BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780558|ref|YP_003064971.1| hypothetical protein
CLIBASIA_02225 [Candidatus Liberibacter asiaticus str. psy62]
         (396 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040235|gb|ACT57031.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 396

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY
Sbjct: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
           SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT
Sbjct: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
           RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL
Sbjct: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD
Sbjct: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
           SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF
Sbjct: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA
Sbjct: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
Sbjct: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396


>gi|315121752|ref|YP_004062241.1| hypothetical protein CKC_00010 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495154|gb|ADR51753.1| hypothetical protein CKC_00010 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 354

 Score =  431 bits (1108), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 228/364 (62%), Positives = 266/364 (73%), Gaps = 25/364 (6%)

Query: 37  IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCN--Q 94
           I GLSIYIL+S+A +GT+SE+ PYS +RE     + +PL      +P+    NT  +  Q
Sbjct: 3   IFGLSIYILMSNALIGTVSEIGPYSFVRE----AVLVPLKNSSVANPASSPVNTAPSPTQ 58

Query: 95  LKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK----- 149
           + N +   D           V N+  RST +DSLPTIE RLI      EL+ K K     
Sbjct: 59  VVNSTDHKDA---------LVANESKRSTLLDSLPTIEGRLI---PVSELMEKTKPHLIS 106

Query: 150 VGREDTEVP-AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNS 208
           V  E+  V  A     C N SGARIAIVVS LGISQTGTQRAINLLP N+TLAFASNGNS
Sbjct: 107 VESENKSVSSAYSTRSCPNVSGARIAIVVSALGISQTGTQRAINLLPQNVTLAFASNGNS 166

Query: 209 LDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF 268
           L+RWM+ AK+KGQE +LQIPMQ+F+E  N DD YTLK+T++ QQLL+RLRYSLRRG GYF
Sbjct: 167 LNRWMQAAKQKGQEVMLQIPMQSFNE-LNNDDVYTLKITKSSQQLLSRLRYSLRRGKGYF 225

Query: 269 GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYL 328
           GVMNYRGAM LSNK+S E IFKEFA  GLLFFDDGSS RNLTRV+AP++NLPY VADLYL
Sbjct: 226 GVMNYRGAMFLSNKDSVETIFKEFAALGLLFFDDGSSSRNLTRVVAPQINLPYAVADLYL 285

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           DD VDRD IREKLK L +IAR TGQAIGVA AFDES+E IS+WLQ+EH  DVS+VPLSCL
Sbjct: 286 DDVVDRDSIREKLKKLSDIARVTGQAIGVASAFDESVEEISKWLQEEHASDVSIVPLSCL 345

Query: 389 AKLS 392
            KL+
Sbjct: 346 VKLA 349


>gi|307316285|ref|ZP_07595729.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           AK83]
 gi|306898125|gb|EFN28867.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           AK83]
          Length = 400

 Score =  232 bits (592), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 148/408 (36%), Positives = 210/408 (51%), Gaps = 31/408 (7%)

Query: 1   MSIDLNHPL---RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           M+ DLN PL   RK++P RK         LG  L +C   +G    I IS       S +
Sbjct: 1   MATDLNAPLGQNRKESPARKR-------DLGRVLRYCGLGLGALAVIGIS-----AWSAL 48

Query: 58  IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTV 115
            P    R  A +P      +  + +PS          L    +     +++ ++  G TV
Sbjct: 49  SPGHQTRSPA-MPAATEATLATEPAPSSEGQGNGPGALHRSGALSGAHVEDVLTDDGATV 107

Query: 116 VNKPTRSTSIDSLPTIEERLILG-------LSKKELLAKNKVGREDTEVP----AMDK-- 162
                RS        I+     G       L  + LL     GR     P     M++  
Sbjct: 108 RKYTPRSRETGGPALIDVEATRGQDPRMAALPNESLLEDRPEGRLPVIGPDGLRPMEQYA 167

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E
Sbjct: 168 RPWSGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHE 227

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +LQ+PM+ FD + N+   + L+V+    + L  L  S+ + T Y GVMNY G   LSN 
Sbjct: 228 ILLQVPMEPFDYATNDPGPHALRVSSDAGKNLAELHRSMGQITNYTGVMNYLGGRFLSNA 287

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           ++ E + ++  KRGLLF DDG+S ++L+  LA    +P+  ADL LD ++ R+ +  +L+
Sbjct: 288 DALEPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFEVPHGFADLVLDGELSRNAVLRRLE 347

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            LE IAR  G AIGVA AFDES+  I++W ++   R + VV ++ L K
Sbjct: 348 ELERIARRNGTAIGVASAFDESVAAIAEWFEEAGGRGIEVVGVAALVK 395


>gi|15966920|ref|NP_387273.1| hypothetical protein SMc03784 [Sinorhizobium meliloti 1021]
 gi|307301692|ref|ZP_07581451.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           BL225C]
 gi|15076193|emb|CAC47746.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306903390|gb|EFN33979.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           BL225C]
          Length = 400

