Query gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 41 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Sun May 29 22:03:49 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780555.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 COG3617 Prophage antirepressor 92.6 0.045 1.1E-06 33.3 1.0 38 1-39 6-43 (176) 2 pfam02498 Bro-N BRO family, N- 82.4 0.37 9.5E-06 28.4 0.2 26 13-39 1-26 (91) 3 TIGR01508 rib_reduct_arch diam 57.6 5.6 0.00014 22.2 1.5 14 10-23 75-88 (224) 4 cd03462 1,2-CCD chlorocatechol 46.4 12 0.00032 20.4 1.8 15 14-28 144-158 (247) 5 KOG4605 consensus 42.0 21 0.00055 19.1 2.4 24 5-28 78-101 (129) 6 cd03460 1,2-CTD Catechol 1,2 d 42.0 15 0.00037 20.0 1.6 21 5-28 163-183 (282) 7 pfam08980 DUF1883 Domain of un 40.7 29 0.00075 18.4 3.0 26 9-35 51-76 (95) 8 cd03458 Catechol_intradiol_dio 40.7 17 0.00043 19.7 1.7 15 14-28 149-163 (256) 9 cd03461 1,2-HQD Hydroxyquinol 38.0 22 0.00056 19.0 2.0 15 14-28 165-179 (277) 10 COG4770 Acetyl/propionyl-CoA c 34.7 34 0.00088 18.0 2.5 18 12-29 272-289 (645) 11 TIGR00227 ribD_Cterm riboflavi 34.1 17 0.00044 19.6 0.9 13 11-23 81-93 (239) 12 pfam00775 Dioxygenase_C Dioxyg 30.0 34 0.00087 18.0 1.9 19 7-28 71-89 (181) 13 COG4257 Vgb Streptogramin lyas 29.9 39 0.00099 17.7 2.1 24 5-28 98-121 (353) 14 pfam02017 CIDE-N CIDE-N domain 29.4 34 0.00086 18.1 1.8 18 6-23 33-50 (78) 15 smart00266 CAD Domains present 28.6 38 0.00096 17.8 1.9 19 6-24 31-49 (74) 16 cd05845 Ig2_L1-CAM_like Second 28.3 39 0.001 17.7 1.9 17 12-28 48-64 (95) 17 COG1598 Predicted nuclease of 27.1 63 0.0016 16.6 2.8 24 12-35 4-27 (73) 18 pfam09837 DUF2064 Uncharacteri 26.9 60 0.0015 16.7 2.7 21 8-28 85-105 (121) 19 cd01615 CIDE_N CIDE_N domain, 26.7 42 0.0011 17.5 1.9 19 6-24 33-51 (78) 20 KOG0210 consensus 26.4 71 0.0018 16.3 3.0 27 4-30 544-572 (1051) 21 pfam07936 BDS_I_II Antihyperte 26.1 39 0.00099 17.7 1.6 20 20-39 11-30 (43) 22 pfam03622 IBV_3B IBV 3B protei 26.1 38 0.00098 17.8 1.6 34 4-37 17-62 (64) 23 pfam11760 CbiG_N Cobalamin syn 25.6 44 0.0011 17.5 1.8 20 8-27 34-53 (84) 24 cd03463 3,4-PCD_alpha Protocat 25.5 47 0.0012 17.3 1.9 15 14-28 85-99 (185) 25 cd06539 CIDE_N_A CIDE_N domain 25.1 44 0.0011 17.4 1.7 19 6-24 33-51 (78) 26 cd06538 CIDE_N_FSP27 CIDE_N do 23.3 48 0.0012 17.2 1.6 18 6-24 33-50 (79) 27 pfam03396 Pox_RNA_pol_35 Poxvi 21.7 58 0.0015 16.8 1.8 35 3-37 157-193 (292) 28 COG3485 PcaH Protocatechuate 3 21.3 61 0.0015 16.7 1.8 15 14-28 121-135 (226) 29 cd00421 intradiol_dioxygenase 20.0 69 0.0018 16.4 1.9 15 14-28 58-72 (146) No 1 >COG3617 Prophage antirepressor [Transcription] Probab=92.60 E-value=0.045 Score=33.33 Aligned_cols=38 Identities=37% Similarity=0.814 Sum_probs=32.1 Q ss_pred CCCCCCCCCCCCCEEEEEECCCCEEEEEEECCCCCEEEE Q ss_conf 974001002568289999179989999821247602212 Q gi|254780555|r 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 (41) Q Consensus 1 msdmipfnlehnpirivvdedgnywfmvkdvaggldfts 39 (41) |+.+.||+.+...+|+|++.. +-||.