HHsearch alignment of GI: 254780558 and MMDB domain: 3cl6_A_1-42_96-308

>3cl6_A (A:1-42,A:96-308) PUUE allantoinase; URIC acid, nitrogen fixation, hydrolase; 1.58A {Pseudomonas fluorescens} PDB: 3cl7_A 3cl8_A 1z7a_A
Probab=96.52  E-value=0.048  Score=32.17  Aligned_cols=175  Identities=11%  Similarity=-0.054  Sum_probs=103.9

Q ss_pred             CCCEEEEECCC-CCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC-----CEE
Q ss_conf             35089870898-768999999998599299981766568987787855446789989999999999985589-----359
Q gi|254780558|r  196 ANITLAFASNG-NSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTG-----YFG  269 (396)
Q Consensus       196 ~~vT~A~~P~~-~~~~~~~~~Ar~~G~EvllhlPMEp~~~~~~~pGp~~L~~~~~~~~~~~~l~~~l~~~p~-----~vG  269 (396)
                      -+.||-+.-.. ....+.++++++.||||-.|=      |      -+.-+..++.+++.+.|.+..+.+-.     .+|
T Consensus        42 ~kaTFFv~g~~~~~~p~~ir~l~~~GHEIG~Ht------~------~H~~~~~~s~~~~~~ei~~~~~~L~~~~G~~~~~  109 (255)
T 3cl6_A           42 NPLTIFAVAMAAQRHPDVIRAMVAAGHEICSHG------Y------RWIDYQYMDEAQEREHMLEAIRILTELTGERPLG  109 (255)
T ss_dssp             CCCEEEECHHHHHHCHHHHHHHHHTTCEEEECC------S------SSSCCTTCCHHHHHHHHHHHHHHHHHHHSSCCSE
T ss_pred             CCEEEEEEHHHHHHCHHHHHHHHHCCCCHHHCC------C------CCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCE
T ss_conf             647999888998779999999998689787723------6------6767110999999999999999999986989863


Q ss_pred             EEECCCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCEEEEEEE---------EC-CCCCHHHHHH
Q ss_conf             8001230000498999999999850692899749763226789898709946984588---------62-8999999999
Q gi|254780558|r  270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY---------LD-DQVDRDKIRE  339 (396)
Q Consensus       270 vnNhmGs~~t~~~~~m~~vl~~l~~rgL~flDs~Ts~~Sva~~~A~~~gvp~~~~dvf---------LD-~~~~~~~I~~  339 (396)
                      .-...|+.   +.    .+...+++.|+.+..+......--.. ..............         +. ...+.....+
T Consensus       110 fr~P~~~~---~~----~~~~~l~~~G~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  181 (255)
T 3cl6_A          110 WYTGRTGP---NT----RRLVMEEGGFLYDCDTYDDDLPYWEP-NNPTGKPHLVIPYTLDTNDMRFTQVQGFNKGDDFFE  181 (255)
T ss_dssp             ECCSSCCT---TH----HHHHHHHCCCSEECCCCCCSSCEECS-CCTTCSCCEECCCCSSSBGGGGGSSSCCSSHHHHHH
T ss_pred             ECCCCCCC---CH----HHHHHHHCCCEEECCCCCCCCCCCCC-CCCCCCEEEECCCCCCCCHHHHHCCCCCCCHHHHHH
T ss_conf             51899986---51----67999971970442544787764322-478864355225655542455420367664579999


Q ss_pred             HHHHHHHHHHHC-----CEEEEEEEC----CHHHHHHHHHHHHHHHHC-CCEEEEHHHHHH
Q ss_conf             999999999871-----948999808----878899999997568876-918996777430
Q gi|254780558|r  340 KLKGLEEIARTT-----GQAIGVAVA----FDESIEVISQWLQQEHVR-DVSVVPLSCLAK  390 (396)
Q Consensus       340 qL~~l~~~Ar~~-----G~AI~igh~----~p~Ti~~L~~w~~~l~~~-gi~lVpvS~l~~  390 (396)
                      .|..+....+++     +..+...|+    .+..+++|.+.+..+.++ |+.+|.++++++
T Consensus       182 ~l~~~i~~l~~~~~~~~~~~~l~~H~~~~~~~~~~~~l~~ll~~~~~~~~v~~~T~~ei~~  242 (255)
T 3cl6_A          182 YLKDAFDVLYAEGAEAPKMLSIGLHCRLIGRPARLAALQRFIEYAKSHEQVWFTRRVDIAR  242 (255)
T ss_dssp             HHHHHHHHHHHHTTTSCEEEEEEEEHHHHTSHHHHHHHHHHHHHHHTSSSEEECCHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCEEEECHHHHHH
T ss_conf             9999999999985648986999879876698889999999999997289989987999999