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 148/408 (36%), Positives = 209/408 (51%), Gaps = 31/408 (7%)

Query: 1   MSIDLNHPL---RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           M+ DLN PL   RK++P RK         LG  L +C   +G    I IS       S +
Sbjct: 1   MATDLNAPLGQNRKESPARKR-------DLGRVLRYCGLGLGALAVIGIS-----AWSAL 48

Query: 58  IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTV 115
            P    R  A +P      +  + +PS          L    +     +++ ++  G TV
Sbjct: 49  SPGHQTRSPA-MPAATEATLATEPAPSSEGQGNGPGALHRSGALSGAHVEDVLTDDGATV 107

Query: 116 VNKPTRSTSIDSLPTIEERLILG-------LSKKELLAKNKVGREDTEVP----AMDK-- 162
                RS        I+     G       L  + LL     GR     P     M++  
Sbjct: 108 RKYTPRSRETGGPALIDVEATRGQDPRMAALPNESLLEDRPEGRLPVIGPDGLRPMEQYA 167

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E
Sbjct: 168 RPWSGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHE 227

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +LQ+PM+ FD + N+   + L+V+    + L  L  S+ + T Y GVMNY G   LSN 
Sbjct: 228 ILLQVPMEPFDYATNDPGPHALRVSSDAGKNLAELHRSMGQITNYTGVMNYLGGRFLSNA 287

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           ++ E + ++  KRGLLF DDG+S ++L+  LA    +P+  ADL LD ++ R+ +  +L 
Sbjct: 288 DALEPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFEVPHGFADLVLDGELSRNAVLRRLD 347

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            LE IAR  G AIGVA AFDES+  I++W ++   R + VV ++ L K
Sbjct: 348 ELERIARRNGTAIGVASAFDESVAAIAEWFEEAGGRGIEVVGVAALVK 395


>gi|209551457|ref|YP_002283374.1| hypothetical protein Rleg2_3886 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537213|gb|ACI57148.1| protein of unknown function DUF610 YibQ [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 397

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 148/408 (36%), Positives = 212/408 (51%), Gaps = 36/408 (8%)

Query: 1   MSIDLNHPL---RKKTPKRKSFYSQIISRLG-LFLLFCTF-IVGLSIYILISHAFVGTIS 55
           M  DL+ PL   RK   +R       + RLG +    C F I G S+Y     AF G   
Sbjct: 1   MGTDLHAPLGRNRKAGSRRPG-----VLRLGRIAASLCLFAIGGFSLYT----AFRGDGL 51

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-T 114
           E       +   P P   P        P     N   + +     +    ++  ++G  +
Sbjct: 52  ERTKPPAEQAATP-PSNTP-------QPPTTTANQAADGMPRAEPRSGANVEQMVTGDGS 103

Query: 115 VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDT---EVP--------AMDK- 162
           VV K +      S P + + + +G   +     N+   EDT    +P         MD+ 
Sbjct: 104 VVTKYSPRPRDGSGPVLVDAMQIGQDPRMAAQPNEALLEDTPFGRLPIVGPDGRRPMDQY 163

Query: 163 -NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
               S A G RIAIVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G 
Sbjct: 164 ARPSSGARGVRIAIVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGH 223

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E +LQ+P++ FD   N+    TL  T+ V + +  L  ++   T Y GVMNY G   LS+
Sbjct: 224 EILLQVPLEPFDYPANDPGPETLLTTKPVARNIENLHKAMGEITNYTGVMNYLGGRFLSD 283

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
             + E + ++  KRGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL
Sbjct: 284 STAMEPVMRDIGKRGLLFLDDGTSAQSKTADVAKGTELPYAFADLQLDGQLDINAVLKKL 343

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             LE IAR  GQAIGVA AFDES++ I++W ++  +R + +V ++ L+
Sbjct: 344 DELERIARKNGQAIGVASAFDESVDAIAKWSEEAAMRGIEIVGVAALS 391


>gi|222087889|ref|YP_002546427.1| hypothetical protein Arad_4893 [Agrobacterium radiobacter K84]
 gi|221725337|gb|ACM28493.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 400

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 150/224 (66%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G R+AIVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E ++
Sbjct: 166 SGARGTRVAIVVSGLGLSQTGTQRAIEKLPEEITLAFAASGNSLQRWMQEARRGGHEILI 225

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           Q+P + FD   N     TL  +Q+  + ++ L  ++ + T Y GVMNY G   LSN ++ 
Sbjct: 226 QVPFEPFDYPSNNPGPETLLTSQSAAKNIDNLHKAMGKITNYTGVMNYLGGRFLSNTDAL 285

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + ++  KRGLLF DDGSS ++ +  +A  L  P+  AD+ LD ++ +D I +KL  LE
Sbjct: 286 QPVMRDIGKRGLLFLDDGSSAQSKSGTVAKALETPHAFADMQLDGELQQDAILKKLDELE 345

