HHsearch alignment for GI: 254780558 and conserved domain: pfam04794

>pfam04794 YdjC YdjC-like protein. Family of YdjC-like proteins. This region is possibly involved in the the cleavage of cellobiose-phosphate.
Probab=93.72  E-value=0.55  Score=25.88  Aligned_cols=181  Identities=12%  Similarity=-0.009  Sum_probs=107.9

Q ss_pred             EEEEEECCCCCCCHHHHHHHHHC---CCCCEEEEECCCCCHHHHHHHHHHC-CCCEEEECCCCCCCCCCCCC--------
Q ss_conf             58999737787716889999837---9350898708987689999999985-99299981766568987787--------
Q gi|254780558|r  172 RIAIVVSGLGISQTGTQRAINLL---PANITLAFASNGNSLDRWMKEAKKK-GQEAILQIPMQAFDESYNED--------  239 (396)
Q Consensus       172 riAIVIddlG~~~~~~~~ai~~L---P~~vT~A~~P~~~~~~~~~~~Ar~~-G~EvllhlPMEp~~~~~~~p--------  239 (396)
T Consensus         2 ~Lii~ADD~G~s~~vn-~gI~~~~~~G~ltstS~M~n~p~~~~a~~~~k~~p~l~vGlHlnLt~g-~p~~~~~~~psLvd   79 (261)
T pfam04794         2 KLIVNADDFGLSPGVN-RGIIEAHRAGIVTSTSLMVNMPAFEHAAALAKRNPDLGVGLHLTLTAG-KPLLPPTEVPSLVD   79 (261)
T ss_pred             EEEEECCCCCCCHHHH-HHHHHHHHCCCCEEEEEEECCHHHHHHHHHHHHCCCCCEEEEEEECCC-CCCCCHHHCCCCCC
T ss_conf             6999677688987788-999999987981678871078159999999972899987888773689-88898454897618


Q ss_pred             --C---------CCCCCCCCCHHHHHHHHHHHHHHCCC----CEEEEECCCCCCCCCHHHHHHHHHHHHCCCCEEEECCC
Q ss_conf             --8---------55446789989999999999985589----35980012300004989999999998506928997497
Q gi|254780558|r  240 --D---------SYTLKVTQTVQQLLNRLRYSLRRGTG----YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS  304 (396)
Q Consensus       240 --G---------p~~L~~~~~~~~~~~~l~~~l~~~p~----~vGvnNhmGs~~t~~~~~m~~vl~~l~~rgL~flDs~T  304 (396)
T Consensus        80 ~~G~F~~~~~~~~~~~~~~~~~~ev~~Ei~AQi~~f~~~G~~p~hiDgH~hvh--~~P~i~~~~~~la~~~~lp~iR~~~  157 (261)
T pfam04794        80 ENGYFLRLSVLLRRALLRRLDRDEVERELRAQIERFLAFGLPPDHIDSHHHVH--LLPQVRPAVLELAREYGLPLVRLPR  157 (261)
T ss_pred             CCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCEECCCCCEE--CCHHHHHHHHHHHHHHCCCEEECCC
T ss_conf             89961752999999871499999999999999999998399964661655200--2878999999999994998772466


Q ss_pred             CCC--------------CHHHHHHHHHCCCEEEEEEEEC--CCCCHHHHHHHHHHHHHHHHHCCEEEEEEECC
Q ss_conf             632--------------2678989870994698458862--89999999999999999998719489998088
Q gi|254780558|r  305 SPR--------------NLTRVLAPKLNLPYMVADLYLD--DQVDRDKIREKLKGLEEIARTTGQAIGVAVAF  361 (396)
Q Consensus       305 s~~--------------Sva~~~A~~~gvp~~~~dvfLD--~~~~~~~I~~qL~~l~~~Ar~~G~AI~igh~~  361 (396)
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~gi~~~~~f~g~~~~~~~~~~~~~~~l~~l-----~~g~~eim~HPg  225 (261)
T pfam04794       158 EPPAGAPKLALLVRSLAAAFRARFYRAGISTNDGFAGLYSSGADFEALLLALLARL-----PEGTTEIMCHPG  225 (261)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-----CCCCEEEEECCC
T ss_conf             53322221013567678999999998699868543554566300799999999848-----999689997899