BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] gi|254040232|gb|ACT57028.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 82.3 bits (202), Expect = 2e-14, Method: Composition-based stats. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT Sbjct: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|254039802|gb|ACT56598.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] gi|317120696|gb|ADV02519.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] gi|317120739|gb|ADV02561.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120800|gb|ADV02621.1| putative Bro-N family phage antirepressor [Liberibacter phage SC2] gi|317120840|gb|ADV02661.1| putative Bro-N family phage antirepressor [Liberibacter phage SC1] Length = 262 Score = 45.7 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS + PF E N IR +VD+D N WF+ KDVA L + Sbjct: 1 MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37 >gi|53803190|ref|YP_115046.1| hypothetical protein MCA2642 [Methylococcus capsulatus str. Bath] gi|53756951|gb|AAU91242.1| conserved domain protein [Methylococcus capsulatus str. Bath] Length = 252 Score = 42.3 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 24/36 (66%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +++IPF+ E P+R+V D G WF+ DVA L++ Sbjct: 3 TELIPFDFEGRPVRVVTDAQGEPWFVAADVAQSLEY 38 >gi|315122913|ref|YP_004063402.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496315|gb|ADR52914.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 261 Score = 41.5 bits (96), Expect = 0.036, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS++IPF E N IR VVD+D F+ KD+A L + Sbjct: 1 MSNIIPFEFESNKIRTVVDKDNTILFVAKDIAEALGY 37 >gi|315121946|ref|YP_004062435.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495348|gb|ADR51947.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 262 Score = 41.1 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 18/37 (48%), Positives = 23/37 (62%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS +IPF E N IR VVD+D F+ KD+A L + Sbjct: 1 MSSIIPFEFESNKIRTVVDKDNTILFVAKDIAEALGY 37 >gi|255020306|ref|ZP_05292374.1| prophage antirepressor [Acidithiobacillus caldus ATCC 51756] gi|254970226|gb|EET27720.1| prophage antirepressor [Acidithiobacillus caldus ATCC 51756] Length = 257 Score = 40.3 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 15/40 (37%), Positives = 24/40 (60%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +++IPF+ E P+R+V D G WF+ DV L+ + T Sbjct: 3 TELIPFDFEGRPVRVVTDAQGEPWFVAADVCAVLELPNTT 42 >gi|9107730|gb|AAF85322.1|AE004059_12 phage-related protein [Xylella fastidiosa 9a5c] Length = 530 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 161 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 199 >gi|77747608|ref|NP_299802.2| hypothetical protein XF2524 [Xylella fastidiosa 9a5c] Length = 504 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 >gi|15837286|ref|NP_297974.1| hypothetical protein XF0684 [Xylella fastidiosa 9a5c] gi|9105566|gb|AAF83494.1|AE003912_6 phage-related protein [Xylella fastidiosa 9a5c] Length = 503 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 >gi|28199601|ref|NP_779915.1| hypothetical protein PD1726 [Xylella fastidiosa Temecula1] gi|77747679|ref|NP_779339.2| hypothetical protein PD1133 [Xylella fastidiosa Temecula1] gi|28057716|gb|AAO29564.1| phage-related protein [Xylella fastidiosa Temecula1] Length = 503 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 135 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 173 >gi|182681747|ref|YP_001829907.1| prophage antirepressor [Xylella fastidiosa M23] gi|182682342|ref|YP_001830502.1| prophage antirepressor [Xylella fastidiosa M23] gi|28057123|gb|AAO28988.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631857|gb|ACB92633.1| prophage antirepressor [Xylella fastidiosa M23] gi|182632452|gb|ACB93228.1| prophage antirepressor [Xylella fastidiosa M23] gi|307578623|gb|ADN62592.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] gi|307580176|gb|ADN64145.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 535 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L +T+ Sbjct: 167 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYTN 205 >gi|71276718|ref|ZP_00652986.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71276734|ref|ZP_00653001.