-+|||--|+++. T Consensus 6 ~~~~~~f~F~~~~vRvv~~d~-epwFva~Dva~~Lg~~n 43 (176) T COG3617 6 MTMLQPFTFEDHAVRVVLDDG-EPWFVAADVARALGYTN 43 (176) T ss_pred CCCCCCEEECCCEEEEEEECC-CEEEEHHHHHHHHCCCC T ss_conf 144652740683478997589-65576999999977778 No 2 >pfam02498 Bro-N BRO family, N-terminal domain. This family includes the N-terminus of baculovirus BRO and ALI motif proteins. The function of BRO proteins is unknown. It has been suggested that BRO-A and BRO-C are DNA binding proteins that influence host DNA replication and/or transcription. This Pfam domain does not include the characteristic invariant alanine, leucine, isoleucine motif of the ALI proteins. Probab=82.43 E-value=0.37 Score=28.43 Aligned_cols=26 Identities=42% Similarity=0.815 Sum_probs=21.9 Q ss_pred CEEEEEECCCCEEEEEEECCCCCEEEE Q ss_conf 289999179989999821247602212 Q gi|254780555|r 13 PIRIVVDEDGNYWFMVKDVAGGLDFTS 39 (41) Q Consensus 13 pirivvdedgnywfmvkdvaggldfts 39 (41) .||++. .+|+.||..+|+|.+|.|.. T Consensus 1 ~ir~v~-~~~~~wf~a~dia~~Lgy~~ 26 (91) T pfam02498 1 EVRTVV-INGEPWFVAKDVAKALGYKN 26 (91) T ss_pred CEEEEE-ECCEEEEEHHHHHHHHCCCC T ss_conf 959999-99988688899999958998 No 3 >TIGR01508 rib_reduct_arch diaminohydroxyphosphoribosylaminopyrimidine reductase; InterPro: IPR006401 These sequences represent a specific reductase of riboflavin biosynthesis in the archaea, diaminohydroxyphosphoribosylaminopyrimidine reductase. It should not be confused with bacterial 5-amino-6-(5-phosphoribosylamino)uracil reductase. The intermediate 2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine in riboflavin biosynthesis is reduced first and then deaminated in both archaea and fungi, opposite to the order in bacteria. The subsequent deaminase is not presently known and is not closely homologous to the deaminase domain fused to the reductase domain, which is similar to this protein but found in most bacteria. . Probab=57.55 E-value=5.6 Score=22.19 Aligned_cols=14 Identities=50% Similarity=0.783 Sum_probs=10.8 Q ss_pred CCCCEEEEEECCCC Q ss_conf 56828999917998 Q gi|254780555|r 10 EHNPIRIVVDEDGN 23 (41) Q Consensus 10 ehnpirivvdedgn 23 (41) +-||+|+|||..-+ T Consensus 75 ~PnP~RvVvds~~r 88 (224) T TIGR01508 75 EPNPVRVVVDSKLR 88 (224) T ss_pred CCCCEEEEECCEEC T ss_conf 75977999712007 No 4 >cd03462 1,2-CCD chlorocatechol 1,2-dioxygenases (1,2-CCDs) (type II enzymes) are homodimeric intradiol dioxygenases that degrade chlorocatechols via the addition of molecular oxygen and the subsequent cleavage between two adjacent hydroxyl groups. This reaction is part of the modified ortho-cleavage pathway which is a central oxidative bacterial pathway that channels chlorocatechols, derived from the degradation of chlorinated benzoic acids, phenoxyacetic acids, phenols, benzenes, and other aromatics into the energy-generating tricarboxylic acid pathway. Probab=46.38 E-value=12 Score=20.35 Aligned_cols=15 Identities=40% Similarity=0.490 Sum_probs=12.8 Q ss_pred EEEEEECCCCEEEEE Q ss_conf 899991799899998 Q gi|254780555|r 14 IRIVVDEDGNYWFMV 28 (41) Q Consensus 14 irivvdedgnywfmv 28 (41) -|+..|+||.