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            IAR  G AIGVA AFDESI+ IS+W Q+  +R + +V +S LA
Sbjct: 346 RIARRNGTAIGVASAFDESIDAISKWSQEAAMRGIEIVAVSALA 389


>gi|218515367|ref|ZP_03512207.1| hypothetical protein Retl8_17560 [Rhizobium etli 8C-3]
          Length = 367

 Score =  219 bits (558), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 199/372 (53%), Gaps = 28/372 (7%)

Query: 33  FCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTV 91
            C F IVG S+Y     AF G   E        + A   L+ P      Q+         
Sbjct: 3   LCLFAIVGFSLYT----AFRGEGLERAKPPATEQAASQTLSKPPTATADQA--------- 49

Query: 92  CNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKV 150
            N +     +    ++  I+G  +VV K +      S P + + + +G   +     N+ 
Sbjct: 50  ANGMPRADPRSGANVEQMITGDGSVVTKYSPRPRDGSGPVLVDAMQIGQDPRMAAQPNEA 109

Query: 151 GREDT---EVP--------AMDK--NFCSNASGARIAIVVSGLGISQTGTQRAINLLPAN 197
             EDT    +P         MD+     S   G RIAIVVSGLG+SQTGTQRAI  LP  
Sbjct: 110 LLEDTAFGRLPIVGPDGRRPMDQYARPSSGVRGIRIAIVVSGLGLSQTGTQRAIAELPEE 169

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ V + +  L
Sbjct: 170 ITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKPVARNIENL 229

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
             ++   T Y GVMNY G   LS+  + E + ++  KRGLLF DDG+S ++ T  +A   
Sbjct: 230 HKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLLFLDDGTSAQSKTATVAKGA 289

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
            LPY  ADL LD Q+D + I EKL  LE IAR  GQAIG+A AFDES++ I++W ++  +
Sbjct: 290 ELPYAFADLQLDGQLDINAILEKLDELERIARKNGQAIGIASAFDESVDAIAKWSEEASM 349

Query: 378 RDVSVVPLSCLA 389
           R + +V ++ L+
Sbjct: 350 RGIEIVGVAALS 361


>gi|222150173|ref|YP_002551130.1| hypothetical protein Avi_4301 [Agrobacterium vitis S4]
 gi|221737155|gb|ACM38118.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 398

 Score =  219 bits (557), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 107/225 (47%), Positives = 145/225 (64%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G R+AIVVSGLG+SQTGTQRAI  LP  +TLAFA++GNSL RWM+EA++ G E +
Sbjct: 169 WSGAHGTRVAIVVSGLGLSQTGTQRAIKHLPEQVTLAFAASGNSLSRWMQEARRGGHEIL 228

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+P++      N+    TL+V +     L  L  ++   T Y G+MNY G   LS+  +
Sbjct: 229 LQVPLEPVGYPANDPGRGTLQVGRAATDNLRDLHRAMASMTNYTGLMNYMGGRFLSDSGA 288

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + ++ A RGLLF DDGSS R+LT   A  +N+P+ VADL LDDQ+    I ++L  L
Sbjct: 289 MDPVMRDIAARGLLFLDDGSSARSLTATFAKAMNMPFSVADLQLDDQIQEQAILKRLDEL 348

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E IAR  G AIGVA AFDES+  I++W +    R + +V +S LA
Sbjct: 349 ERIARRNGSAIGVASAFDESVNAIAKWAEGAKARGIEIVGVSALA 393


>gi|150398212|ref|YP_001328679.1| hypothetical protein Smed_3017 [Sinorhizobium medicae WSM419]
 gi|150029727|gb|ABR61844.1| protein of unknown function DUF610 YibQ [Sinorhizobium medicae
           WSM419]
          Length = 399

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/226 (47%), Positives = 149/226 (65%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E +
Sbjct: 169 WSGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEIL 228

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+PM+ FD   N+     L+V+   ++ L +L  S+ + T Y GVMNY G   LSN ++
Sbjct: 229 LQVPMEPFDAPDNDPGPPALRVSADARENLAQLHRSMGQITNYTGVMNYLGGRFLSNADA 288

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDG+S ++L+  LA   ++P+  AD+ LD ++ R  I  +L  L
Sbjct: 289 LEPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFDVPHGFADVVLDSELSRSTILRRLDDL 348

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           E IAR  G AIGVA AFDES+  I++W+++   R + VV ++ L K
Sbjct: 349 ERIARKGGTAIGVASAFDESVTSIAEWIEEAGGRGIEVVGVAALVK 394


>gi|190893932|ref|YP_001980474.1| hypothetical protein RHECIAT_CH0004369 [Rhizobium etli CIAT 652]
 gi|190699211|gb|ACE93296.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 388

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 141/380 (37%), Positives = 202/380 (53%), Gaps = 29/380 (7%)

Query: 26  RLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSP 83
           RLG +    C F I G S+Y     AF G   E        + A   L+ P      Q+ 
Sbjct: 16  RLGRIAASLCLFAIGGFSLYT----AFRGEGLERAKPPATEQAASQTLSKPPTATADQA- 70

