIMHSFHSIGMAQSAALATVAPGISEALIATAIG 184

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           L V+IP++I YN F+    +    M  FA  F     R+ 
Sbjct: 185 LLVAIPATIFYNYFLGKLNEVESGMVDFAGAFLNRAEREI 224


>gi|253997472|ref|YP_003049536.1| MotA/TolQ/ExbB proton channel [Methylotenera mobilis JLW8]
 gi|253984151|gb|ACT49009.1| MotA/TolQ/ExbB proton channel [Methylotenera mobilis JLW8]
          Length = 249

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/215 (23%), Positives = 91/215 (42%), Gaps = 3/215 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           + + +      G     +  +L + S+ SW  I+ KS+     R  ++ +   FW   SL
Sbjct: 6   EFNSWEFITAGGPVSMLVALILLVMSVASWYFIVTKSIAVWRTRSAYKAYLAAFWQAPSL 65

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMS--EWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
               K  +     G+A +   A+   E  KS    A   +   + + R M+ +I  E   
Sbjct: 66  AAAVKQGQQVSATGMARLAEKAVQAAEHHKSHAAKAVDIVAQDEFVARAMNRSITEEAAN 125

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGL 186
           +   L+ L S+ S    VG+ G V G+     SI+      +      + E+LI    GL
Sbjct: 126 MEGGLTVLASVGSVSPFVGLFGTVWGIYHALASISLSGQATLDKVAGPVGEALIMTAFGL 185

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            V+IP+ +AYN  +  ++  + ++E F  E   ++
Sbjct: 186 AVAIPAVLAYNAIVRSNRALSAELEKFGYELHTLI 220


>gi|183601006|ref|ZP_02962499.1| hypothetical protein PROSTU_04622 [Providencia stuartii ATCC 25827]
 gi|188019339|gb|EDU57379.1| hypothetical protein PROSTU_04622 [Providencia stuartii ATCC 25827]
          Length = 310

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 98/218 (44%), Gaps = 2/218 (0%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S++ ++      VK ++  L + S+++W++   K +  +  RR+ +         +SL
Sbjct: 87  DLSVWGMYQNADNVVKTVMIGLVLASVITWALFFSKGIELLAARRRLKAEVAQLNKVKSL 146

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +      +      +  + +   +  +++    +    GI+DR    ++ +IA     + 
Sbjct: 147 DEAMSIAEGFKANSVTRLLLK-QAVVERTLSAQSTDLSGIKDRTGFRLERSIAAISRHMG 205

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
               +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  +GL  
Sbjct: 206 RGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATAIGLIA 265

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ + YN F      +  Q+   A + + +L R  +
Sbjct: 266 AIPAVVIYNIFARMINNYRGQVGDVAAQAALLLGRDLD 303


>gi|77920568|ref|YP_358383.1| TolQ protein [Pelobacter carbinolicus DSM 2380]
 gi|77546651|gb|ABA90213.1| Cell division and transport-associated protein TolQ [Pelobacter
           carbinolicus DSM 2380]
          Length = 223

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 55/218 (25%), Positives = 100/218 (45%), Gaps = 8/218 (3%)

Query: 14  FALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLETVC 73
             L    GL VK ++ +L  FS+LSW++I  K           + F+Q FW+ + ++ + 
Sbjct: 1   MELISDAGLVVKLVLLILIGFSLLSWAIIFLKFRVIYRAISDSQRFQQFFWNKRHIDAIA 60

Query: 74  KSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGI-------QDRIDRMMDVAIARELE 126
           + L++  +   A++F     E K++          +        D + R +  A  +E +
Sbjct: 61  QKLRDFPHAPTASLFRDGYQEMKRNQRDNGTDEPTLFSADMGQADNVARALRRATNQETQ 120

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   L FL +  S    +G+ G V G+M  F  I    S ++  +   I E+L++  +G
Sbjct: 121 RLERYLPFLATTGSTAPFIGLFGTVWGIMDSFHGIGKTGSASLAVVAPGISEALVATAIG 180

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSR 223
           L  +IP+ +AYN F+         M+ F+ EF  I+ R
Sbjct: 181 LVAAIPAVVAYNHFVSKVNVLTGDMDSFSQEFLNIVDR 218


>gi|238024465|ref|YP_002908697.1| MotA/TolQ/ExbB proton channel [Burkholderia glumae BGR1]
 gi|238025671|ref|YP_002909903.1| MotA/TolQ/ExbB proton channel [Burkholderia glumae BGR1]
 gi|237879130|gb|ACR31462.1| MotA/TolQ/ExbB proton channel [Burkholderia glumae BGR1]
 gi|237880336|gb|ACR32667.1| MotA/TolQ/ExbB proton channel [Burkholderia glumae BGR1]
          Length = 244

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/224 (22%), Positives = 94/224 (41%), Gaps = 10/224 (4%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M  YG+A        ++ Q     + I   L   S++SW VI+ K +    L    +  +
Sbjct: 1   MEQYGIA-------NVWQQGDFITRFIFVFLLGMSVVSWFVIVTKGLANRRLETMGKRAQ 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGI--QDRIDRMMD 118
             FWS  S +   K+L +  +    A+ ++     ++    GA     +   + + R + 
Sbjct: 54  TRFWSTPSFDEGIKALGDGADNPYRAMALAGREANEQQAGGGASLQGSLSASEWVARGLR 113