|||-- T Consensus 144 g~~~Td~~G~y~f~t 158 (247) T cd03462 144 GKIRTDEDGRYEVRT 158 (247) T ss_pred EEEEECCCCEEEEEE T ss_conf 799818997699999 No 5 >KOG4605 consensus Probab=41.99 E-value=21 Score=19.11 Aligned_cols=24 Identities=21% Similarity=0.454 Sum_probs=19.3 Q ss_pred CCCCCCCCCEEEEEECCCCEEEEE Q ss_conf 010025682899991799899998 Q gi|254780555|r 5 IPFNLEHNPIRIVVDEDGNYWFMV 28 (41) Q Consensus 5 ipfnlehnpirivvdedgnywfmv 28 (41) -++.+.-.|+|..|+++|.||.-- T Consensus 78 ~~~~tklrPvrFkvektg~~wlCn 101 (129) T KOG4605 78 FQGRTKLRPVRFKVEKTGMVWLCN 101 (129) T ss_pred CCCCCCCCCEEEEECCCCEEEEEC T ss_conf 644246662476763666488362 No 6 >cd03460 1,2-CTD Catechol 1,2 dioxygenase (1,2-CTD) catalyzes an intradiol cleavage reaction of catechol to form cis,cis-muconate. 1,2-CTDs is homodimers with one catalytic non-heme ferric ion per monomer. They belong to the aromatic dioxygenase family, a family of mononuclear non-heme iron intradiol-cleaving enzymes that catalyze the oxygenation of catecholates to aliphatic acids via the cleavage of aromatic rings. Probab=41.96 E-value=15 Score=19.98 Aligned_cols=21 Identities=48% Similarity=0.830 Sum_probs=15.2 Q ss_pred CCCCCCCCCEEEEEECCCCEEEEE Q ss_conf 010025682899991799899998 Q gi|254780555|r 5 IPFNLEHNPIRIVVDEDGNYWFMV 28 (41) Q Consensus 5 ipfnlehnpirivvdedgnywfmv 28 (41) -+|||. -|+..|+||+|||-- T Consensus 163 ~~~nlR---g~~~td~~G~y~f~t 183 (282) T cd03460 163 SPFNLR---RSIITDADGRYRFRS 183 (282) T ss_pred CCCCCE---EEEECCCCCEEEEEE T ss_conf 987643---699708983699999 No 7 >pfam08980 DUF1883 Domain of unknown function (DUF1883). This domain is found in a set of hypothetical bacterial proteins. Probab=40.73 E-value=29 Score=18.37 Aligned_cols=26 Identities=35% Similarity=0.732 Sum_probs=20.6 Q ss_pred CCCCCEEEEEECCCCEEEEEEECCCCC Q ss_conf 256828999917998999982124760 Q gi|254780555|r 9 LEHNPIRIVVDEDGNYWFMVKDVAGGL 35 (41) Q Consensus 9 lehnpirivvdedgnywfmvkdvaggl 35 (41) .+..|+||.|-+.| .|..+-|..|.- T Consensus 51 ~~ksP~ri~vP~sG-~W~vvvD~~G~~ 76 (95) T pfam08980 51 AKKSPARIAVPSSG-HWYVVVDLEGHS 76 (95) T ss_pred CCCCCEEEECCCCC-EEEEEEECCCCC T ss_conf 22387699768995-189999668852 No 8 >cd03458 Catechol_intradiol_dioxygenases Catechol intradiol dioxygenases can be divided into several subgroups according to their substrate specificity for catechol, chlorocatechols and hydroxyquinols. Almost all members of this family are homodimers containing one ferric ion (Fe3+) per monomer. They belong to the intradiol dioxygenase family, a family of mononuclear non-heme iron intradiol-cleaving enzymes that catalyze the oxygenation of catecholates to aliphatic acids via the cleavage of aromatic rings. Probab=40.66 E-value=17 Score=19.66 Aligned_cols=15 Identities=40% Similarity=0.636 Sum_probs=12.5 Q ss_pred EEEEEECCCCEEEEE Q ss_conf 899991799899998 Q gi|254780555|r 14 IRIVVDEDGNYWFMV 28 (41) Q Consensus 14 irivvdedgnywfmv 28 (41) =|+..