RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] (160 letters) >gnl|CDD|179094 PRK00714, PRK00714, RNA pyrophosphohydrolase; Reviewed. Length = 156 Score = 185 bits (472), Expect = 5e-48 Identities = 66/158 (41%), Positives = 92/158 (58%), Gaps = 12/158 (7%) Query: 2 YRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI 61 YR VGI++LN+ V+ GRR WQ PQGGI+P E P A YRELYEE G+ Sbjct: 7 YRPNVGIILLNRQGQVFWGRR-----IGQGHSWQFPQGGIDPGETPEQAMYRELYEEVGL 61 Query: 62 KS--ISLLGQGDSYIQYDFPAHCI--QENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYE 117 + + +L + +++YD P + + Y GQ QKWF R G SEI ++ T++ Sbjct: 62 RPEDVEILAETRDWLRYDLPKRLVRRSKGVYRGQKQKWFLLRLTGDDSEINLNTTSHP-- 119 Query: 118 SEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIK 155 EFDAW WVS W + VV FK++ YR+V+ +FA L+ Sbjct: 120 -EFDAWRWVSYWYPLDQVVPFKRDVYRRVLKEFARLLM 156 >gnl|CDD|180046 PRK05379, PRK05379, bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional. Length = 340 Score = 40.4 bits (95), Expect = 2e-04 Identities = 16/30 (53%), Positives = 19/30 (63%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETGIK 62 LW +P G + E LDA REL EETG+K Sbjct: 229 LWALPGGFLEQDETLLDACLRELREETGLK 258 >gnl|CDD|182721 PRK10776, PRK10776, nucleoside triphosphate pyrophosphohydrolase; Provisional. Length = 129 Score = 39.2 bits (92), Expect = 4e-04 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 13/78 (16%) Query: 6 VGILILNQDDLVWVGRRC--FHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI-- 61 VGI I N ++ +++ RR H K W+ P G I E P A REL EE GI Sbjct: 8 VGI-IRNPNNEIFITRRAADAHMAGK----WEFPGGKIEAGETPEQALIRELQEEVGITV 62 Query: 62 KSISLLGQGDSYIQYDFP 79 + +L + ++Y+FP Sbjct: 63 QHATLFEK----LEYEFP 76 >gnl|CDD|181607 PRK08999, PRK08999, hypothetical protein; Provisional. Length = 312 Score = 39.1 bits (92), Expect = 6e-04 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Query: 9 LILNQDDLVWVGRRCFHDNNKHLS-LWQMPQGGINPQEDPLDAAYRELYEETGI 61 +I + D + + RR KH LW+ P G + P E A REL EE GI Sbjct: 11 VIRDADGRILLARRPEG---KHQGGLWEFPGGKVEPGETVEQALARELQEELGI 61 >gnl|CDD|131752 TIGR02705, nudix_YtkD, nucleoside triphosphatase YtkD. The functional assignment to the proteins of this family is contentious. Reference challenges the findings of reference, both in interpretation and in enzyme assay results. This protein belongs to the nudix family and shares some sequence identity with E. coli MutT but appears not to be functionally interchangeable with it. Length = 156 Score = 38.9 bits (91), Expect = 6e-04 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Query: 37 PQGGINPQEDPLDAAYRELYEETG--IKSISLLGQ 69 P G + P E +AA RE+ EETG +K + +GQ Sbjct: 50 PGGKVEPGETSKEAAIREVMEETGAIVKELHYIGQ 84 >gnl|CDD|181858 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional. Length = 148 Score = 37.6 bits (88), Expect = 0.002 Identities = 13/28 (46%), Positives = 15/28 (53%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETGI 61 WQ G + E P A RE+ EETGI Sbjct: 33 WQSVTGSLEEGETPAQTAIREVKEETGI 60 >gnl|CDD|183303 PRK11762, nudE, adenosine nucleotide hydrolase NudE; Provisional. Length = 185 Score = 36.3 bits (85), Expect = 0.004 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 8/38 (21%) Query: 37 PQGGINPQEDPLDAAYRELYEETG--------IKSISL 66 P+G I+P E PL+AA REL EE G +K +SL Sbjct: 79 PKGLIDPGETPLEAANRELKEEVGFGARQLTFLKELSL 116 >gnl|CDD|177959 PLN02325, PLN02325, nudix hydrolase. Length = 144 Score = 32.1 bits (73), Expect = 0.061 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query: 3 RRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIK 62 R V + +L + V +GRR + S + +P G + E + A RE+ EETG++ Sbjct: 