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A   E+  +   L+ LGS+ S    VG+ G V G+     +I      ++      + E
Sbjct: 114 NAFDDEVARLQNGLAVLGSIGSTAPFVGLFGTVWGIYHALMAIGASGQASLDHVAGPVGE 173

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           SLI   +GL V+IP+ + +N     +K+ + ++  F +E     
Sbjct: 174 SLIMTAIGLFVAIPAVLGFNYVNRGNKRVSHRLNRFVHELHVYF 217


>gi|26991982|ref|NP_747407.1| ferric siderophore transport system protein ExbB [Pseudomonas
           putida KT2440]
 gi|24987113|gb|AAN70871.1|AE016731_6 ferric siderophore transport system protein ExbB [Pseudomonas
           putida KT2440]
          Length = 320

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 50/225 (22%), Positives = 100/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R     
Sbjct: 85  SLGMA-HDLSPWGMYKNADIVVKIVMIGLAIASIITWTIWIAKGFELMGAKRRLRGEIAQ 143

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                +L+   +    +    LA   +    E  +     AR   GI++R+   ++  + 
Sbjct: 144 LKKSTTLKEASEV--TNKEGTLAHTLVHDALEEMRLS-ANAREKEGIKERVSFRLERLVH 200

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 201 ASGRTMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 260

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 261 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 305


>gi|154248193|ref|YP_001419151.1| TonB-system energizer ExbB type-1 [Xanthobacter autotrophicus Py2]
 gi|154162278|gb|ABS69494.1| TonB-system energizer ExbB type-1 [Xanthobacter autotrophicus Py2]
          Length = 327

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 53/224 (23%), Positives = 94/224 (41%), Gaps = 5/224 (2%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S + +FM   L VK ++  L   S+++W+V   KS+  +  RR          +  
Sbjct: 96  PHDLSPWGMFMAADLVVKAVMVGLAFASLVTWTVWFAKSLELVFARRAVARTLDALQAAP 155

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L                A   +A++EWK S         GI++R+   +    AR    
Sbjct: 156 TLFDAAA-AMPKDRGAAPATVKAALAEWKVSE---GLPVEGIKERVAVALSRIEARAGRR 211

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           ++     L ++ +    VG+ G V G+M  F  I+   + N+  +   I E+L++  LGL
Sbjct: 212 LSGGTGVLATIGATAPFVGLFGTVWGIMNAFIGISRAQTTNLAVVAPGIAEALLATALGL 271

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
             +IP+ + YN F         ++   + E    LSR  +   S
Sbjct: 272 VAAIPAVVIYNLFARAIAAQKARLADTSAEVMRHLSRDLDRAAS 315


>gi|86749211|ref|YP_485707.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris HaA2]
 gi|86572239|gb|ABD06796.1| MotA/TolQ/ExbB proton channel [Rhodopseudomonas palustris HaA2]
          Length = 313

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 48/221 (21%), Positives = 104/221 (47%), Gaps = 4/221 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
            + ++S +++F+Q  + VK ++  L + S+++W+++I K +     R + R   +     
Sbjct: 83  GLTELSPWSMFLQADIVVKAVMVGLALASMITWTILIAKKIELGRARWRLRSALKQIADA 142

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           +S+     +L       ++ +  +A+ E + S   G  S  GI++R        +  E  
Sbjct: 143 RSMSEAQLALG-DKTSPVSMLLAAALREARVSA--GLASDEGIKERAASSFSEIVRAESR 199

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FL ++ +    +G+ G V G+M  F  I+   + N+  +   I E+L++  +G
Sbjct: 200 HMRHGMGFLATIGATAPFIGLFGTVWGIMNSFIGISKSQTTNLAVVAPGIAEALLATAIG 259

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I YN F  + K +   +   +     +LSR  +
Sbjct: 260 LVAAIPAVIIYNHFSREIKVYLEMVARASGAALRLLSRDLD 300


>gi|296161441|ref|ZP_06844247.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. Ch1-1]
 gi|295888256|gb|EFG68068.1| MotA/TolQ/ExbB proton channel [Burkholderia sp. Ch1-1]
          Length = 262

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 56/229 (24%), Positives = 95/229 (41%), Gaps = 15/229 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M +YGLA        ++    +  +CI++ L I S+LSW+VI+ K    + ++R  R+ E
Sbjct: 1   MQHYGLA-------NVWESGDIVTRCILSTLLIMSVLSWTVILVKLWTILRIKRVTRQAE 53

Query: 61  QLFWSGQSLETVCKSLKNH-------HNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRI 113
             FW     E   KSL  H       + +   A+     +   +         I + D I
Sbjct: 54  AQFWRADHFEDGLKSLGAHASKSVRDNPLLALALAGEEAAAHHQQTQSHLHDRIDVSDWI 113

Query: 114 DRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSI 172
            R +   +   +  +   L+ L S+ S    VG+ G V G+      I      ++    
Sbjct: 114 TRRLQDTMDDAIARMQSGLAVLASIGSTAPFVGLFGTVWGIYHALILIGETGQTSIDHVA 173

Query: 173 PGIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
             + ESLI    GL V+IP+ + YN     +K    +++ FA+   A  
Sbjct: 174 GPVGESLIMTAFGLFVAIPAVLGYNGLTRANKSVVTRLKRFAHGLHAYF 222


>gi|148653364|ref|YP_001280457.1| Tol-Pal system, TolQ [Psychrobacter sp. PRwf-1]
 gi|148572448|gb|ABQ94507.1| Tol-Pal system, TolQ [Psychrobacter sp. PRwf-1]
          Length = 263