|+||+|||-- T Consensus 149 G~~~Td~dG~y~f~T 163 (256) T cd03458 149 GKFRTDEDGRYRFRT 163 (256) T ss_pred EEEEECCCCEEEEEE T ss_conf 899718993699999 No 9 >cd03461 1,2-HQD Hydroxyquinol 1,2-dioxygenase (1,2-HQD) catalyzes the ring cleavage of hydroxyquinol (1,2,4-trihydroxybenzene), a intermediate in the degradation of a large variety of aromatic compounds including some polychloro- and nitroaromatic pollutants, to form 3-hydroxy-cis,cis-muconates. 1,2-HQD blongs to the aromatic dioxygenase family, a family of mononuclear non-heme intradiol-cleaving enzymes. Probab=37.97 E-value=22 Score=19.03 Aligned_cols=15 Identities=40% Similarity=0.592 Sum_probs=12.6 Q ss_pred EEEEEECCCCEEEEE Q ss_conf 899991799899998 Q gi|254780555|r 14 IRIVVDEDGNYWFMV 28 (41) Q Consensus 14 irivvdedgnywfmv 28 (41) -|+..|+||.|||-- T Consensus 165 G~~~Td~~G~y~f~t 179 (277) T cd03461 165 GKFRTDEDGRYAFRT 179 (277) T ss_pred EEEEECCCCCEEEEE T ss_conf 899868985589999 No 10 >COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Probab=34.73 E-value=34 Score=18.02 Aligned_cols=18 Identities=33% Similarity=0.870 Sum_probs=14.1 Q ss_pred CCEEEEEECCCCEEEEEE Q ss_conf 828999917998999982 Q gi|254780555|r 12 NPIRIVVDEDGNYWFMVK 29 (41) Q Consensus 12 npirivvdedgnywfmvk 29 (41) ..+...||+|+|+|||-- T Consensus 272 GTVEFivd~~~~f~FlEM 289 (645) T COG4770 272 GTVEFIVDADGNFYFLEM 289 (645) T ss_pred CEEEEEECCCCCEEEEEE T ss_conf 558999838986899986 No 11 >TIGR00227 ribD_Cterm riboflavin-specific deaminase C-terminal domain; InterPro: IPR011549 Eubacterial riboflavin-specific deaminases have a zinc-binding domain, IPR002125 from INTERPRO, toward the N-terminus and this domain toward the C-terminus. Yeast HTP reductase, a riboflavin-biosynthetic enzyme, and several archaeal proteins related to riboflavin biosynthesis consist only of this domain and lack the zinc-binding domain.; GO: 0008703 5-amino-6-(5-phosphoribosylamino)uracil reductase activity, 0050661 NADP binding, 0009231 riboflavin biosynthetic process. Probab=34.12 E-value=17 Score=19.62 Aligned_cols=13 Identities=38% Similarity=0.854 Sum_probs=10.2 Q ss_pred CCCEEEEEECCCC Q ss_conf 6828999917998 Q gi|254780555|r 11 HNPIRIVVDEDGN 23 (41) Q Consensus 11 hnpirivvdedgn 23 (41) .||+|||+|-.-. T Consensus 81 ~~PvRvv~Dskqk 93 (239) T TIGR00227 81 RNPVRVVLDSKQK 93 (239) T ss_pred CCCCCEEEECCCE T ss_conf 6995189826740 No 12 >pfam00775 Dioxygenase_C Dioxygenase. Probab=30.03 E-value=34 Score=18.05 Aligned_cols=19 Identities=53% Similarity=0.852 Sum_probs=14.4 Q ss_pred CCCCCCCEEEEEECCCCEEEEE Q ss_conf 0025682899991799899998 Q gi|254780555|r 7 FNLEHNPIRIVVDEDGNYWFMV 28 (41) Q Consensus 7 fnlehnpirivvdedgnywfmv 28 (41) ||+- =|+..|+||+|||.. T Consensus 71 ~~~r---Gr~~Td~dG~y~f~T 89 (181) T pfam00775 71 FNLR---GRIVTDAEGRYRFRT 89 (181) T ss_pred CCCE---EEEEECCCCEEEEEE T ss_conf 6625---699748998399999 No 13 >COG4257 Vgb Streptogramin lyase [Defense mechanisms] Probab=29.85 E-value=39 Score=17.73 Aligned_cols=24 Identities=33% Similarity=0.598 Sum_probs=13.0 Q ss_pred CCCCCCCCCEEEEEECCCCEEEEE Q ss_conf 010025682899991799899998 Q gi|254780555|r 5 IPFNLEHNPIRIVVDEDGNYWFMV 28 (41) Q Consensus 5 ipfnlehnpirivvdedgnywfmv 28 (41) .|..---.|--||+++||+-|+.