BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] (41 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780555|ref|YP_003064968.1| hypothetical protein CLIBASIA_02210 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 87.0 bits (214), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT Sbjct: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDFTSIT 41 >gi|254780125|ref|YP_003064538.1| prophage antirepressor [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Score = 46.6 bits (109), Expect = 8e-08, Method: Composition-based stats. Identities = 19/37 (51%), Positives = 24/37 (64%) Query: 1 MSDMIPFNLEHNPIRIVVDEDGNYWFMVKDVAGGLDF 37 MS + PF E N IR +VD+D N WF+ KDVA L + Sbjct: 1 MSTITPFEFESNKIRTIVDKDQNIWFVAKDVATALGY 37 >gi|254780348|ref|YP_003064761.1| 5-amino-6-(5-phosphoribosylamino)uracil reductase/diaminohydroxyphosphoribosylaminopyrimidine [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Score = 21.6 bits (44), Expect = 2.8, Method: Composition-based stats. Identities = 6/10 (60%), Positives = 10/10 (100%) Query: 10 EHNPIRIVVD 19 EH+P+RI++D Sbjct: 216 EHSPMRIILD 225 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.143 0.449 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,000 Number of Sequences: 1233 Number of extensions: 717 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 41 length of database: 328,796 effective HSP length: 15 effective length of query: 26 effective length of database: 310,301 effective search space: 8067826 effective search space used: 8067826 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.0 bits) S2: 31 (16.5 bits)