 Score =  144 bits (363), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 62/217 (28%), Positives = 114/217 (52%), Gaps = 3/217 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           I++ AL  +  L V+ ++ +L + S++ W +I + S    T +RQ + FE  FWSG+ L 
Sbjct: 22  INLIALITEASLLVQIVMAILLLASVICWVLIFRLSARLGTAKRQDQHFENWFWSGEDLS 81

Query: 71  TVCKSLKNHHN-IGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
            + + ++N  +  GLA IF    SE+ +  +K  +    I D ++R + V + R+ + + 
Sbjct: 82  KLYQGIQNSPDRHGLANIFYVGFSEFLRM-NKKRQPKDHIIDGVERKLRVGLGRQQQSLE 140

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
             L+ L S+ S    +G+ G V G+M  F  +A     ++ ++   I E+LI+  +GL  
Sbjct: 141 SGLAVLASIGSVSPYIGLFGTVWGIMNAFLGLAQVEQVSLSAVAPGIAEALIATAMGLFA 200

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQT 225
           +IP+ +AYN F   +         F +E + +L R+T
Sbjct: 201 AIPAVLAYNHFTAKAAGIYDSRALFCDEMTGMLQRET 237


>gi|319763204|ref|YP_004127141.1| mota/tolq/exbb proton channel [Alicycliphilus denitrificans BC]
 gi|330825398|ref|YP_004388701.1| MotA/TolQ/ExbB proton channel [Alicycliphilus denitrificans K601]
 gi|317117765|gb|ADV00254.1| MotA/TolQ/ExbB proton channel [Alicycliphilus denitrificans BC]
 gi|329310770|gb|AEB85185.1| MotA/TolQ/ExbB proton channel [Alicycliphilus denitrificans K601]
          Length = 239

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 84/214 (39%), Gaps = 4/214 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
             I  +++Q     + +  LL   S+ SW VII K+++ +  ++  R+  + FW  +   
Sbjct: 5   FGIANVWIQGDFVTRAVAVLLLGMSLASWIVIIIKALDIVRYKKHARQA-RDFWHSEDFA 63

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
                L          + +         ++        + + D + R +   I      +
Sbjct: 64  AGLTKLGADPANPFRHLALEGREATAHHRNTQAHLHDSLDVSDWVTRCLRNCIDEFTARL 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGLC 187
              L+ L S+ S    +G+ G V G+     +I     + +      I E+LI   LGL 
Sbjct: 124 QSGLAILASVGSTAPFIGLFGTVWGIYHALVAIGASGQSTIDKVAGPIGEALIMTALGLA 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           V+IP+ + YN  +  +K     +  FA++  A  
Sbjct: 184 VAIPAVLGYNALVRGNKSVLSSLNSFAHDLHAYF 217


>gi|192292067|ref|YP_001992672.1| tonB-system energizer ExbB [Rhodopseudomonas palustris TIE-1]
 gi|192285816|gb|ACF02197.1| tonB-system energizer ExbB [Rhodopseudomonas palustris TIE-1]
          Length = 316

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 41/220 (18%), Positives = 88/220 (40%), Gaps = 1/220 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   +FM     VK ++  L + S LSW++ + K+V       + +    +    +
Sbjct: 79  PHDLSPIGMFMAADWVVKAVMIALLLASFLSWTICVAKTVELACANARAKRAFLIVDRSR 138

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            L+     L       +  +  ++    +          +G+++R+   +    A+    
Sbjct: 139 DLDEAVHRLSKRGGPAVFMVRSASEELHRSLPVLAYSGEVGLKERVVSRLARIEAQAGRR 198

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           +      L ++ +    VG+ G V G+M  F  I+  ++ N+  +   I E+L++   GL
Sbjct: 199 LMRGTGLLATVGAVSPFVGLFGTVWGIMNAFIGISQSHTTNLAVVAPGIAEALLATAFGL 258

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +IP+ I YN F      +   +   A     ++S   +
Sbjct: 259 VAAIPAVIIYNVFARAISGYRQVLADAAVGVERLISLDLD 298


>gi|238793632|ref|ZP_04637255.1| TonB complex protein [Yersinia intermedia ATCC 29909]
 gi|238727047|gb|EEQ18578.1| TonB complex protein [Yersinia intermedia ATCC 29909]
          Length = 336

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 47/216 (21%), Positives = 102/216 (47%), Gaps = 3/216 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             GLA MD+S++ ++    + VK ++  L + SI++W+++  K       RR+ ++  ++
Sbjct: 95  PQGLA-MDLSVWGMYQHADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLQQEYEV 153

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
             +   L+T  +  +      ++A+ +      ++     +    GI++R    ++  +A
Sbjct: 154 IGAVTELDTASERAEAFSTDSISALLLREAQN-ERLLSTESNDNNGIKERAAFRLERRVA 212

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
               ++ +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 213 AIGRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 272

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             LGL  +IP+ + YN F      +  Q+   A + 
Sbjct: 273 TALGLVAAIPAVVIYNIFARLIGSYRAQVGDVAAQV 308


>gi|170694658|ref|ZP_02885810.1| MotA/TolQ/ExbB proton channel [Burkholderia graminis C4D1M]
 gi|170140540|gb|EDT08716.1| MotA/TolQ/ExbB proton channel [Burkholderia graminis C4D1M]
          Length = 242