Query: 84  SKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTIEERLILGLSKK 142
                    N +     +    ++  I+G  +VV K +      S P + + + +G   +
Sbjct: 71  --------ANGMPRADPRSGANVEQMITGDGSVVTKYSPRPRDGSGPVLVDAMQIGQDPR 122

Query: 143 ELLAKNKVGREDT---EVP--------AMDK--NFCSNASGARIAIVVSGLGISQTGTQR 189
                N+   EDT    +P         MD+     S   G RIAIVVSGLG+SQTGTQR
Sbjct: 123 MAAQPNEALLEDTAFGRLPIVGPDGRRPMDQYARPSSGVRGIRIAIVVSGLGLSQTGTQR 182

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           AI  LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ 
Sbjct: 183 AIAELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKP 242

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
           V + +  L  ++   T Y GVMNY G   LS+  + E + ++  KRGLLF DDG+S ++ 
Sbjct: 243 VARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLLFLDDGTSAQSK 302

Query: 310 TRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVIS 369
           T  +A    LPY  ADL LD Q+D + I EKL  LE IAR  GQAIG+A AFDES++ I+
Sbjct: 303 TATVAKGAELPYAFADLQLDGQLDINAILEKLDELERIARKNGQAIGIASAFDESVDAIA 362

Query: 370 QWLQQEHVRDVSVVPLSCLA 389
           +W ++  +R + +V ++ L+
Sbjct: 363 KWSEEASMRGIEIVGVAALS 382


>gi|116254417|ref|YP_770255.1| polysaccharide deacetylase protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259065|emb|CAK10176.1| putative polysaccharide deacetylase protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 388

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 141/383 (36%), Positives = 203/383 (53%), Gaps = 31/383 (8%)

Query: 24  ISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQ 81
           I RLG +    C F I G S+Y     AF G   E        + A  P   P      Q
Sbjct: 14  ILRLGRIAASLCLFAIGGFSLYT----AFRGDELERTKPPTGEQAATPPANTP------Q 63

Query: 82  SPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTIEERLILGLS 140
            P+        + +     +    ++  ++G  +VV K +  T     P + + + +G  
Sbjct: 64  PPTA---GQAADGMPRADPRSGANVEQMVTGDGSVVTKYSPRTRDGGGPVLVDAMQIGQD 120

Query: 141 KK-------ELLAKNKVGR-----EDTEVPAMDK--NFCSNASGARIAIVVSGLGISQTG 186
            +        LL +   GR      D   P MD+     S A G RIAIVVSGLG+SQTG
Sbjct: 121 PRMAAQPNEALLEETPFGRLPIVGPDGRRP-MDQYARPSSGARGVRIAIVVSGLGLSQTG 179

Query: 187 TQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKV 246
           TQRAI  LP  IT AFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  
Sbjct: 180 TQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLT 239

Query: 247 TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
           T++  + +  L  ++   T Y GVMNY G   LS+  + E + ++  KRGLLF DDG+S 
Sbjct: 240 TKSAARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLLFLDDGTSA 299

Query: 307 RNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIE 366
           ++ T  +A    LPY  ADL LD Q+D + + +KL  LE IAR  GQAIGVA AFDES++
Sbjct: 300 QSKTAAIAKGTELPYAFADLQLDGQLDINAVLKKLDELERIARKNGQAIGVASAFDESVD 359

Query: 367 VISQWLQQEHVRDVSVVPLSCLA 389
            I++W ++  +R + +V ++ L+
Sbjct: 360 AIAKWSEEAAMRGIEIVGVAALS 382


>gi|86359657|ref|YP_471549.1| hypothetical protein RHE_CH04079 [Rhizobium etli CFN 42]
 gi|86283759|gb|ABC92822.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 377

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 116/273 (42%), Positives = 170/273 (62%), Gaps = 8/273 (2%)

Query: 125 IDSLPTIEERLILGLSKKELLAKNKVGR-----EDTEVPAMDK--NFCSNASGARIAIVV 177
           +D++   ++  +  L  + LL  +  GR      D   P MD+     S A G R+AIVV
Sbjct: 101 VDAMQIGQDPRMAALPNETLLEDSAYGRLPIVGPDGRRP-MDQYARPSSGARGVRVAIVV 159

Query: 178 SGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYN 237
           SGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N
Sbjct: 160 SGLGLSQTGTQRAIAELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPAN 219

Query: 238 EDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGL 297
           +    TL  ++ V + +  L  ++   T Y G++NY G   LS+  + E I ++  KRGL
Sbjct: 220 DPGPETLLTSKPVARNIENLHKAMGEITNYTGILNYLGGRFLSDPAAMEPIMRDIGKRGL 279

Query: 298 LFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGV 357
           LF DDG+S ++ T  +A    LPY  ADL LD Q+D + I +KL  LE +AR  GQAIG+
Sbjct: 280 LFLDDGTSAQSKTADVAKGTELPYAFADLQLDGQLDVNAILKKLDELERVARKNGQAIGI 339