- T Consensus 98 ypLg~Ga~Phgiv~gpdg~~Witd 121 (353) T COG4257 98 YPLGSGASPHGIVVGPDGSAWITD 121 (353) T ss_pred EECCCCCCCCEEEECCCCCEEEEC T ss_conf 756888887537878988726852 No 14 >pfam02017 CIDE-N CIDE-N domain. This domain is found in CAD nuclease and ICAD, the inhibitor of CAD nuclease. The two proteins interact through this domain. Probab=29.36 E-value=34 Score=18.05 Aligned_cols=18 Identities=28% Similarity=0.486 Sum_probs=14.7 Q ss_pred CCCCCCCCEEEEEECCCC Q ss_conf 100256828999917998 Q gi|254780555|r 6 PFNLEHNPIRIVVDEDGN 23 (41) Q Consensus 6 pfnlehnpirivvdedgn 23 (41) -|++...+++||.+|||. T Consensus 33 ~l~l~~~~~~lvLeeDGT 50 (78) T pfam02017 33 ILQLPDGLSTLVLEEDGT 50 (78) T ss_pred HHCCCCCCCEEEEECCCC T ss_conf 848998772899936895 No 15 >smart00266 CAD Domains present in proteins implicated in post-mortem DNA fragmentation. Probab=28.56 E-value=38 Score=17.81 Aligned_cols=19 Identities=32% Similarity=0.733 Sum_probs=14.8 Q ss_pred CCCCCCCCEEEEEECCCCE Q ss_conf 1002568289999179989 Q gi|254780555|r 6 PFNLEHNPIRIVVDEDGNY 24 (41) Q Consensus 6 pfnlehnpirivvdedgny 24 (41) .|++...|++||.+|||.- T Consensus 31 ~l~l~~~~~~lvLeeDGT~ 49 (74) T smart00266 31 KLALPDSPVTLVLEEDGTI 49 (74) T ss_pred HHCCCCCCEEEEEECCCCE T ss_conf 8489986609999468959 No 16 >cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. Probab=28.28 E-value=39 Score=17.72 Aligned_cols=17 Identities=24% Similarity=0.556 Sum_probs=13.3 Q ss_pred CCEEEEEECCCCEEEEE Q ss_conf 82899991799899998 Q gi|254780555|r 12 NPIRIVVDEDGNYWFMV 28 (41) Q Consensus 12 npirivvdedgnywfmv 28 (41) +--|+-++.+||.||-- T Consensus 48 ~d~Rvt~~~~GnLyFsn 64 (95) T cd05845 48 QDERVSMGQNGNLYFAN 64 (95) T ss_pred CCCEEEECCCCCEEEEE T ss_conf 56507877899889886 No 17 >COG1598 Predicted nuclease of the RNAse H fold, HicB family [General function prediction only] Probab=27.06 E-value=63 Score=16.61 Aligned_cols=24 Identities=42% Similarity=0.520 Sum_probs=19.4 Q ss_pred CCEEEEEECCCCEEEEEEECCCCC Q ss_conf 828999917998999982124760 Q gi|254780555|r 12 NPIRIVVDEDGNYWFMVKDVAGGL 35 (41) Q Consensus 12 npirivvdedgnywfmvkdvaggl 35 (41) -++.|-.|+||.||-.+-|..|-. T Consensus 4 y~~~i~~~~dg~y~~~~Pdlpgc~ 27 (73) T COG1598 4 YPALIEKDEDGGYVASVPDLPGCH 27 (73) T ss_pred EEEEEEECCCCCEEEEECCCCCHH T ss_conf 458999968886699838978733 No 18 >pfam09837 DUF2064 Uncharacterized protein conserved in bacteria (DUF2064). This domain, found in various prokaryotic proteins, has no known function. Probab=26.93 E-value=60 Score=16.75 Aligned_cols=21 Identities=29% Similarity=0.504 Sum_probs=17.4 Q ss_pred CCCCCCEEEEEECCCCEEEEE Q ss_conf 025682899991799899998 Q gi|254780555|r 8 NLEHNPIRIVVDEDGNYWFMV 28 (41) Q Consensus 8 nlehnpirivvdedgnywfmv 28 (41) .|+++.+-|.-.+||.||.+- T Consensus 85 ~L~~~d~VlgPa~DGGy~LiG 105 (121) T pfam09837 85 ALERHDAVLGPAEDGGYYLLG 105 (121) T ss_pred HHHCCCEEEEECCCCCEEEEE T ss_conf 862199799974889999997 No 19 >cd01615 CIDE_N CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of ICAD/DFF45, and the CAD/DFF40 and CIDE nucleases during apoptosis. The CIDE-N domain is also found in the FSP27/CIDE-C protein. Probab=26.75 E-value=42 Score=17.53 Aligned_cols=19 Identities=32% Similarity=0.686 Sum_probs=15.1 Q ss_pred CCCCCCCCEEEEEECCCCE Q ss_conf 1002568289999179989 Q gi|254780555|r 6 PFNLEHNPIRIVVDEDGNY 24 (41) Q Consensus 6 pfnlehnpirivvdedgny 24 (41) -|++...