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 53/228 (23%), Positives = 91/228 (39%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L + S++SWSVI+ K  N + L R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALALLVMSVMSWSVIVIKGWNVMRLNRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMS------AMSEWKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L    +      F++        ++            + + D + 
Sbjct: 54  QAFWHSDDLADGVKKLGAGASTPQDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAIVAKLSRFAHGLHAFF 221


>gi|121594748|ref|YP_986644.1| MotA/TolQ/ExbB proton channel [Acidovorax sp. JS42]
 gi|222110639|ref|YP_002552903.1| mota/tolq/exbb proton channel [Acidovorax ebreus TPSY]
 gi|120606828|gb|ABM42568.1| outer membrane transport energization protein ExbB [Acidovorax sp.
           JS42]
 gi|221730083|gb|ACM32903.1| MotA/TolQ/ExbB proton channel [Acidovorax ebreus TPSY]
          Length = 238

 Score =  144 bits (363), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 43/214 (20%), Positives = 87/214 (40%), Gaps = 4/214 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
             I  +++Q     + +  LL   S+ SW VII K+++ +  ++  R+  + FW  +   
Sbjct: 5   FGIANVWVQGDFVTRAVAVLLIGMSLASWIVIIIKALDILKFKKHARQA-RDFWHSEDFA 63

Query: 71  TVCKSLKNHHNIGLAAIFMSAMS--EWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
                L +  +     + +      +  ++        + + D + R +   I      +
Sbjct: 64  AGLTKLGSDPSNPFRHLALEGREATQHHRNTQAHLHDSLDVSDWVTRCLRNCIDEFTARV 123

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGLC 187
              L+ L S+ S    +G+ G V G+     +I     + +      I E+LI   LGL 
Sbjct: 124 QSGLAILASVGSTAPFIGLFGTVWGIYHALVAIGASGQSTIDKVAGPIGEALIMTALGLA 183

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           V+IP+ + YN  +  +K     +  FA++  A  
Sbjct: 184 VAIPAVLGYNALVRGNKSILHSLNSFAHDLHAYF 217


>gi|154250831|ref|YP_001411655.1| TonB-system energizer ExbB type-1 [Parvibaculum lavamentivorans
           DS-1]
 gi|154154781|gb|ABS61998.1| TonB-system energizer ExbB type-1 [Parvibaculum lavamentivorans
           DS-1]
          Length = 309

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/218 (21%), Positives = 95/218 (43%), Gaps = 4/218 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
           D+S + +F+   + VK ++  L   SI++W++ + K+      R + +       + ++L
Sbjct: 83  DLSPWGMFLAADIVVKAVMIGLVFASIVTWTIWLAKNTEIARARSRAKSGFAALAASKTL 142

Query: 70  ETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           +   + L       +  +  +A+ E + S         G+++RI        A    EI 
Sbjct: 143 DEAGEKL-RSAKGPVQQLAQAAIHEMQLSGTAP--DKEGVKERIAWRFQRIEANTAREIG 199

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCV 188
                L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++  LGL  
Sbjct: 200 IGTGVLATIGATAPFVGLFGTVWGIMNSFIGIAHTQTTNLAVVAPGIAEALLATGLGLVA 259

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +IP+ + YN F      +   +   + E   ++SR  +
Sbjct: 260 AIPAVVIYNSFSRAIAGYRAIVADSSAELLRLVSRDLD 297


>gi|316933259|ref|YP_004108241.1| tonB-system energizer ExbB [Rhodopseudomonas palustris DX-1]
 gi|315600973|gb|ADU43508.1| tonB-system energizer ExbB [Rhodopseudomonas palustris DX-1]
          Length = 308

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/221 (23%), Positives = 103/221 (46%), Gaps = 4/221 (1%)

Query: 7   AIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSG 66
            + ++S + +F+   + VK ++  L I S+++W++ I K +     R + R   +     
Sbjct: 78  GMSELSPWTMFLNADIVVKIVMIGLAISSVITWTIFIAKKIELGRARIRLRRSLKQIGES 137

Query: 67  QSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELE 126
           +SL     +L + H   L+ +  +A+ E K S   G  S  GI++R        +  E  
Sbjct: 138 RSLAEAQMALGDKH-SVLSMLLAAALREAKLSA--GLSSDEGIKERAASSFSEYVRAEGR 194

Query: 127 EITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLG 185
            +   + FL ++ +    +G+ G V G+M  F  I+   + N+  +   I E+L++  +G
Sbjct: 195 HMRRGMGFLATIGATAPFIGLFGTVWGIMNSFIGISKSQTTNLAVVAPGIAEALLATAIG 254

Query: 186 LCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           L  +IP+ I YN F  + K +   +   +     +LSR  +
Sbjct: 255 LVAAIPAVIIYNHFSREIKVYLELVARASGAAGRLLSRDLD 295


>gi|90418655|ref|ZP_01226566.1| biopolymer transport protein exbB [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336735|gb|EAS50440.1| biopolymer transport protein exbB [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 289

 Score =  144 bits (363), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 96/222 (43%), Gaps = 4/222 (1%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+S   +FM     VK ++  L   S+++W++ + K++     +R+ R   +     +
Sbjct: 57  PHDLSPMGMFMAADWVVKAVMIGLAFASLVTWTIGLSKAMELALAKRRARVGVRRLARAE 116

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           +L     + +      +AA+  SA +E  +S      S  GI++R+   +    A     
Sbjct: 117 TLTEALTANRRRWRGPVAALAQSAEAERARSA---DLSDDGIKERVSVALSRIEAGAGRS 173