Query: 358 AVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           A AFDES++ I++W ++  +R + +V ++ L+K
Sbjct: 340 ASAFDESVDAIAKWSEEASMRGIEIVGVAALSK 372


>gi|241206894|ref|YP_002977990.1| hypothetical protein Rleg_4210 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860784|gb|ACS58451.1| protein of unknown function DUF610 YibQ [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 398

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 107/225 (47%), Positives = 148/225 (65%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G RIAIVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +
Sbjct: 168 SSGARGVRIAIVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEIL 227

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+P++ FD   N+    TL  T+   + +  L  ++   T Y GVMNY G   LS+  +
Sbjct: 228 LQVPLEPFDYPANDPGPETLLTTKPAARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAA 287

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  L
Sbjct: 288 MEPVMRDIGKRGLLFLDDGTSAQSKTAAIAKGTELPYAFADLQLDGQLDINAVLKKLDEL 347

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E IAR  GQAIGVA AFDES++ I++W ++  +R + +V ++ L+
Sbjct: 348 ERIARKNGQAIGVASAFDESVDAIAKWSEEAAMRGIEIVGVAALS 392


>gi|227823692|ref|YP_002827665.1| hypothetical protein NGR_c31780 [Sinorhizobium fredii NGR234]
 gi|227342694|gb|ACP26912.1| hypothetical protein NGR_c31780 [Sinorhizobium fredii NGR234]
          Length = 401

 Score =  208 bits (530), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 204/407 (50%), Gaps = 32/407 (7%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLL--FCTFIVGLSIYILISHAFVGTISEMI 58
           M  DLN PL +   KR           G   L  F   I GLS +     AF        
Sbjct: 1   MGTDLNAPLGQGLKKRPPRKRNPRRMFGYAFLGVFSLAIAGLSGWA----AFA------- 49

Query: 59  PYSVIREIAP-IPLTIP-LNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKT 114
           P S++R  AP   +  P  + E   SP+K         L+   ++    ++  ++  G T
Sbjct: 50  PDSLLRTEAPGTSVETPQASTERPASPTK--PKVAGGSLRQSGARSGAHVEEMLTDDGAT 107

Query: 115 VVNKPTRSTSIDSLPTIEERLILG-------LSKKELLAKNKVGREDTEVP----AMDK- 162
           V     RS   D    I    + G       L  ++L+     GR     P     MD+ 
Sbjct: 108 VTKYTPRSRDGDGPALISAGPMRGQDPRMAALPNEDLIEDTPQGRLPIVGPDGLRPMDQY 167

Query: 163 -NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
               S A G RI +VV GLG+SQTGTQRAI  L   +TLAFA+ GNSL RWM++A++ G 
Sbjct: 168 ARPWSGARGTRIGLVVGGLGLSQTGTQRAIRDLAPEVTLAFAAAGNSLQRWMQDARRDGH 227

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E +LQIPM+ FD   N    + L V++   + L  L  S+ + T Y G+MNY G   LS 
Sbjct: 228 EILLQIPMEPFDYPDNAPGPHALLVSRGATKNLAELHRSMGQITNYTGIMNYLGGRFLSE 287

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
            ++ E + ++  KRGLLF DDG+S ++L+  L+    +P+  ADL LD ++ R+ I  KL
Sbjct: 288 ADALEPLMRDLGKRGLLFLDDGTSAQSLSGTLSGAFGVPHGFADLVLDSELSRNAILRKL 347

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             LE +AR  G AIGVA AFDES+  I++W+++   R +  V +S +
Sbjct: 348 DELERVARRNGTAIGVASAFDESVATIAEWMEEAGGRGIEFVGISAV 394


>gi|13473411|ref|NP_104978.1| hypothetical protein mll3999 [Mesorhizobium loti MAFF303099]
 gi|14024160|dbj|BAB50764.1| mll3999 [Mesorhizobium loti MAFF303099]
          Length = 247

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 98/225 (43%), Positives = 139/225 (61%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A GAR+AIV+ GL +SQTGTQ AI  LPA +TLAFA  GNS+ RWM+ A++ G E +
Sbjct: 17  WSGARGARVAIVIGGLAVSQTGTQAAIAKLPAEVTLAFAPQGNSIGRWMQAARQGGHEIV 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +Q+P++ FD         TL V  + ++ L  L ++L R T Y GVMNY GA   ++K +
Sbjct: 77  MQVPLEPFDYPNVNPGRNTLTVAGSAEENLKNLHWALSRTTNYTGVMNYMGARFSADKAA 136

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E    E  KRGL + DDGSS R+L   LA K  +P++  D  +D   DR  I +KL GL
Sbjct: 137 MEPFMAELGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDTAIDAVQDRGAILKKLDGL 196

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E  AR  G A+G+  AFD +++++S W+ +   R + +VP+S +A
Sbjct: 197 EATARAKGTAVGIGSAFDLTVDIVSSWIAEAKKRGIEIVPISAVA 241


