>cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily. This class of enzymes is unique from other members of the superfamily in two aspects. First, it contains a modified Nudix signature sequence. The slight changes to the conserved sequence motif, GX5EX7REUXEEXGU, where U = I, L or V), are believed to contribute to the removal of all magnesium binding sites but one, retaining only the metal site that coordinates the pyrophosphate of the substrate. Secondly, it is not a pyrophosphatase that substitutes at a phosphorus; instead, it hydrolyzes nucleotide sugars such as GDP-mannose to GDP and mannose, cleaving the phosphoglycosyl bond by substituting at a carbon position. GDP-mannose provides mannosyl components for cell wall synthesis and is required for the synthesis of other glycosyl donors (such as GDP-fucose and colitose) for the cell wall. The importance of GDP-sugar hydrolase activities is thus close

Probab=99.91 E-value=2.5e-24 Score=162.04 Aligned_cols=120 Identities=12% Similarity=0.164 Sum_probs=84.1 Q ss_pred CEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCC Q ss_conf 60699998489839999926887766687220121150788888899999999983755222220136612411632220 Q gi|254780557|r 4 RGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAHCI 83 (160) Q Consensus 4 ~~V~vvi~n~~~~iLl~kR~~~~~~~~~g~W~~PgG~ve~gEt~~~Aa~REl~EEtGi~~~~~~~~~~~~~~~~~~~~~~ 83 (160) T Consensus 13 v~V~~vI~n~~g~iLL~kR~~~---p~~g~W~~PGG~i~~gEt~~~a~~Re~~eE~Gl~i~~~~~~~~Gv~eh~y~d~~~ 89 (144) T cd03430 13 VSIDLIVENEDGQYLLGKRTNR---PAQGYWFVPGGRIRKNETLTEAFERIAKDELGLEFLISDAELLGVFEHFYDDNFF 89 (144) T ss_pred EEEEEEEECCCCCEEEEECCCC---CCCCEEECCCCCCCCCCCHHHHHHHHHHHHHCCCEEECCCEEEEEEEEECCCCCC T ss_conf 7999999979996999981699---8899498983447799799999999999974971640344897758998267777 Q ss_pred CCCCCCCCCCEEEEEEECCCCCCEECCCCCCCCCCCCCEEEECCHHHHHHC Q ss_conf 000112344337999980475430105788888886003760378997630 Q gi|254780557|r 84 QENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDTPNI 134 (160) Q Consensus 84 ~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~E~~~~~Wv~~~el~~~ 134 (160) T Consensus 90 ~~~~~~H~V~l~y~~~~~~~--------e~~~~ddeh~e~~Wf~~del~~~ 132 (144) T cd03430 90 GDDFSTHYVVLGYVLKLSSN--------ELLLPDEQHSEYQWLTSDELLAD 132 (144) T ss_pred CCCCCEEEEEEEEEEEECCC--------CCCCCHHHCCEEEEECHHHHHCC T ss_conf 89853099999999995589--------75599457006699679995217

HHsearch alignment for GI: 254780557 and conserved domain: cd03430