BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] (160 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780557|ref|YP_003064970.1| dinucleoside polyphosphate hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Score = 337 bits (863), Expect = 8e-95, Method: Compositional matrix adjust. Identities = 160/160 (100%), Positives = 160/160 (100%) Query: 1 MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETG 60 MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETG Sbjct: 1 MYRRGVGILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETG 60 Query: 61 IKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEF 120 IKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEF Sbjct: 61 IKSISLLGQGDSYIQYDFPAHCIQENGYVGQMQKWFAFRFQGLTSEICVDRTAYGYESEF 120 Query: 121 DAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG 160 DAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG Sbjct: 121 DAWTWVSLWDTPNIVVDFKKEAYRQVVADFAYLIKSEPMG 160 >gi|254780325|ref|YP_003064738.1| mutator MutT protein [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 33.1 bits (74), Expect = 0.003, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 34/88 (38%), Gaps = 12/88 (13%) Query: 23 CFHDNNKHLSLWQMPQGGINPQEDPLDAAYRELYEETGI--KSISLLGQGDSYIQYD--- 77 C + H W+ P G I E P +A REL+EE I K SL+ Y+ Sbjct: 28 CRPKDKSHGEFWEFPGGKIEDGETPEEALTRELFEELAIVVKPFSLVPLTFISHPYEKFH 87 Query: 78 -----FPAHCIQ--ENGYVGQMQKWFAF 98 F HC + GQ +W A Sbjct: 88 LLMPFFVCHCFEGIPQSCEGQQLQWVAL 115 >gi|254780500|ref|YP_003064913.1| hypothetical protein CLIBASIA_01935 [Candidatus Liberibacter asiaticus str. psy62] Length = 159 Score = 27.3 bits (59), Expect = 0.12, Method: Compositional matrix adjust. Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 15/85 (17%) Query: 61 IKSISLLGQGDSYIQ----YDFPAHCIQENG-------YVGQMQKWFAFRF-QGLTSEIC 108 + +ISL+ QG S P+ I NG YV Q +KWF +F E Sbjct: 46 MSAISLVSQGSSRSHVIESLGSPSFSILHNGNRSQSFYYVSQKKKWFPVKFLSPKIMEYI 105 Query: 109 VDRTAYGYESEFDAWTWVSLWDTPN 133 V + +G E + VS+ PN Sbjct: 106 VLKITFG---EKGVVSSVSMERLPN 127 >gi|254780449|ref|YP_003064862.1| hypothetical protein CLIBASIA_01670 [Candidatus Liberibacter asiaticus str. psy62] Length = 459 Score = 25.4 bits (54), Expect = 0.48, Method: Compositional matrix adjust. Identities = 13/45 (28%), Positives = 23/45 (51%) Query: 8 ILILNQDDLVWVGRRCFHDNNKHLSLWQMPQGGINPQEDPLDAAY 52 IL LN+ ++ G++ DN+ M Q NP++ L ++Y Sbjct: 325 ILDLNRASFIFNGKKLARDNSAEAIQKLMNQFAKNPKQLQLISSY 369 >gi|254780957|ref|YP_003065370.1| dihydrofolate reductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 176 Score = 24.6 bits (52), Expect = 0.91, Method: Compositional matrix adjust. Identities = 20/80 (25%), Positives = 36/80 (45%), Gaps = 10/80 (12%) Query: 19 VGRRCFHDNNKHLSLWQMPQGGINPQ----EDPLDAAYRELYEETGIKSISLLGQGDSYI 74 +GR N ++ + +NP+ LD+ +L +TG K I ++G G+ Y Sbjct: 54 IGRLLPGRTNIIITRDNTRRASVNPEAVLASSILDSL--DLASKTGSKKIFIIGGGEIYA 111 Query: 75 QYDFPAHCIQENGYVGQMQK 94 Q AH + Y+ ++K Sbjct: 112 QTISLAHTL----YITHIEK 127 >gi|254780949|ref|YP_003065362.1| tyrosyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 418 Score = 21.9 bits (45), Expect = 6.4, Method: Compositional matrix adjust. Identities = 10/18 (55%), Positives = 13/18 (72%) Query: 57 EETGIKSISLLGQGDSYI 74 ++TG K ISL+G G S I Sbjct: 64 QKTGHKPISLMGGGTSII 81 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.140 0.457 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 114,341 Number of Sequences: 1233 Number of extensions: 4549 Number of successful extensions: 10 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 6 length of query: 160 length of database: 328,796 effective HSP length: 67 effective length of query: 93 effective length of database: 246,185 effective search space: 22895205 effective search space used: 22895205 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 35 (18.1 bits)