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900867|ref|ZP_00682983.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71902520|ref|ZP_00684445.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162461|gb|EAO12196.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71162476|gb|EAO12210.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71727755|gb|EAO30023.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71729338|gb|EAO31453.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 370 Score = 40.0 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E +R VVD+ G WF+ KDVA L +T+ Sbjct: 1 MNAITPFHFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 39 >gi|273810427|ref|YP_003344898.1| Bro-N family protein [Xylella phage Xfas53] gi|257097802|gb|ACV41108.1| Bro-N family protein [Xylella phage Xfas53] Length = 431 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E +R VVD+ G WF+ KDVA L +T+ Sbjct: 180 MNAITPFQFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 218 >gi|71898928|ref|ZP_00681095.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71731340|gb|EAO33404.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 387 Score = 39.6 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E +R VVD+ G WF+ KDVA L +T+ Sbjct: 137 MNAITPFQFESQAVRTVVDDHGEVWFVGKDVADVLGYTN 175 >gi|169633393|ref|YP_001707129.1| hypothetical protein ABSDF1750 [Acinetobacter baumannii SDF] gi|169152185|emb|CAP01089.1| hypothetical protein; putative Prophage antirepressor [Acinetobacter baumannii] Length = 260 Score = 39.6 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS+M FN N IR +V +DG WF+ DVA L + Sbjct: 1 MSEMSVFNFNQNEIRTIVKDDGEIWFIAADVATVLGY 37 >gi|169634092|ref|YP_001707828.1| hypothetical protein ABSDF2615 [Acinetobacter baumannii SDF] gi|169152884|emb|CAP01922.1| conserved hypothetical protein; putative Prophage antirepressor [Acinetobacter baumannii] Length = 94 Score = 39.6 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 22/37 (59%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS+M FN N IR +V +DG WF+ DVA L + Sbjct: 1 MSEMSVFNFNQNEIRTIVKDDGEIWFVAADVATVLGY 37 >gi|315122933|ref|YP_004063422.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313496335|gb|ADR52934.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 264 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 ++IPF E N IR VVDED F+ KD+A L + Sbjct: 5 NIIPFEFESNRIRTVVDEDNTILFVAKDIAEALGY 39 >gi|315121965|ref|YP_004062454.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495367|gb|ADR51966.1| prophage antirepressor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 263 Score = 39.2 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 22/35 (62%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 ++IPF E N IR VVDED F+ KD+A L + Sbjct: 5 NIIPFEFESNRIRTVVDEDNTILFVAKDIAEALGY 39 >gi|184157378|ref|YP_001845717.1| prophage antirepressor [Acinetobacter baumannii ACICU] gi|183208972|gb|ACC56370.1| Prophage antirepressor [Acinetobacter baumannii ACICU] Length = 250 Score = 38.8 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 16/38 (42%), Positives = 24/38 (63%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ FN N IR V+ +DG WF+ DVA L+++ Sbjct: 1 MSNISVFNFNQNEIRTVLKDDGEIWFVASDVATVLEYS 38 >gi|283852564|ref|ZP_06369831.1| prophage antirepressor [Desulfovibrio sp. FW1012B] gi|283572012|gb|EFC20005.1| prophage antirepressor [Desulfovibrio sp. FW1012B] Length = 323 Score = 38.4 bits (88), Expect = 0.31, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 24/37 (64%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 S+ +PF E + IR V++ DGN WF+ +DV ++ + Sbjct: 13 SNPVPFAFESHEIRTVINGDGNPWFVARDVCAAMNIS 49 >gi|15838264|ref|NP_298952.1| hypothetical protein XF1663 [Xylella fastidiosa 9a5c] gi|9106723|gb|AAF84472.1|AE003992_8 phage-related protein [Xylella fastidiosa 9a5c] Length = 381 Score = 38.0 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E +R VVD+ G WF+ KDVA L + + Sbjct: 12 MNAITPFHFESQAVRTVVDDHGEVWFVGKDVADVLGYAN 50 >gi|71901490|ref|ZP_00683577.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71728746|gb|EAO30890.