++++|.+|||.- T Consensus 33 ~l~l~~~~~~lvLeeDGT~ 51 (78) T cd01615 33 KLKLPSAPVTLVLEEDGTE 51 (78) T ss_pred HHCCCCCCEEEEEECCCCE T ss_conf 8289987708999368959 No 20 >KOG0210 consensus Probab=26.41 E-value=71 Score=16.34 Aligned_cols=27 Identities=26% Similarity=0.535 Sum_probs=22.7 Q ss_pred CCCCCCCCCCEEEEEECC--CCEEEEEEE Q ss_conf 001002568289999179--989999821 Q gi|254780555|r 4 MIPFNLEHNPIRIVVDED--GNYWFMVKD 30 (41) Q Consensus 4 mipfnlehnpirivvded--gnywfmvkd 30 (41) ..||+-|..-..|.|.+. |.+||+.|. T Consensus 544 vFPFtsEtKRMGIIVr~e~~~evtfylKG 572 (1051) T KOG0210 544 VFPFTSETKRMGIIVRDETTEEVTFYLKG 572 (1051) T ss_pred EECCCCCCCEEEEEEECCCCCEEEEEEEC T ss_conf 82356666234699951787638999826 No 21 >pfam07936 BDS_I_II Antihypertensive protein BDS-I/II. This family features the antihypertensive and antiviral proteins BDS-I and BDS-II expressed by Anemonia sulcata. BDS-I is organized into a triple-stranded antiparallel beta-sheet, with an additional small antiparallel beta-sheet at the N-terminus. Both peptides are known to specifically block the Kv3.4 potassium channel, and thus bring about a decrease in blood pressure. Moreover, they inhibit the cytopathic effects of mouse hepatitis virus strain MHV-A59 on mouse liver cells, by an unknown mechanism. Probab=26.15 E-value=39 Score=17.75 Aligned_cols=20 Identities=30% Similarity=0.695 Sum_probs=17.2 Q ss_pred CCCCEEEEEEECCCCCEEEE Q ss_conf 79989999821247602212 Q gi|254780555|r 20 EDGNYWFMVKDVAGGLDFTS 39 (41) Q Consensus 20 edgnywfmvkdvaggldfts 39 (41) .-|.|||.-+.-.||-.+|+ T Consensus 11 ~~g~~w~~~~tcp~~~gyt~ 30 (43) T pfam07936 11 DIGDLWFGRGTCPGGRGYTG 30 (43) T ss_pred CCCCEEEEECCCCCCCCCCC T ss_conf 72566788433688854246 No 22 >pfam03622 IBV_3B IBV 3B protein. Product of ORF 3B from Avian infectious bronchitis virus (IBV). Currently, the function of this protein remains unknown. Probab=26.15 E-value=38 Score=17.77 Aligned_cols=34 Identities=35% Similarity=0.802 Sum_probs=22.6 Q ss_pred CCCCCCCC----------CCEEEEEECCCCEEEEE--EECCCCCEE Q ss_conf 00100256----------82899991799899998--212476022 Q gi|254780555|r 4 MIPFNLEH----------NPIRIVVDEDGNYWFMV--KDVAGGLDF 37 (41) Q Consensus 4 mipfnleh----------npirivvdedgnywfmv--kdvaggldf 37 (41) -|.|||.| .|.....-..||||-.- .|..|.-.| T Consensus 17 qiSF~LQhISsvl~te~FDPFE~cyYrgG~~wEieSad~~sGdde~ 62 (64) T pfam03622 17 QISFNLQHISSVLNTEVFDPFEVCYYRGGSYWEIESADDFSGDDEF 62 (64) T ss_pred HHHCCHHHHHHHHHCCCCCCEEEEEECCCCEEEEECCCCCCCCCCC T ss_conf 8412099988886212348724899738857887402124787422 No 23 >pfam11760 CbiG_N Cobalamin synthesis G N-terminal. Members of this family are involved in cobalamin synthesis. The Synechocystis sp. PCC 6803 precorrin methylase has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process. Within the cobalamin synthesis pathway CbiG catalyses the both