>gi|163761381|ref|ZP_02168455.1| hypothetical protein HPDFL43_17685 [Hoeflea phototrophica DFL-43]
 gi|162281376|gb|EDQ31673.1| hypothetical protein HPDFL43_17685 [Hoeflea phototrophica DFL-43]
          Length = 418

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/226 (44%), Positives = 140/226 (61%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A GAR+ I+V GLG+SQTGTQ AI  LP +ITLAFA+NGNSL RWM+EA+++G E +
Sbjct: 189 WSGARGARVVIIVGGLGLSQTGTQHAIAALPEDITLAFAANGNSLQRWMQEARREGHEIL 248

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQIP + FD   N+    TL V    +  L+ L  S+ R T Y G+ N+ G   LS+ ++
Sbjct: 249 LQIPFEPFDYPANDPGPRTLTVEAGAEANLDNLHASMARITNYTGITNFMGGRFLSDADA 308

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++ A RGL+F DDG+S ++LT   +  L +P+  AD+ LD   +R  I  KL  L
Sbjct: 309 LEPVMRDIADRGLMFLDDGTSAQSLTEPFSKTLGIPFAAADMVLDATQERGYILAKLDDL 368

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           E  AR  G AIGVA AF+ S++ I+ W  +   R + +V  S  A+
Sbjct: 369 ERSARRNGIAIGVASAFEVSVDAIASWANEAKARGIEIVSASAGAE 414


>gi|15890022|ref|NP_355703.1| hypothetical protein Atu2773 [Agrobacterium tumefaciens str. C58]
 gi|15157997|gb|AAK88488.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 399

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 141/224 (62%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA++GNSL RWM++A+++G E +
Sbjct: 169 WSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEIL 228

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQIP++ F          TL      +  ++RL  S+ + T Y GVMNY G   L+ + +
Sbjct: 229 LQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSA 288

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDGSS ++L+  +A  ++ P   AD+ LD +V    I  KL  L
Sbjct: 289 LEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDL 348

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           E IAR  GQAIGVA AFDESI  IS+W ++   R + +V +S L
Sbjct: 349 ERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSAL 392


>gi|319780956|ref|YP_004140432.1| hypothetical protein Mesci_1219 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166844|gb|ADV10382.1| protein of unknown function DUF610 YibQ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 392

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 136/225 (60%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S   GAR+AIV+ GL +SQTGTQ AI  LPA +TLAFA  GNS+ RWM+ A++ G E +
Sbjct: 162 WSGGRGARVAIVIGGLSVSQTGTQAAIAKLPAEVTLAFAPQGNSIGRWMQAARQSGHEIV 221

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +Q+P++ FD         TL V  +  + L  L ++L R T Y GVMNY GA   ++  +
Sbjct: 222 MQVPLEPFDYPKVNPGRNTLTVAASADENLKSLHWALSRTTNYTGVMNYMGARFSADAAA 281

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E    E  KRGL + DDGSS R+L   LA K  +P++  D+ +D   DR +I +KL  L
Sbjct: 282 MEPFIAELGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDMAIDAVQDRGEILKKLDSL 341

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E  AR  G A+G+  AFD +++ +S W+ +   R + +VP+S +A
Sbjct: 342 EATARAKGTAVGIGSAFDLTVDTVSSWVVEAKKRGIEIVPISAVA 386


>gi|159795367|pdb|2QV5|A Chain A, Crystal Structure Of Uncharacterized Protein Atu2773 From
           Agrobacterium Tumefaciens C58
 gi|159795368|pdb|2QV5|B Chain B, Crystal Structure Of Uncharacterized Protein Atu2773 From
           Agrobacterium Tumefaciens C58
          Length = 261

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 141/224 (62%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA++GNSL RWM++A+++G E +
Sbjct: 24  WSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEIL 83

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQIP++ F          TL      +  ++RL  S+ + T Y GVMNY G   L+ + +
Sbjct: 84  LQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSA 143

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDGSS ++L+  +A  ++ P   AD+ LD +V    I  KL  L
Sbjct: 144 LEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDL 203

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           E IAR  GQAIGVA AFDESI  IS+W ++   R + +V +S L
Sbjct: 204 ERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSAL 247


>gi|325294144|ref|YP_004280008.1| hypothetical protein AGROH133_09217 [Agrobacterium sp. H13-3]
 gi|325061997|gb|ADY65688.1| hypothetical protein AGROH133_09217 [Agrobacterium sp. H13-3]
          Length = 373

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 140/224 (62%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA++GNSL RWM+EA+++G E +
Sbjct: 143 WSGARGTRVAIVVGGLGLSQTGSQKAIRELPPEVTLGFAASGNSLQRWMQEARREGHEIL 202

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQIP++ F          TL      +  ++RL  S+ + T Y G+MNY G   LS + +
Sbjct: 203 LQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGIMNYLGGRFLSEQAA 262