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 412 Score = 38.0 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF E + +R VVD+ G WF+ KDVA L + + Sbjct: 161 MNAITPFQFESHAVRTVVDDHGEVWFVGKDVADVLGYAN 199 >gi|330810751|ref|YP_004355213.1| phage regulatory protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327378859|gb|AEA70209.1| Putative phage regulatory protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 283 Score = 38.0 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 24/36 (66%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 + +IPF+ + IR++ DE G+ WF+ +DVA L + Sbjct: 28 NSVIPFDFDGGAIRVITDELGDPWFVARDVADALGY 63 >gi|144898901|emb|CAM75765.1| BRO, N-terminal [Magnetospirillum gryphiswaldense MSR-1] Length = 300 Score = 37.6 bits (86), Expect = 0.58, Method: Composition-based stats. Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 M++++PF E + IR VVD DG WF+ KDVA L + + T Sbjct: 1 MTNIVPFEFEGSAIR-VVDIDGAPWFVGKDVAERLGYANAT 40 >gi|258543092|ref|YP_003188525.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01] gi|256634170|dbj|BAI00146.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01] gi|256637230|dbj|BAI03199.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-03] gi|256640282|dbj|BAI06244.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-07] gi|256643339|dbj|BAI09294.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-22] gi|256646394|dbj|BAI12342.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-26] gi|256649447|dbj|BAI15388.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-32] gi|256652433|dbj|BAI18367.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-01-42C] gi|256655491|dbj|BAI21418.1| prophage antirepressor [Acetobacter pasteurianus IFO 3283-12] Length = 234 Score = 37.6 bits (86), Expect = 0.59, Method: Composition-based stats. Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 MS++IPFN E + +R V+ DG WF++ DV L+ T+ Sbjct: 1 MSNIIPFNFEDHAVR-VITRDGEPWFVLADVCDVLEHTN 38 >gi|108763205|ref|YP_630118.1| putative bacteriophage L54a, antirepressor [Myxococcus xanthus DK 1622] gi|108467085|gb|ABF92270.1| putative bacteriophage L54a, antirepressor [Myxococcus xanthus DK 1622] Length = 270 Score = 37.6 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M+ + F+ E + +R+V D G +WF+ KD+A L++ Sbjct: 1 MNQPVAFDFESHHVRVVTDAHGEHWFVAKDIAESLEY 37 >gi|28198899|ref|NP_779213.1| hypothetical protein PD1001 [Xylella fastidiosa Temecula1] gi|182681602|ref|YP_001829762.1| prophage antirepressor [Xylella fastidiosa M23] gi|28056997|gb|AAO28862.1| phage-related protein [Xylella fastidiosa Temecula1] gi|182631712|gb|ACB92488.1| prophage antirepressor [Xylella fastidiosa M23] gi|307580036|gb|ADN64005.1| prophage antirepressor [Xylella fastidiosa subsp. fastidiosa GB514] Length = 262 Score = 37.6 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 23/39 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ M PF E + +R VVD+ G WF+ DVA L + + Sbjct: 12 MNAMTPFQFESHAVRTVVDDHGEVWFVGTDVATVLGYAN 50 >gi|312962012|ref|ZP_07776509.1| hypothetical protein PFWH6_3932 [Pseudomonas fluorescens WH6] gi|311283822|gb|EFQ62406.1| hypothetical protein PFWH6_3932 [Pseudomonas fluorescens WH6] Length = 283 Score = 36.9 bits (84), Expect = 0.87, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 25/37 (67%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 S +IPF+ + IR++ D+ G+ WF+ +DVA L ++ Sbjct: 28 SAVIPFDFDGAAIRVITDKLGDPWFVARDVADALGYS 64 >gi|71276717|ref|ZP_00652985.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71900866|ref|ZP_00682982.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71162475|gb|EAO12209.1| BRO, N-terminal [Xylella fastidiosa Dixon] gi|71729337|gb|EAO31452.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 264 Score = 36.9 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +IPF+ + +R+V+ DGN WF+ KDV LD+ + + Sbjct: 5 IIPFDFHSHVVRVVM-RDGNPWFVAKDVMDALDYAATS 41 >gi|222112392|ref|YP_002554656.1| prophage antirepressor [Acidovorax ebreus TPSY] gi|221731836|gb|ACM34656.1| prophage antirepressor [Acidovorax ebreus TPSY] Length = 252 Score = 36.9 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 MS +IPF E + +R+ VD+ G WF DV L+ Sbjct: 1 MSAIIPFQFEAHAVRVQVDDQGQPWFNATDVCDALE 36 >gi|71899743|ref|ZP_00681894.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730438|gb|EAO32518.