BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780551|ref|YP_003064964.1| tolQ protein [Candidatus
Liberibacter asiaticus str. psy62]
         (230 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780551|ref|YP_003064964.1| tolQ protein [Candidatus Liberibacter asiaticus str. psy62]
          Length = 230

 Score =  463 bits (1191), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 230/230 (100%), Positives = 230/230 (100%)

Query: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60
           MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE
Sbjct: 1   MNNYGLAIMDISIFALFMQMGLAVKCIITLLFIFSILSWSVIIQKSVNFITLRRQFREFE 60

Query: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120
           QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA
Sbjct: 61  QLFWSGQSLETVCKSLKNHHNIGLAAIFMSAMSEWKKSCDKGARSPIGIQDRIDRMMDVA 120

Query: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLI 180
           IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLI
Sbjct: 121 IARELEEITEKLSFLGSMSSAGLLVGILGAVLGMMGFFQSIAGYYSNNVVSIPGIIESLI 180

Query: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230
           SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS
Sbjct: 181 SILLGLCVSIPSSIAYNKFIEDSKKFAMQMEGFANEFSAILSRQTEGNIS 230


>gi|254780922|ref|YP_003065335.1| glucose-1-phosphate thymidylyltransferase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 292

 Score = 26.2 bits (56), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 184 LGLCVSIPSSIAY-NKFIEDSKKFAMQMEGFANEFSAILSRQ 224
           LGL V+ P  IAY + FI +S+ F + ++ F N    +  RQ
Sbjct: 244 LGLYVACPEEIAYRHDFINESQFFQL-IDHFGNSPYGLYLRQ 284


>gi|254780395|ref|YP_003064808.1| organic solvent tolerance protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 762

 Score = 24.3 bits (51), Expect = 2.1,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%)

Query: 167 NNVVSIPGIIESLISILLGLCVSIPSSIAY--NKFIED 202
           NN+ +I G+I   I IL     SIP SI    N  +ED
Sbjct: 579 NNLFTINGVIGRSIHILGTNSFSIPDSIGIGQNSGLED 616


>gi|255764488|ref|YP_003065099.2| flagellar motor protein MotA [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 290

 Score = 22.7 bits (47), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 109 IQDRIDRMMDVAIARELEEITEKLSFLGSMSSAGLLVGILGAVLGMM 155
           I++ +D  +D+ +  +L+     +S +G    A   +GI+GA+LG++
Sbjct: 143 IENLMDEEIDIILYEKLKP-YHAISHMGESLPA---IGIVGAILGII 185


>gi|254780805|ref|YP_003065218.1| chromosome partitioning protein B [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 300

 Score = 22.3 bits (46), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 6/17 (35%), Positives = 13/17 (76%)

Query: 63 FWSGQSLETVCKSLKNH 79
          ++  + LE +C+S+K+H
Sbjct: 57 YFESEGLEDLCQSIKSH 73


>gi|254780705|ref|YP_003065118.1| phosphate ABC transporter, permease protein PstA [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 425

 Score = 21.9 bits (45), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 14/25 (56%)

Query: 156 GFFQSIAGYYSNNVVSIPGIIESLI 180
           GFF S      NN+ S+P I+  ++
Sbjct: 239 GFFSSFVQANINNLASVPSIVYGIL 263


>gi|254780976|ref|YP_003065389.1| Holliday junction resolvase YqgF [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 160

 Score = 21.9 bits (45), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 19/28 (67%)

Query: 110 QDRIDRMMDVAIARELEEITEKLSFLGS 137
           + RI ++  +A A  L+E+ +++SFL S
Sbjct: 130 KKRIQKVDSIAAALILQEVLDRISFLES 157


>gi|254780545|ref|YP_003064958.1| metalloprotease [Candidatus Liberibacter asiaticus str. psy62]
          Length = 647

 Score = 21.9 bits (45), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 8/66 (12%)

Query: 40  SVIIQKSVNFITLRRQFREFEQLFWSGQSLETVCKSLK-----NHHNIGL-AAIFMSAMS 93
           S+I +K+ NF+ +     E+E L  SG+ + ++ +  K         + L A++  + + 
Sbjct: 558 SIIQEKNDNFVAIAEALLEYETL--SGKEIASLIRGEKISRPSEDDGVALCASVPQAGVQ 615

Query: 94  EWKKSC 99
           E + SC
Sbjct: 616 EAEVSC 621


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.325    0.138    0.394 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 138,474
Number of Sequences: 1233
Number of extensions: 5372
Number of successful extensions: 33
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 21
Number of HSP's gapped (non-prelim): 14
length of query: 230
length of database: 328,796
effective HSP length: 71
effective length of query: 159
effective length of database: 241,253
effective search space: 38359227
effective search space used: 38359227
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 37 (18.9 bits)