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DD SS ++L+  +A  ++ P   AD+ LD +V    I  KL  L
Sbjct: 263 LEPVMRDIGKRGLLFLDDASSAQSLSGGIAKAISAPQGFADVLLDGEVTEATILRKLDEL 322

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           E IAR  GQAIGVA AFDESI  IS+W ++   R + +V +S L
Sbjct: 323 ERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSAL 366


>gi|260466735|ref|ZP_05812921.1| protein of unknown function DUF610 YibQ [Mesorhizobium
           opportunistum WSM2075]
 gi|259029465|gb|EEW30755.1| protein of unknown function DUF610 YibQ [Mesorhizobium
           opportunistum WSM2075]
          Length = 392

 Score =  192 bits (489), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 93/225 (41%), Positives = 134/225 (59%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A GAR+AIV+ GL +SQTGTQ AI  LP  +TL FA  GNS+ RWM+ A++ G E +
Sbjct: 162 WSGARGARVAIVIGGLAVSQTGTQAAIAKLPPEVTLGFAPQGNSIGRWMQAARQGGHEIV 221

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +Q+P++ FD         TL V  +  + L  L ++L R T Y GVMNY GA   ++  +
Sbjct: 222 MQVPLEPFDYPSVNPGRNTLTVAASADENLKSLHWALSRTTNYTGVMNYMGARFSADATA 281

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
                 E  KRGL + DDGSS R+L   LA K  +P++  D+ +D   DR +I +KL  L
Sbjct: 282 MGPFMAELGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDMAIDAVQDRGEILKKLDSL 341

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E  AR  G A+G+  AFD +++ +S W+ +   R + +VP+S +A
Sbjct: 342 EATARAKGFAVGIGSAFDLTVDTVSSWVAEAKKRGIEIVPISAVA 386


>gi|114706555|ref|ZP_01439456.1| hypothetical protein FP2506_12424 [Fulvimarina pelagi HTCC2506]
 gi|114537947|gb|EAU41070.1| hypothetical protein FP2506_12424 [Fulvimarina pelagi HTCC2506]
          Length = 386

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 137/221 (61%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           G R+AIVV GLGISQ+GT  AI  LP+ +TLAFA+NGNSL RWM+EA++ G E +LQ+PM
Sbjct: 161 GPRVAIVVGGLGISQSGTLSAIRNLPSEVTLAFAANGNSLARWMQEARRGGHELLLQMPM 220

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +      N+    T+   Q   +  + +  SL + T Y GVMNY G  L S+  +     
Sbjct: 221 EPVGYPTNDPGDNTVTSEQMNAEDFSSVLASLGQMTNYVGVMNYLGGQLTSDASALHPFM 280

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            E A+RGL++ DDGSS R++   LA   ++P   ADL LDD  D  +I  +L  LE+IAR
Sbjct: 281 SELARRGLMYLDDGSSARSVAVDLAETTSIPAGAADLVLDDVQDAGEISRRLDQLEQIAR 340

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           T G AIGVA AF+ +  VI  W+++   R ++V P+S + +
Sbjct: 341 TRGHAIGVASAFETTTSVIGSWIREAERRGITVTPVSSVVR 381


>gi|110635778|ref|YP_675986.1| protein of unknown function DUF610, YibQ [Mesorhizobium sp. BNC1]
 gi|110286762|gb|ABG64821.1| protein of unknown function DUF610, YibQ [Chelativorans sp. BNC1]
          Length = 330

 Score =  190 bits (482), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/225 (42%), Positives = 138/225 (61%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A GARIAIV+ GLGISQTGTQ AI  LP  ITLAFA  GNSL RWM+EA++ G E I
Sbjct: 97  WSGARGARIAIVIGGLGISQTGTQEAIEKLPPEITLAFAPLGNSLMRWMQEARRDGHEVI 156

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +Q+P++           YTL       + +  LR+ L R T Y GVMNY GA   +++++
Sbjct: 157 MQVPLEPAGYPSTNPGRYTLLTNVGADKNIRNLRWVLSRITNYTGVMNYMGARFTADRKA 216

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            +++  E ++RGLL+FDDG S R+L   +A    +P++  D  +D + +R  I +KL  L
Sbjct: 217 MDLLMDELSQRGLLYFDDGMSARSLAEEVALAKGVPFVAGDDVIDQERERGAILKKLDEL 276

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E IAR  G A+G  +A + +++ ++ W  +   R V +VP+S +A
Sbjct: 277 ERIARAKGFAVGSGIALNATVDAVTSWAGEVRKRGVELVPISAVA 321


>gi|90418832|ref|ZP_01226743.1| possible divergent polysaccharide deacetylase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336912|gb|EAS50617.1| possible divergent polysaccharide deacetylase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 384

 Score =  189 bits (479), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/258 (40%), Positives = 143/258 (55%), Gaps = 3/258 (1%)

Query: 132 EERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAI 191
           ++ LI   +   L A+   GR   +V A      S   G RIAIVV GLGISQTGT  AI
Sbjct: 124 DDALIEDSAYGPLPARAPDGRRPYDVYA---GAWSGKPGTRIAIVVGGLGISQTGTLNAI 180

