HHSEARCH alignment of GI: 254780558 and SCOP domain: d2cc0a1

Alignment
>d2cc0a1 c.6.2.3 (A:1-192) Acetyl-xylan esterase {Streptomyces lividans [TaxId: 1916]}
Probab=98.28  E-value=3.2e-05  Score=49.77  Aligned_cols=170  Identities=15%  Similarity=0.032  Sum_probs=108.3

Q ss_pred             CEEEEEECCCCCCCHHHHH---HHHHCCCCCEEEEECCCCCH---HHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCC
Q ss_conf             6589997377877168899---99837935089870898768---99999999859929998176656898778785544
Q gi|254780558|r  171 ARIAIVVSGLGISQTGTQR---AINLLPANITLAFASNGNSL---DRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL  244 (396)
Q Consensus       171 ~riAIVIddlG~~~~~~~~---ai~~LP~~vT~A~~P~~~~~---~~~~~~Ar~~G~EvllhlPMEp~~~~~~~pGp~~L  244 (396)
                      ..|||-+|| |.+. .+.+   .+.+--.+.||-+.  +...   .+++++..+.||||-.|-      |..      .-
T Consensus         5 g~VaLTFDD-Gp~~-~t~~il~~L~~~~v~aTFFv~--G~~~~~~p~~~~~~~~~GheIgnHs------~~H------~~   68 (192)
T d2cc0a1           5 GYVGLTFDD-GPSG-STQSLLNALRQNGLRATMFNQ--GQYAAQNPSLVRAQVDAGMWVANHS------YTH------PH   68 (192)
T ss_dssp             EEEEEEEES-CCST-THHHHHHHHHHTTCCCEEEEC--HHHHHHCHHHHHHHHHTTCEEEECC------SSC------CC
T ss_pred             CEEEEEEEC-CCCH-HHHHHHHHHHHCCCCEEEEEE--CCCCCCCCHHHHHHHHHHHHHHHHH------CCC------CC
T ss_conf             989998726-9825-399999999983981999995--6452337246676764114877512------428------64


Q ss_pred             CCCCCHHHHHHHHHHHHHHCCCCEEEEEC----CCCCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCC
Q ss_conf             67899899999999999855893598001----23000049899999999985069289974976322678989870994
Q gi|254780558|r  245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNY----RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLP  320 (396)
Q Consensus       245 ~~~~~~~~~~~~l~~~l~~~p~~vGvnNh----mGs~~t~~~~~m~~vl~~l~~rgL~flDs~Ts~~Sva~~~A~~~gvp  320 (396)
                      +..++.++++..|.+....+-...|..-.    -++.+  +.    .+.+.+++.|+-.++-                  
T Consensus        69 ~~~ls~~~~~~ei~~~~~~i~~~~g~~~~~fR~P~g~~--~~----~~~~~l~~~G~~~v~w------------------  124 (192)
T d2cc0a1          69 MTQLGQAQMDSEISRTQQAIAGAGGGTPKLFRPPYGET--NA----TLRSVEAKYGLTEVIW------------------  124 (192)
T ss_dssp             GGGSCHHHHHHHHHHHHHHHHHTTSCCCSEECCGGGCC--CH----HHHHHHHHTTCEECCC------------------
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHH--HH----HHHHHHHHCCCCCCCC------------------
T ss_conf             00100788999999999999997688753403863654--25----5789999759845428------------------


Q ss_pred             EEEEEE-EEC-CCCCHHHHHHHHHHHHHHHHHCCEEEEEEEC-CHHHHHHHHHHHHHHHHCCCEEEEHHHHHH
Q ss_conf             698458-862-8999999999999999999871948999808-878899999997568876918996777430
Q gi|254780558|r  321 YMVADL-YLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVA-FDESIEVISQWLQQEHVRDVSVVPLSCLAK  390 (396)
Q Consensus       321 ~~~~dv-fLD-~~~~~~~I~~qL~~l~~~Ar~~G~AI~igh~-~p~Ti~~L~~w~~~l~~~gi~lVpvS~l~~  390 (396)
                          ++ ..| ...+.+.|.+.+.+     .++|. |.+-|- ++.|+++|...++.|+++|+++|.+|++.-
T Consensus       125 ----~vd~~Dw~~~~~~~i~~~v~~-----~~~G~-IiL~Hd~~~~t~~aL~~ii~~lk~~Gy~fvtlse~~~  187 (192)
T d2cc0a1         125 ----DVDSQDWNNASTDAIVQAVSR-----LGNGQ-VILMHDWPANTLAAIPRIAQTLAGKGLCSGMISPQTG  187 (192)
T ss_dssp             ----SEECCGGGTCCHHHHHHHHHT-----CCTTC-EEEEESSCHHHHHHHHHHHHHHHHTTEEECEECTTTS
T ss_pred             ----CCCCCCCCCCCHHHHHHHHHC-----CCCCE-EEEEECCCHHHHHHHHHHHHHHHHCCCEEEECCCCCC
T ss_conf             ----998565666899999999726-----58996-9997189520999999999999988998997266768


SCOP domain information

class: Alpha and beta proteins (a/b)
fold: 7-stranded beta/alpha barrel
superfamily: Glycoside hydrolase/deacetylase
family: NodB-like polysaccharide deacetylase
domain: Acetyl-xylan esterase
species: Streptomyces lividans [TaxId: 1916]