RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) >gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional. Length = 464 Score = 26.9 bits (60), Expect = 1.3 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 5 IPFNLEHNPIRIVVDEDGN 23 + F+L NP+ I+ DE+G Sbjct: 333 VIFDLLTNPVEILGDENGW 351 >gnl|CDD|183739 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional. Length = 752 Score = 26.6 bits (59), Expect = 1.6 Identities = 9/18 (50%), Positives = 10/18 (55%) Query: 5 IPFNLEHNPIRIVVDEDG 22 I F HNPI + DE G Sbjct: 623 IEFLTLHNPIEYLADEKG 640 >gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed. Length = 800 Score = 24.8 bits (55), Expect = 4.9 Identities = 9/14 (64%), Positives = 11/14 (78%), Gaps = 1/14 (7%) Query: 10 EHN-PIRIVVDEDG 22 E N P RI++DEDG Sbjct: 286 ELNLPTRIIIDEDG 299 >gnl|CDD|183738 PRK12775, PRK12775, putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional. Length = 1006 Score = 24.1 bits (52), Expect = 7.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 5 IPFNLEHNPIRIVVDEDGN 23 I F H+P+ I VD +G+ Sbjct: 624 IDFFFLHSPVEIYVDAEGS 642 >gnl|CDD|152572 pfam12137, RapA_C, RNA polymerase recycling family C-terminal. This domain is found in bacteria. This domain is about 360 amino acids in length. This domain is found associated with pfam00271, pfam00176. The function of this domain is not known, but structurally it forms an alpha-beta fold in nature with a central beta-sheet flanked by helices and loops, the beta-sheet being mainly antiparallel and flanked by four alpha helices, among which the two longer helices exhibit a coiled-coil arrangement. Length = 362 Score = 24.0 bits (53), Expect = 9.1 Identities = 6/11 (54%), Positives = 11/11 (100%) Query: 13 PIRIVVDEDGN 23 PIR+++D++GN Sbjct: 236 PIRLLLDKNGN 246 >gnl|CDD|179821 PRK04319, PRK04319, acetyl-CoA synthetase; Provisional. Length = 570 Score = 24.1 bits (53), Expect = 9.4 Identities = 9/15 (60%), Positives = 10/15 (66%), Gaps = 2/15 (13%) Query: 19 DEDGNYWFM--VKDV 31 DEDG +WF V DV Sbjct: 443 DEDGYFWFQGRVDDV 457 >gnl|CDD|149902 pfam08980, DUF1883, Domain of unknown function (DUF1883). This domain is found in a set of hypothetical bacterial proteins. Length = 95 Score = 23.9 bits (52), Expect = 9.4 Identities = 9/23 (39%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Query: 12 NPIRIVVDEDGNYWFMVKDVAGG 34 +P RI V G+ W++V D+ G Sbjct: 54 SPARIAVPSSGH-WYVVVDLEGH 75 >gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional. Length = 441 Score = 23.8 bits (51), Expect = 9.9 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 6/31 (19%) Query: 16 IVVDED-----GNYWFMVKDVAGGLDFTSIT 41 IVVD+ N W M DV GGL FT I+ Sbjct: 274 IVVDKYLHTTADNIWAM-GDVTGGLQFTYIS 303 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.143 0.449 Gapped Lambda K H 0.267 0.0614 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 703,812 Number of extensions: 24952 Number of successful extensions: 107 Number of sequences better than 10.0: 1 Number of HSP's gapped: 107 Number of HSP's successfully gapped: 14 Length of query: 41 Length of database: 5,994,473 Length adjustment: 15 Effective length of query: 26 Effective length of database: 5,670,353 Effective search space: 147429178 Effective search space used: 147429178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.3 bits)