the opening of the lactone ring and the extrusion of the two-carbon fragment of cobalt-precorrin-5A from C-20 and its associated methyl group (deacylation) to give cobalt-precorrin-5B. The N-terminal of the enzyme is conserved in this family, and the C-terminal and the mid-sections are conserved in Probab=25.58 E-value=44 Score=17.46 Aligned_cols=20 Identities=35% Similarity=0.674 Sum_probs=15.8 Q ss_pred CCCCCCEEEEEECCCCEEEE Q ss_conf 02568289999179989999 Q gi|254780555|r 8 NLEHNPIRIVVDEDGNYWFM 27 (41) Q Consensus 8 nlehnpirivvdedgnywfm 27 (41) +-++.|--+|+||+|.|-.- T Consensus 34 ~K~~DPaVvvvDe~g~~vIp 53 (84) T pfam11760 34 DKDTDPAVVVVDEDGRFVIP 53 (84) T ss_pred CCCCCCCEEEECCCCCEEEE T ss_conf 66769999998289999987 No 24 >cd03463 3,4-PCD_alpha Protocatechuate 3,4-dioxygenase (3,4-PCD) , alpha subunit. 3,4-PCD catalyzes the oxidative ring cleavage of 3,4-dihydroxybenzoate to produce beta-carboxy-cis,cis-muconate. 3,4-PCDs are large aggregates of 12 protomers, each composed of an alpha- and beta-subunit and an Fe3+ ion bound in the beta-subunit at the alpha-subunit-beta-subunit interface. 3,4-PCD is a member of the aromatic dioxygenases which are non-heme iron intradiol-cleaving enzymes that break the C1-C2 bond and utilize Fe3+. Probab=25.45 E-value=47 Score=17.30 Aligned_cols=15 Identities=33% Similarity=0.620 Sum_probs=12.8 Q ss_pred EEEEEECCCCEEEEE Q ss_conf 899991799899998 Q gi|254780555|r 14 IRIVVDEDGNYWFMV 28 (41) Q Consensus 14 irivvdedgnywfmv 28 (41) -|...|++|+|+|.. T Consensus 85 Gr~~Td~~G~y~F~T 99 (185) T cd03463 85 GRVATDADGRFSFTT 99 (185) T ss_pred EEEEECCCCCEEEEE T ss_conf 788548998299999 No 25 >cd06539 CIDE_N_A CIDE_N domain of CIDE-A proteins. The CIDE_N (cell death-inducing DFF45-like effector, N-terminal) domain is found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins. These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of the CAD/DFF40, ICAD/DFF45, and CIDE nucleases during apoptosis. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C). Based on sequence similarity with DFF40 and DFF45, the CIDE proteins were initially characterized as mitochondrial activators of apoptosis. However, strong metabolic phenotypes of mice lacking CIDE-A and CIDE-B indicated that this family may play critical roles in energy balance. Probab=25.11 E-value=44 Score=17.42 Aligned_cols=19 Identities=21% Similarity=0.503 Sum_probs=14.7 Q ss_pred CCCCCCCCEEEEEECCCCE Q ss_conf 1002568289999179989 Q gi|254780555|r 6 PFNLEHNPIRIVVDEDGNY 24 (41) Q Consensus 6 pfnlehnpirivvdedgny 24 (41) -|++...+++||.+|||.- T Consensus 33 ~L~i~~~~~~lvLeeDGT~ 51 (78) T cd06539 33 ALVITSGLVTLVLEEDGTV 51 (78) T ss_pred HHCCCCCCCEEEEECCCCE T ss_conf 8578877738999379979 No 26 >cd06538 CIDE_N_FSP27 CIDE_N domain of FSP27 proteins. The CIDE-N (cell death-inducing DFF45-like effector, N-terminal) domain is found in the FSP27/CIDE-C protein, which has been identified as a n adipocyte lipid droplet protein that negatively regulates lipolysis and promotes triglyceride accumulation. The CIDE protein family