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGL 186
           I+     L ++ S    VG+ G V G+M  F  I+   + N+  +   I E+L++  +GL
Sbjct: 174 ISRGTGILATIGSTAPFVGLFGTVWGIMNAFIGISQANTTNLAVVAPGIAEALLATAIGL 233

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGN 228
             +IP+ I YN F      +   +   +      LSR  +  
Sbjct: 234 VAAIPAVIVYNVFARSIAGYRAVLSDGSALVLQHLSRDLDRR 275


>gi|284006382|emb|CBA71618.1| biopolymer transport protein [Arsenophonus nasoniae]
          Length = 312

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 47/219 (21%), Positives = 99/219 (45%), Gaps = 2/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
            D+SI++++    + VK ++  L + SI++W++   K +  I   RQ ++ +Q     +S
Sbjct: 87  QDLSIWSMYQHADMVVKAVMLGLIVASIITWALFFSKGIEMIGAYRQLQKEQQKLSKVKS 146

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+             +       +   +K+   G+    G +DR    ++ A+A     +
Sbjct: 147 LDDAIGIAATFKKNSVTRKLYDEV-VAEKTLSAGSHDLNGTKDRASFRLERAVASISRYM 205

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
                +L ++ +    +G+ G V G+M  F  IA   + N+  +   I E+L++  +GL 
Sbjct: 206 GRGNGYLATIGAISPFIGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATAIGLV 265

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ + YN F      +  Q+   A + + +L R  +
Sbjct: 266 AAIPAVVIYNLFARMINTYRGQLGDVAAQATVLLGRDLD 304


>gi|268592103|ref|ZP_06126324.1| ferric siderophore transport system protein ExbB [Providencia
           rettgeri DSM 1131]
 gi|291312499|gb|EFE52952.1| ferric siderophore transport system protein ExbB [Providencia
           rettgeri DSM 1131]
          Length = 314

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 100/225 (44%), Gaps = 2/225 (0%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             G    D+S++ ++      VK ++  L I S+++W++   K +  +  RR+ +   + 
Sbjct: 84  PTGGFDQDLSVWGMYQNADNVVKTVMIGLVIASVITWALFFSKGLEILVARRRLKAEAKA 143

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
               +SL+      +      +  + ++  +  +++    +    G ++R    ++ A+A
Sbjct: 144 IAEVKSLDEAVSIAEGFKANSITRMLLNE-AVTERALSANSSDLSGTKERTSFRLERAVA 202

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                +     +L ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 203 AISRYMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 262

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             +GL  +IP+ + YN F      +  Q+   A + + +L R  +
Sbjct: 263 TAIGLIAAIPAVVIYNIFARMINNYRGQVGDVAAQSALLLGRDLD 307


>gi|262375664|ref|ZP_06068896.1| TolQ [Acinetobacter lwoffii SH145]
 gi|262309267|gb|EEY90398.1| TolQ [Acinetobacter lwoffii SH145]
          Length = 293

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/221 (22%), Positives = 93/221 (42%), Gaps = 11/221 (4%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N YGL  M       + +  +  K  + +L I SI +W ++I K +    +R+Q +E E 
Sbjct: 67  NPYGLEAM-------WKEGDMVSKVTLFILVIMSIGTWYIMISKCLQQSKIRKQAKEAEH 119

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
            FW   SL+   ++L       +         +  K+        I     +   +  AI
Sbjct: 120 QFWESSSLDNATENL---DEASVYRFIAEKGIKSTKNHGGTLLERIDFNTWVTISISRAI 176

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLI 180
            +    ++  L+FL ++ S    VG+ G V G+     +I      ++      + E+LI
Sbjct: 177 DKIQNHLSGGLAFLATVGSTAPFVGLFGTVWGIYHALTAIGVSGQASIDKVAGPVGEALI 236

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
              +GL V++P+ + YN     +K    ++  F ++  A+L
Sbjct: 237 MTAIGLAVAVPAVLGYNWLTRRNKAVMEEVRTFGSDLHAVL 277


>gi|226952121|ref|ZP_03822585.1| Tol-Pal system TolQ protein [Acinetobacter sp. ATCC 27244]
 gi|226837130|gb|EEH69513.1| Tol-Pal system TolQ protein [Acinetobacter sp. ATCC 27244]
          Length = 232

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
           + I  L +Q    V+ ++ +L + SI SW VI +  ++F    +    F+++FWSG  L 
Sbjct: 9   MHISDLILQASPVVQLVMLILLLASIYSWYVIAKLHMSFKKTGQDDEHFQKMFWSGAELN 68

Query: 71  TVCKSLK-NHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEIT 129
           T+  + + N    GL  +F   +SE+ K   + A +   I +  +RM+ V ++RE   + 
Sbjct: 69  TLYNNAQLNSKRNGLEDVFYQGLSEFFKLKKRKADTTQTI-EGTERMLRVGLSREQGGLE 127

Query: 130 EKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISILLGLCV 188
           + L  L S+ S    +G+ G V G+M  F  +A      +    PGI E+LI+  +GL  
Sbjct: 128 QSLGVLASIGSVAPYIGLFGTVWGIMNAFIGLAAVDQVTLATVAPGIAEALIATAIGLFA 187

Query: 189 SIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEG 227
           +IP+ +A+N F    +        FA E  A+L RQ+ G
Sbjct: 188 AIPAVLAFNHFTAKGEAIYSDRALFAEEMVALLQRQSIG 226


