>gnl|CDD|72892 cd03672, Dcp2p, mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex. Decapping is a key step in both general and nonsense-mediated 5'->3' mRNA-decay pathways. Dcp2p contains an all-alpha helical N-terminal domain and a C-terminal domain which has the Nudix fold. While decapping is not dependent on the N-terminus of Dcp2p, it does affect its efficiency. Dcp1p binds the N-terminal domain of Dcp2p stimulating the decapping activity of Dcp2p. Decapping permits the degradation of the transcript and is a site of numerous control inputs. It is responsible for nonsense-mediated decay as well as AU-rich element (ARE)-mediated decay. In addition, it may also play a role in the levels of mRNA. Enzymes belonging to the Nudix superfamily require a divalent cation, such as Mg2+ or Mn2+, for their activity and are recognized by a highly conserved 23-residue nudix motif (GX5EX7REUXEEXGU, where U = I, L or V).. Length = 145

 Score = 41.7 bits (98), Expect = 1e-04
 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQ 75
          W  P+G IN  ED  D A RE+YEETG   IS     D YI+
Sbjct: 27 WSFPKGKINKDEDDHDCAIREVYEETGF-DISKYIDKDDYIE 67