includes 3 members: CIDE-A, CIDE-B, and FSP27(CIDE-C). Based on sequence similarity with DFF40 and DFF45, CIDE proteins were initially characterized as mitochondrial activators of apoptosis. The CIDE-N domain of FSP27 is sufficient to increase apoptosis in vitro when overexpressed. Probab=23.26 E-value=48 Score=17.23 Aligned_cols=18 Identities=33% Similarity=0.398 Sum_probs=13.7 Q ss_pred CCCCCCCCEEEEEECCCCE Q ss_conf 1002568289999179989 Q gi|254780555|r 6 PFNLEHNPIRIVVDEDGNY 24 (41) Q Consensus 6 pfnlehnpirivvdedgny 24 (41) -|++ ..|+++|.+|||.- T Consensus 33 ~L~i-~~~~~lVLeeDGT~ 50 (79) T cd06538 33 ALLL-DCISSLVLDEDGTG 50 (79) T ss_pred HHCC-CCCCEEEEECCCCE T ss_conf 8577-89837999268979 No 27 >pfam03396 Pox_RNA_pol_35 Poxvirus DNA-directed RNA polymerase, 35 kD subunit. Probab=21.71 E-value=58 Score=16.82 Aligned_cols=35 Identities=34% Similarity=0.421 Sum_probs=27.7 Q ss_pred CCCCCCCCCCCEEEEEEC--CCCEEEEEEECCCCCEE Q ss_conf 400100256828999917--99899998212476022 Q gi|254780555|r 3 DMIPFNLEHNPIRIVVDE--DGNYWFMVKDVAGGLDF 37 (41) Q Consensus 3 dmipfnlehnpirivvde--dgnywfmvkdvaggldf 37 (41) |.--||-||+-|+++.++ .|.+-|.|-.-.|.|.| T Consensus 157 d~E~FnREy~NvK~i~~~~f~~~~Pf~viAP~G~Ltf 193 (292) T pfam03396 157 DIEVFNREYANIKPILDENFRSIVPFIVIAPLGRLTF 193 (292) T ss_pred CHHHHHHHHCCEEEECCCCCEEECCEEEECCCCCEEE T ss_conf 7988636552642112567316610699825871799 No 28 >COG3485 PcaH Protocatechuate 3,4-dioxygenase beta subunit [Secondary metabolites biosynthesis, transport, and catabolism] Probab=21.28 E-value=61 Score=16.71 Aligned_cols=15 Identities=47% Similarity=0.771 Sum_probs=12.3 Q ss_pred EEEEEECCCCEEEEE Q ss_conf 899991799899998 Q gi|254780555|r 14 IRIVVDEDGNYWFMV 28 (41) Q Consensus 14 irivvdedgnywfmv 28 (41) =|++.||+|.|||-- T Consensus 121 Gr~~Td~~G~y~F~T 135 (226) T COG3485 121 GRTITDEDGEYRFRT 135 (226) T ss_pred EEEEECCCCEEEEEE T ss_conf 788768984399998 No 29 >cd00421 intradiol_dioxygenase Intradiol dioxygenases catalyze the critical ring-cleavage step in the conversion of catecholate derivatives to citric acid cycle intermediates. This family contains catechol 1,2-dioxygenases and protocatechuate 3,4-dioxygenases which are mononuclear non-heme iron enzymes that catalyze the oxygenation of catecholates to aliphatic acids via the cleavage of aromatic rings. The members are intradiol-cleaving enzymes which break the catechol C1-C2 bond and utilize Fe3+, as opposed to the extradiol-cleaving enzymes which break the C2-C3 or C1-C6 bond and utilize Fe2+ and Mn+. Catechol 1,2-dioxygenases are mostly homodimers with one catalytic ferric ion per monomer. Protocatechuate 3,4-dioxygenases form more diverse oligomers. Probab=20.02 E-value=69 Score=16.41 Aligned_cols=15 Identities=40% Similarity=0.649 Sum_probs=11.4 Q ss_pred EEEEEECCCCEEEEE Q ss_conf 899991799899998 Q gi|254780555|r 14 IRIVVDEDGNYWFMV 28 (41) Q Consensus 14 irivvdedgnywfmv 28 (41) =|+..|++|.|+|-- T Consensus 58 G~~~Td~~G~~~F~T 72 (146) T cd00421 58 GRQITDADGRYRFRT 72 (146) T ss_pred EEEEECCCCEEEEEE T ss_conf 899879999599999 Done!