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 203 Score = 36.5 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 4 MIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 +IPF+ + +R+V+ DGN WF+ KDV LD+ + Sbjct: 5 IIPFDFHSHVVRVVM-RDGNPWFVAKDVMDALDYAETS 41 >gi|71899745|ref|ZP_00681896.1| BRO, N-terminal [Xylella fastidiosa Ann-1] gi|71730440|gb|EAO32520.1| BRO, N-terminal [Xylella fastidiosa Ann-1] Length = 251 Score = 36.1 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 M+ + PF+ E + +R VVD+ G WF+ DVA L + + Sbjct: 1 MNAITPFHFESHAVRTVVDDHGEVWFVGTDVATVLGYAN 39 >gi|170720501|ref|YP_001748189.1| prophage antirepressor [Pseudomonas putida W619] gi|169758504|gb|ACA71820.1| prophage antirepressor [Pseudomonas putida W619] Length = 256 Score = 35.7 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 22/36 (61%) Query: 3 DMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 ++IPFN + IR+V D WF+ KD+A L ++ Sbjct: 2 NLIPFNFNGHEIRVVKDHANEPWFVAKDIADDLGYS 37 >gi|292491104|ref|YP_003526543.1| BRO domain protein [Nitrosococcus halophilus Nc4] gi|291579699|gb|ADE14156.1| BRO domain protein [Nitrosococcus halophilus Nc4] Length = 316 Score = 35.3 bits (80), Expect = 2.7, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 M+D+IPFN + + IR+V+ DG WF+ KD+ L+ Sbjct: 1 MNDLIPFNFDGHDIRVVMI-DGEPWFVAKDLCDVLE 35 >gi|160898695|ref|YP_001564277.1| prophage antirepressor [Delftia acidovorans SPH-1] gi|160364279|gb|ABX35892.1| prophage antirepressor [Delftia acidovorans SPH-1] Length = 270 Score = 34.9 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 12/38 (31%), Positives = 25/38 (65%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 MS++ PF + + I ++ ++ G WF+ K+V+G L ++ Sbjct: 1 MSNITPFKFQDHEITVLTNDSGEPWFIAKEVSGVLGYS 38 >gi|310286594|ref|YP_003937852.1| phage anti-repressor protein [Bifidobacterium bifidum S17] gi|309250530|gb|ADO52278.1| putative phage anti-repressor protein [Bifidobacterium bifidum S17] Length = 260 Score = 34.6 bits (78), Expect = 4.6, Method: Composition-based stats. Identities = 13/36 (36%), Positives = 23/36 (63%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 +++ PF+ + N +RI+ D+ G WF+ KDV L + Sbjct: 4 NNLQPFDFKGNQVRILTDKKGEPWFVAKDVCNVLGY 39 >gi|190573874|ref|YP_001971719.1| putative phage-like protein [Stenotrophomonas maltophilia K279a] gi|190011796|emb|CAQ45416.1| putative phage-related protein [Stenotrophomonas maltophilia K279a] Length = 253 Score = 34.6 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 20/36 (55%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLD 36 MS +IPF E + +RI VD G WF DV L+ Sbjct: 1 MSAIIPFQFEAHAVRIQVDGAGLPWFNASDVCNALE 36 >gi|269955332|ref|YP_003325121.1| prophage antirepressor [Xylanimonas cellulosilytica DSM 15894] gi|269304013|gb|ACZ29563.1| prophage antirepressor [Xylanimonas cellulosilytica DSM 15894] Length = 259 Score = 34.2 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 22/39 (56%) Query: 2 SDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSI 40 +D+ F+ +RI+ DE G+ WF+ DVA L +I Sbjct: 3 TDLQQFDFHGAGVRIITDEHGDPWFVAADVAAALSLGNI 41 >gi|307544693|ref|YP_003897172.1| prophage antirepressor [Halomonas elongata DSM 2581] gi|307216717|emb|CBV41987.1| prophage antirepressor [Halomonas elongata DSM 2581] Length = 262 Score = 33.4 bits (75), Expect = 9.5, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 M + PFN + +R++ +DG F+ KDVA L + Sbjct: 1 MQSIQPFNFDSQQVRVIQGDDGEPMFVAKDVAAALGY 37 >gi|294789953|ref|ZP_06755172.1| toxin-antitoxin system, toxin component, Bro family [Simonsiella muelleri ATCC 29453] gi|294482110|gb|EFG29818.1| toxin-antitoxin system, toxin component, Bro family [Simonsiella muelleri ATCC 29453] Length = 283 Score = 33.4 bits (75), Expect = 9.6, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 10 EHNPIRIVVDEDGNYWFMVKDVAGGLDFTS 39 E++ IR + DE G +WF+ DV G L + + Sbjct: 23 ENHSIRTIADEKGEFWFLANDVCGVLGYVN 52 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.324 0.143 0.449 Lambda K H 0.267 0.0464 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 549,210,661 Number of Sequences: 14124377 Number of extensions: 16084020 Number of successful extensions: 37152 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 37087 Number of HSP's gapped (non-prelim): 68 length of query: 41 length of database: 4,842,793,630 effective HSP length: 15 effective length of query: 26 effective length of database: 4,630,927,975 effective search space: 120404127350 effective search space used: 120404127350 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 76 (33.7 bits)