>gi|170734612|ref|YP_001773726.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia MC0-3]
 gi|169820650|gb|ACA95231.1| MotA/TolQ/ExbB proton channel [Burkholderia cenocepacia MC0-3]
          Length = 246

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 48/224 (21%), Positives = 92/224 (41%), Gaps = 10/224 (4%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M  YG+A        ++ Q     + I   L   S++SW VI+ K      L    +  +
Sbjct: 1   MEQYGIA-------NVWQQGDFVTRFIFVFLIGMSVVSWFVILTKGFANRRLESLGKRAQ 53

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMD 118
             FWS  S+     +L    +    A+ ++    +E     +   +  +   + + R + 
Sbjct: 54  TGFWSSASISDGIAALGERGDNPYRALVLAGREANEQHAGNEPSMQGSLSASEWVARGLR 113

Query: 119 VAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIE 177
            A   E+  +   L+ LGS+ S    VG+ G V G+     +I      ++      + E
Sbjct: 114 NAFDDEVARLQNGLAVLGSIGSTAPFVGLFGTVWGIYHALMAIGMSGQASLDHVAGPVGE 173

Query: 178 SLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
           SL+   +GL V+IP+ + +N     +K+ + ++  FA+E     
Sbjct: 174 SLVMTAIGLFVAIPAVLGFNYVNRGNKRVSHRLNRFAHELHVYF 217


>gi|187923405|ref|YP_001895047.1| MotA/TolQ/ExbB proton channel [Burkholderia phytofirmans PsJN]
 gi|187714599|gb|ACD15823.1| MotA/TolQ/ExbB proton channel [Burkholderia phytofirmans PsJN]
          Length = 243

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 56/228 (24%), Positives = 91/228 (39%), Gaps = 14/228 (6%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           M NYGLA        ++ Q     + I   L I S++SWSVI+ K  N + L R  +  E
Sbjct: 1   MQNYGLA-------HVWAQGDFVTRGIALALLIMSVMSWSVIVIKGWNVMRLNRLTKNAE 53

Query: 61  QLFWSGQSLETVCKSLK----NHHNIGLAAIFMSAMSE--WKKSCDKGARSPIGIQDRID 114
           Q FW    L    K L       H+    A+ +S                  + + D + 
Sbjct: 54  QAFWHSDDLADGVKKLGAGSSTPHDNPFLALALSGQEAADHHHQTQPHLHDRMDVSDWVT 113

Query: 115 RMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIP 173
           R +   +   +  +   L+ L S+ S    VG+ G V G+     +I     +++     
Sbjct: 114 RCLKDTMDESVARMQSGLAILASIGSTAPFVGLFGTVWGIYHALLAIGASGQSSIDQVAG 173

Query: 174 GIIESLISILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            + E+LI    GL V+IP+ + YN     +K    ++  FA+   A  
Sbjct: 174 PVGEALIMTAFGLFVAIPAVLGYNALTRANKAVVAKLSRFAHGLHAFF 221


>gi|257481748|ref|ZP_05635789.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv.
           tabaci ATCC 11528]
          Length = 317

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 101/226 (44%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 77  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 135

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 136 NLKKARSLNEASSTAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 192

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 193 AACGRNMSMGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 252

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 253 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 298


>gi|104784347|ref|YP_610845.1| solvent/drug/ferric siderophore transport protein ExbB [Pseudomonas
           entomophila L48]
 gi|95113334|emb|CAK18062.1| solvent/drug/ferric siderophore transport protein ExbB [Pseudomonas
           entomophila L48]
          Length = 320

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/225 (22%), Positives = 99/225 (44%), Gaps = 5/225 (2%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
           + G+A  D+S + ++    + VK ++  L + SI++W++ I K    +  +R+ R     
Sbjct: 85  SLGMA-HDLSPWGMYKNADVVVKAVMIGLALASIITWTIWIAKGFELMGAKRRLRGEIAA 143

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
                SL+             LA   +    E  +     AR   GI++R+   ++  +A
Sbjct: 144 LKRSVSLKEASDVSN--KEGTLAHTLVHDALEEMRLS-ANAREKEGIKERVSFRLERLVA 200

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
                ++     L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 201 ASGRNMSSGTGVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALLA 260

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
             LGL  +IP+ + YN F      +  Q+   + +   ++SR  +
Sbjct: 261 TALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAQVLLLVSRDLD 305


>gi|260431111|ref|ZP_05785082.1| protein TolQ [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414939|gb|EEX08198.1| protein TolQ [Silicibacter lacuscaerulensis ITI-1157]
          Length = 231

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 79/219 (36%), Positives = 121/219 (55%), Gaps = 1/219 (0%)

Query: 9   MDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQS 68
           +D S++ LF +    VK ++ +L + S  SWS+IIQ+ +N+   RR+   F+Q FWSG  
Sbjct: 12  IDFSMWGLFARATFIVKVVMLMLVVASFWSWSIIIQRLINYRAARREAEAFDQAFWSGNP 71

Query: 69  LETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEI 128
           L+ + + +    +     IF + M EW++S         G   RIDR MDVAIA+E E++
Sbjct: 72  LDELFEQIGPQPDGASEKIFAAGMIEWRRSHRNDGGLIAGATARIDRSMDVAIAKEAEKL 131

