RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) >gnl|CDD|33416 COG3617, COG3617, Prophage antirepressor [Transcription]. Length = 176 Score = 36.1 bits (83), Expect = 0.002 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFT 38 M+ + PF E + +R+V+D DG WF+ DVA L +T Sbjct: 6 MTMLQPFTFEDHAVRVVLD-DGEPWFVAADVARALGYT 42 >gnl|CDD|145567 pfam02498, Bro-N, BRO family, N-terminal domain. This family includes the N-terminus of baculovirus BRO and ALI motif proteins. The function of BRO proteins is unknown. It has been suggested that BRO-A and BRO-C are DNA binding proteins that influence host DNA replication and/or transcription. This Pfam domain does not include the characteristic invariant alanine, leucine, isoleucine motif of the ALI proteins. Length = 91 Score = 29.5 bits (67), Expect = 0.19 Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Query: 13 PIRIVVDEDGNYWFMVKDVAGGLDFT 38 +R V +G WF+ KDVA L + Sbjct: 1 EVR-TVVINGEPWFVAKDVAKALGYK 25 >gnl|CDD|39805 KOG4605, KOG4605, KOG4605, Uncharacterized conserved protein containing CDGSH-type Zn-finger [Function unknown]. Length = 129 Score = 27.0 bits (59), Expect = 1.2 Identities = 5/20 (25%), Positives = 9/20 (45%) Query: 6 PFNLEHNPIRIVVDEDGNYW 25 + P+R V++ G W Sbjct: 79 QGRTKLRPVRFKVEKTGMVW 98 >gnl|CDD|38741 KOG3533, KOG3533, KOG3533, Inositol 1,4,5-trisphosphate receptor [Signal transduction mechanisms]. Length = 2706 Score = 25.0 bits (54), Expect = 5.3 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Query: 5 IPFNLEHNPIRIVVDEDGN--YWFMVK 29 +P LE N +R+ +D GN WF ++ Sbjct: 143 LPALLEKNAMRVYLDAAGNEGSWFYIE 169 >gnl|CDD|119367 cd01615, CIDE_N, CIDE_N domain, found at the N-terminus of the CIDE (cell death-inducing DFF45-like effector) proteins, as well as CAD nuclease (caspase-activated DNase/DNA fragmentation factor, DFF40) and its inhibitor, ICAD(DFF45). These proteins are associated with the chromatin condensation and DNA fragmentation events of apoptosis; the CIDE_N domain is thought to regulate the activity of ICAD/DFF45, and the CAD/DFF40 and CIDE nucleases during apoptosis. The CIDE-N domain is also found in the FSP27/CIDE-C protein.. Length = 78 Score = 24.0 bits (53), Expect = 8.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Query: 7 FNLEHNPIRIVVDEDG 22 L P+ +V++EDG Sbjct: 34 LKLPSAPVTLVLEEDG 49 >gnl|CDD|29648 cd00563, Dtyr_deacylase, D-Tyrosyl-tRNAtyr deacylases; a class of tRNA-dependent hydrolases which are capable of hydrolyzing the ester bond of D-Tyrosyl-tRNA reducing the level of cellular D-Tyrosine while recycling the peptidyl-tRNA; found in bacteria and in eukaryotes but not in archea; beta barrel-like fold structure; forms homodimers in which two surface cavities serve as the active site for tRNA binding. Length = 145 Score = 24.0 bits (52), Expect = 9.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Query: 14 IRIVVDEDGNYWFMVKDVAGGL 35 +RI DE+G VKDV G + Sbjct: 52 LRIFEDEEGKMNLSVKDVNGEI 73 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.143 0.449 Gapped Lambda K H 0.267 0.0773 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 547,277 Number of extensions: 16690 Number of successful extensions: 89 Number of sequences better than 10.0: 1 Number of HSP's gapped: 88 Number of HSP's successfully gapped: 8 Length of query: 41 Length of database: 6,263,737 Length adjustment: 15 Effective length of query: 26 Effective length of database: 5,939,602 Effective search space: 154429652 Effective search space used: 154429652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (23.3 bits)