9 RVAVVVFLLK-GNSVLLGRRRSSIGD---STFALPGGHLEFGESFEECAAREVKEETGLE 64 >gnl|CDD|185291 PRK15393, PRK15393, NUDIX hydrolase YfcD; Provisional. Length = 180 Score = 30.5 bits (69), Expect = 0.22 Identities = 11/29 (37%), Positives = 14/29 (48%) Query: 45 EDPLDAAYRELYEETGIKSISLLGQGDSY 73 E L++A RE EE GI + G Y Sbjct: 79 EQLLESARREAEEELGIAGVPFAEHGQFY 107 >gnl|CDD|129674 TIGR00586, mutt, mutator mutT protein. All proteins in this family for which functions are known are involved in repairing oxidative damage to dGTP (they are 8-oxo-dGTPases). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 128 Score = 30.2 bits (68), Expect = 0.26 Identities = 21/79 (26%), Positives = 30/79 (37%), Gaps = 6/79 (7%) Query: 6 VGILILNQDDLVWVGRRCF-HDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGIKSI 64 +I N++ + + RR H K L + P G E P A REL EE GI Sbjct: 7 AVGIIRNENGEIIITRRADGHMFAK---LLEFPGGKEEGGETPEQAVVRELEEEIGI--P 61 Query: 65 SLLGQGDSYIQYDFPAHCI 83 + + +P H Sbjct: 62 QHFSEFEKLEYEFYPRHIT 80 >gnl|CDD|182536 PRK10546, PRK10546, pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional. Length = 135 Score = 29.3 bits (66), Expect = 0.41 Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETGI 61 LW+ G + P E A REL EE GI Sbjct: 31 LWEFAGGKVEPGESQPQALIRELREELGI 59 >gnl|CDD|185369 PRK15472, PRK15472, nucleoside triphosphatase NudI; Provisional. Length = 141 Score = 28.9 bits (65), Expect = 0.56 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 34 WQMPQGGINPQEDPLDAAYRELYEETG 60 W + GG+ P E +A RE+ EE G Sbjct: 33 WALSGGGVEPGERIEEALRREIREELG 59 >gnl|CDD|182753 PRK10814, PRK10814, outer membrane-specific lipoprotein transporter subunit LolC; Provisional. Length = 399 Score = 27.4 bits (61), Expect = 1.6 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Query: 37 PQGGINPQEDPLDAAYRELYEETGIKSISLLGQGDSYIQ 75 G +NPQ+ P A + G+ I+ L GD +Q Sbjct: 71 EHGSLNPQQLPASALKLD-----GVNRIAPLTTGDVVLQ 104 >gnl|CDD|177797 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional. Length = 891 Score = 27.6 bits (61), Expect = 1.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 73 YIQYDFPAHCIQENGYVG 90 Y+QY FP C+ E G +G Sbjct: 502 YLQYSFPPSCVGEVGRIG 519 >gnl|CDD|182682 PRK10729, nudF, ADP-ribose pyrophosphatase NudF; Provisional. Length = 202 Score = 26.2 bits (58), Expect = 3.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Query: 33 LWQMPQGGINPQEDPLDAAYRELYEETGIK 62 L +M G I E D A RE EE G+ Sbjct: 83 LLEMVAGMIEEGESVEDVARREAIEEAGLI 112 >gnl|CDD|184631 PRK14335, PRK14335, (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional. Length = 455 Score = 26.0 bits (57), Expect = 4.4 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Query: 47 PLDAAYREL--YEETGIKSISLLGQG-DSY 73 LDA +E+ E G++ I+LLGQ +SY Sbjct: 182 DLDAILQEIDVLSEKGVREITLLGQNVNSY 211 >gnl|CDD|180368 PRK06048, PRK06048, acetolactate synthase 3 catalytic subunit; Reviewed. Length = 561 Score = 25.5 bits (56), Expect = 6.2 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 6/82 (7%) Query: 74 IQYDFPAH-CIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEFDAWTWVSLWDT- 131 +Q D P I NGY+G +++W + S C+ + + + +A+ + L Sbjct: 455 VQNDIPVIVAILNNGYLGMVRQWQELFYDKRYSHTCI-KGSVDFVKLAEAYGALGLRVEK 513 Query: 132 PNIVVDFKKEAY---RQVVADF 150 P+ V +EA R VV DF Sbjct: 514 PSEVRPAIEEAVASDRPVVIDF 535 >gnl|CDD|152663 pfam12228, DUF3604, Protein of unknown function (DUF3604). This family of proteins is found in bacteria. Proteins in this family are typically between 621 and 693 amino acids in length. Length = 592 Score = 25.3 bits (56), Expect = 6.8 Identities = 8/51 (15%), Positives = 10/51 (19%), Gaps = 3/51 (5%) Query: 76 YDFPAHCIQENGYVGQMQKWFAFR---FQGLTSEICVDRTAYGYESEFDAW 123 + NG G E D G + AW Sbjct: 86 TGQEWAELLRNGPEDAGTAAALLISAAAAGFLPEALRDPLDGGLDIARSAW 136 >gnl|CDD|129413 TIGR00313, cobQ, cobyric acid synthase CobQ. Length = 475 Score = 25.1 bits (55), Expect = 7.5 Identities = 15/50 (30%), Positives = 20/50 (40%), Gaps = 7/50 (14%) Query: 44 QEDPLDAAYRELYEETGIKSISLLGQGDSYIQYDFPAH---CIQENGYVG 90 D L + +L E TGI + +L Y + FP IQE G Sbjct: 198 NVDVLKSGIEKLEELTGIPVLGVL----PYDENLFPEEDSLVIQERRSRG 243 >gnl|CDD|179387 PRK02228, PRK02228, V-type ATP synthase subunit F; Provisional. Length = 100 Score = 25.3 bits (56), Expect = 7.6 Identities = 7/14 (50%), Positives = 10/14 (71%) Query: 3 RRGVGILILNQDDL 16 VGIL+++ DDL Sbjct: 42 DDDVGILVMHDDDL 55 >gnl|CDD|130609 TIGR01546, GAPDH-II_archae, glyceraldehyde-3-phosphate dehydrogenase, type II. All of the members of the seed are characterized. See, for instance. This model is very solid, there are no species falling between trusted and noise at this time. The closest relatives scoring in the noise are the class I GAPDH's. Length = 333 Score = 25.2 bits (55), Expect = 9.0 Identities = 10/33 (30%), Positives = 15/33 (45%) Query: 50 AAYRELYEETGIKSISLLGQGDSYIQYDFPAHC 82 A + LYE+ G+K+I G+ F A Sbjct: 89 AKNKPLYEKAGVKAIFQGGEKAEVADVSFVAQA 121 >gnl|CDD|129162 TIGR00052, TIGR00052, nudix-type nucleoside diphosphatase, YffH/AdpP family. Length = 185 Score = 25.2 bits (55), Expect = 9.2 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 6/67 (8%) Query: 1 MYRRGVGILIL----NQDDLVWVG--RRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRE 54 +Y RG +L +D +V + R + N + L ++ G + E P D A RE Sbjct: 40 IYDRGNAAAVLLYDPKKDTVVLIEQFRIAAYVNGEEPWLLELSAGMVEKGESPEDVARRE 99 Query: 55 LYEETGI 61 EE G Sbjct: 100 AIEEAGY 106 >gnl|CDD|162608 TIGR01928, menC_lowGC/arch, o-succinylbenzoic acid (OSB) synthetase. This model describes the enzyme o-succinylbenzoic acid synthetase (menC) that is involved in one of the steps of the menaquinone biosynthesis pathway. It takes SHCHC and makes it into 2-succinylbenzoate. Included in this model are low GC gram positive bacteria and archaea. Also included in the seed and in the model are enzymes with the com-name of N-acylamino acid racemase (or the more general term, racemase / racemase family), which refers to the enzyme's industrial application as racemases, and not to its biological function as o-succinylbenzoic acid synthetase. Length = 324 Score = 24.8 bits (54), Expect = 9.7 Identities = 9/46 (19%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Query: 114 YGYESEFDAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPM 159 Y +E+ + + PNI +F+ + + +K PM Sbjct: 48 YTHETIATVKHIIEDFFEPNINKEFE---HPSEALELVRSLKGTPM 90 >gnl|CDD|179786 PRK04207, PRK04207, glyceraldehyde-3-phosphate dehydrogenase; Provisional. Length = 341 Score = 24.8 bits (55), Expect = 9.8 Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 50 AAYRELYEETGIKSI 64 A +ELYE+ G+K+I Sbjct: 92 AKNKELYEKAGVKAI 106 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.140 0.457 Gapped Lambda K H 0.267 0.0731 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,763,450 Number of extensions: 162771 Number of successful extensions: 330 Number of sequences better than 10.0: 1 Number of HSP's gapped: 326 Number of HSP's successfully gapped: 33 Length of query: 160 Length of database: 5,994,473 Length adjustment: 86 Effective length of query: 74 Effective length of database: 4,136,185 Effective search space: 306077690 Effective search space used: 306077690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (24.2 bits)