Query: 129 TEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLC 187
            + L  L ++ S    +G+ G V G+M  F  IA   + N+  +   I E+L++  LGL 
Sbjct: 132 KKGLPILATVGSTAPFIGLFGTVWGIMNAFIEIAEQQNTNLAVVAPGIAEALLATGLGLL 191

Query: 188 VSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
            +IP+ I YNK   DS       E FA+EF+ ILSRQ +
Sbjct: 192 AAIPAVIFYNKLSADSDHIIGGYEAFADEFATILSRQLD 230


>gi|253990989|ref|YP_003042345.1| biopolymer transport exbb protein [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782439|emb|CAQ85603.1| biopolymer transport exbb protein [Photorhabdus asymbiotica]
          Length = 386

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 43/210 (20%), Positives = 97/210 (46%), Gaps = 2/210 (0%)

Query: 8   IMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQ 67
             D+SI+ ++    + VK ++  L I S+++W++   K    +   R+ R+ +      +
Sbjct: 161 ATDLSIWGMYQNADVVVKTVMIGLVIASVITWALFFSKGAELLAAGRRLRKEQLALAEVK 220

Query: 68  SLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
           SL+   +  +    + ++ + +S +   ++   +        ++R    ++ ++A     
Sbjct: 221 SLDQAAEMAEGFSKLSISRMLLSEVQAERQLSSESL-DLNSTKERASFRLERSVAAISRH 279

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSI-PGIIESLISILLGL 186
           +     +L ++ +    VG+ G V G+M  F  IA   + N+  + PGI E+L++  LGL
Sbjct: 280 MGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLATALGL 339

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANE 216
             +IP+ + YN F      +  Q+   A +
Sbjct: 340 VAAIPAVVIYNIFARMIASYRGQVGDVAAQ 369


>gi|238782872|ref|ZP_04626901.1| TonB complex protein [Yersinia bercovieri ATCC 43970]
 gi|238716295|gb|EEQ08278.1| TonB complex protein [Yersinia bercovieri ATCC 43970]
          Length = 332

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 46/216 (21%), Positives = 102/216 (47%), Gaps = 3/216 (1%)

Query: 3   NYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQL 62
             GLA MD+S++ ++    + VK ++  L + SI++W+++  K       RR+  +  ++
Sbjct: 91  PQGLA-MDLSVWGMYQHADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLLQEHEV 149

Query: 63  FWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIA 122
             +   L+T  +  +   +  ++++ +      ++     +    GI++R    ++  +A
Sbjct: 150 IGAVTDLDTASERAEVFASDSISSLLLREAQN-ERLLSAESNDNNGIKERAAFRLERRVA 208

Query: 123 RELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLIS 181
               ++ +   FL ++ +    VG+ G V G+M  F  IA   + N+  +   I E+L++
Sbjct: 209 AIGRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA 268

Query: 182 ILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEF 217
             LGL  +IP+ + YN F      +  Q+   A + 
Sbjct: 269 TALGLVAAIPAVVIYNIFARLIGSYRAQVGDVAAQV 304


>gi|330890916|gb|EGH23577.1| TonB system transport protein ExbB1 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 317

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 53/226 (23%), Positives = 102/226 (45%), Gaps = 5/226 (2%)

Query: 2   NNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQ 61
           N+ G+A  D+S + ++    + VK ++  L I SI++W++ I K    +  +R+ R    
Sbjct: 77  NSLGMA-HDLSPWGMYQNADVVVKAVMIGLAIASIITWTIWISKGFELLGAKRRLRGEIV 135

Query: 62  LFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAI 121
                +SL     +        LA + +    E  +     +R   GI++R+   ++  +
Sbjct: 136 NLKKARSLNEASSTAS--KEGTLAHLLVHDALEEMRLS-ANSREREGIKERVSFRLERLV 192

Query: 122 ARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLI 180
           A     ++   S L ++ S    VG+ G V G+M  F  IA   + N+  +   I E+L+
Sbjct: 193 AACGRNMSMGTSVLATIGSTAPFVGLFGTVWGIMNSFIGIAKTQTTNLAVVAPGIAEALL 252

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           +  LGL  +IP+ + YN F      +  Q+   +     ++SR  +
Sbjct: 253 ATALGLVAAIPAVVIYNVFARSIAGYKAQVSDASAHVLLLVSRDLD 298


>gi|114570969|ref|YP_757649.1| MotA/TolQ/ExbB proton channel [Maricaulis maris MCS10]
 gi|114341431|gb|ABI66711.1| Cell division and transport-associated protein TolQ [Maricaulis
           maris MCS10]
          Length = 222

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 65/215 (30%), Positives = 108/215 (50%), Gaps = 10/215 (4%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
            S +ALFM+    VK ++ +L   SI SW++ I KS+    L  + R+FE+ FWSG+SL+
Sbjct: 15  FSFYALFMRADWVVKGVMGILAFMSIWSWAIAIDKSLQLRGLHAKGRQFEREFWSGRSLD 74

Query: 71  TVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEEITE 130
            +      +     + +F + + EWK     G         R+ +       R++ E   
Sbjct: 75  ALSDQFAKNAREPFSRVFAAGLREWKGDNPGG---------RVAKAAGAEAGRQMTESEG 125

Query: 131 KLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISILLGLCVS 189
            L  L +++SA   VG+ G V G+M  F+SIA     N+  +   I E+L +  LGL  +
Sbjct: 126 GLGILATIASAAPFVGLFGTVWGIMNAFRSIAASQDTNLAVVAPGIAEALFATALGLLAA 185

Query: 190 IPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           IP+ I +N    +  K+  +++GF +E SA+  R 
Sbjct: 186 IPAVIFFNALSANLAKYGSRLDGFVDELSALADRD 220


>gi|310816769|ref|YP_003964733.1| tonB-system energizer ExbB [Ketogulonicigenium vulgare Y25]
 gi|308755504|gb|ADO43433.1| tonB-system energizer ExbB [Ketogulonicigenium vulgare Y25]
          Length = 311

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 49/223 (21%), Positives = 93/223 (41%), Gaps = 1/223 (0%)

Query: 5   GLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFW 64
           GL   D+S   ++ Q  + VK ++  L   +I++W V++ K +     R + R   +L  
Sbjct: 79  GLGGHDMSPMGMYNQADVVVKSVMIGLAAAAIVTWIVLVAKWLQLTGARGRARRTLRLLE 138

Query: 65  SGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIARE 124
             +SL     +L          +  ++          G     G+++R+   M+      
Sbjct: 139 QSRSLSDASAALAGRSGAPALLVRAASDEIAASQDVLGQVDGEGVKERVASRMNRIEIAA 198

Query: 125 LEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPG-IIESLISIL 183
              I   +  L ++ S G  VG+ G V G+M  F  IA   + N+  +   I E+L++  
Sbjct: 199 GRRIGRGVGLLATIGSVGPFVGLFGTVWGIMNSFIGIAETQTTNLAVVAPGIAEALLATA 258

Query: 184 LGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTE 226
           LGL  +IP+ + YN F      +   +   +     ++SR  +
Sbjct: 259 LGLVAAIPAVVIYNGFARAITGYRQLLGDVSASIGRLVSRDLD 301


>gi|121611697|ref|YP_999504.1| MotA/TolQ/ExbB proton channel [Verminephrobacter eiseniae EF01-2]
 gi|121556337|gb|ABM60486.1| MotA/TolQ/ExbB proton channel [Verminephrobacter eiseniae EF01-2]
          Length = 235

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 73/228 (32%), Positives = 112/228 (49%), Gaps = 3/228 (1%)

Query: 6   LAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWS 65
           +   D+SI +L +     V+ ++ LL   SI SW+ I++K      ++    EFE+ FWS
Sbjct: 1   MNSQDMSIISLMLHASWMVQLVLLLLLSVSIASWAAILRKLFALARIKALNEEFEREFWS 60

Query: 66  GQSLETVCKSL--KNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVAIAR 123
           G SL  +  +          +  IF S M E +K  ++    P  + D   R M  +  R
Sbjct: 61  GASLNDLYANATRNARQAGPMERIFASGMREHQKLRERRIADPGTLLDGARRAMRASFQR 120

Query: 124 ELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNV-VSIPGIIESLISI 182
           E++ +   LSFL S+ S    VG+ G V G+M  F   AG     +    PGI E+L++ 
Sbjct: 121 EMDVVESSLSFLASVGSVSPYVGLFGTVWGIMHAFTGFAGMAQVTLATVAPGIAEALVAT 180

Query: 183 LLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
            +GL  +IP+ IAYN+F  D  + A   E F  EFS IL R    +++
Sbjct: 181 AIGLFAAIPAVIAYNRFARDIDRVATHQETFIEEFSNILQRNLGAHVA 228


>gi|221066179|ref|ZP_03542284.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni KF-1]
 gi|220711202|gb|EED66570.1| MotA/TolQ/ExbB proton channel [Comamonas testosteroni KF-1]
          Length = 240

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 44/215 (20%), Positives = 86/215 (40%), Gaps = 4/215 (1%)

Query: 10  DISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSL 69
              I  ++ Q     K +  +L + S+ SW VI+ K+++ +  ++   + +   W    L
Sbjct: 4   QFGIAHVWTQGDFVTKGVAIILLVMSVASWLVIVLKALDIVKFKKFATQAQDF-WHSPDL 62

Query: 70  ETVCKSLKNHHNIGLAAIFMSA--MSEWKKSCDKGARSPIGIQDRIDRMMDVAIARELEE 127
            T  + L +        + +     S   +         + I D + R +   I      
Sbjct: 63  ATGLEKLGDDKQNPFRFMVLEGREASAHHRKTSVHLHDTLDISDWVTRCLRNGINEFTAR 122

Query: 128 ITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVV-SIPGIIESLISILLGL 186
           +   L+ L S+ S    +G+ G V G+     +I     +++      I E+LI   LGL
Sbjct: 123 LQSGLAILASVGSTAPFIGLFGTVWGIYHALVAIGMSGQSSIDKVAGPIGEALIMTALGL 182

Query: 187 CVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAIL 221
            V+IP+ + YN  +  +K     +  FA++  A  
Sbjct: 183 AVAIPAVLGYNALVRGNKGILNALNSFAHDVHAYF 217


>gi|120611968|ref|YP_971646.1| MotA/TolQ/ExbB proton channel [Acidovorax citrulli AAC00-1]
 gi|120590432|gb|ABM33872.1| outer membrane transport energization protein ExbB [Acidovorax
           citrulli AAC00-1]
          Length = 238

 Score =  144 bits (362), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 45/214 (21%), Positives = 86/214 (40%), Gaps = 4/214 (1%)

Query: 11  ISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFEQLFWSGQSLE 70
             I  +++Q     + +  LL   S+ SW VI+ K+++ I  ++  R   + FW  +   
Sbjct: 5   FGIANVWIQGDFVTR