Query: 192 NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQ 251
             LP  +T  F+ +GNSLDRWM+EA++ G E +LQ+P++       +    TL V     
Sbjct: 181 GSLPPGVTFGFSPSGNSLDRWMQEARRSGHELVLQVPLEPVGYPQVDPGEDTLTVDDAAA 240

Query: 252 QLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
             L+ L  SL   T Y G+MNY G   ++   + E +  E  +RGL+FFDD SS R++  
Sbjct: 241 GDLSALHASLATITNYVGIMNYMGGRFVAEPAAMEALIAELGRRGLMFFDDASSLRSVAA 300

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
             A   ++P  V+DL +D   D   IR +L  LE IAR  G AIG A AFD S+  I++W
Sbjct: 301 DTAQLQSVPAAVSDLSIDRSQDPADIRSQLDTLERIARAEGTAIGFASAFDVSVATIAKW 360

Query: 372 LQQEHVRDVSVVPLSCLA 389
           + +   R + +VPLS LA
Sbjct: 361 IGEARGRGIEIVPLSALA 378


>gi|239832921|ref|ZP_04681250.1| protein of unknown function DUF610 YibQ [Ochrobactrum intermedium
           LMG 3301]
 gi|239825188|gb|EEQ96756.1| protein of unknown function DUF610 YibQ [Ochrobactrum intermedium
           LMG 3301]
          Length = 406

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 129/225 (57%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A GARIA+V+ GLG+SQTG+  AI+ LP  +TL FA  GNSL RWM+ A++ G E +L
Sbjct: 177 SGARGARIALVIGGLGLSQTGSMEAIDKLPQEVTLGFAPQGNSLQRWMQAARQNGHELVL 236

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           Q+PM+ FD         TL V    ++    L ++L R T Y GVMNY GA   S  E  
Sbjct: 237 QLPMEPFDYPRVNPGRNTLTVGDGAKKNEASLLWALSRMTNYAGVMNYMGARFTSETEVF 296

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             +  E  +RGL + DDG+S R+    +A    +P+  AD+ +D   +R  I ++L  LE
Sbjct: 297 SPVLGEIGRRGLYYLDDGTSARSEADRIASSDAVPFAAADVLIDAAQERGAILDRLDELE 356

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            IAR  G AIG   AF  +++ ++ W  +   R + +VP+S L +
Sbjct: 357 RIARANGSAIGTGSAFAVTVDAVAAWANEVKKRGIEIVPVSALVR 401


>gi|304392603|ref|ZP_07374543.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303295233|gb|EFL89593.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 408

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 94/227 (41%), Positives = 132/227 (58%), Gaps = 1/227 (0%)

Query: 165 CSNASGA-RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            S A GA RIA+V+ GLG+SQTGTQ AI  LP  ITLAF+  GNSL RWM+ A+++G E 
Sbjct: 178 SSGAVGANRIALVLGGLGLSQTGTQEAIKRLPEGITLAFSPQGNSLQRWMQAARREGHEV 237

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
            LQ+PM+            TL    +    L  LR+SL R T Y  V+NY GA +LSN+ 
Sbjct: 238 ALQLPMEPLGYPTVNPGPQTLNSKVSKGANLKSLRWSLGRMTNYPVVINYLGAGMLSNRP 297

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E I +E   RGL   DDG+   +     A ++ LP   A + +D   D D+IR +L+ 
Sbjct: 298 ALEPILQELRARGLGIVDDGTVQSSNLVTYANEMRLPNAKASIIIDRVRDADRIRAQLQT 357

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           LE +AR  G  I  A AF +++E++ +W +  + R + +VPLS L +
Sbjct: 358 LEAVARQQGNVIATATAFPQTVEIVEEWAKTLNQRGILLVPLSNLVR 404


>gi|153008397|ref|YP_001369612.1| hypothetical protein Oant_1063 [Ochrobactrum anthropi ATCC 49188]
 gi|151560285|gb|ABS13783.1| protein of unknown function DUF610 YibQ [Ochrobactrum anthropi ATCC
           49188]
          Length = 407

 Score =  169 bits (428), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 190/408 (46%), Gaps = 27/408 (6%)

Query: 3   IDLNHPLR--KKTPKRKSFYSQIISRL--GLFLLFCTFIVGLSIYILISH---AFVGTIS 55
           +DLN PL   KK  KR    S+       GL +L    + G +++ +  +   AF  T +
Sbjct: 2   LDLNSPLGLDKKPQKRGGSRSRAFRSFMTGLVILGGLCLAGGAVFAIWQNNQAAFRKTET 61

Query: 56  EMI-------PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
             +       P +   E  P+    P      +  S +    +     +      G    
Sbjct: 62  AAVDPTQIEAPVANKTEAKPVTGNTPPPGSALRGASGQPGPAIIKVTPDMPPGMPGAATG 121

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVG----REDTEVPAMDKNF 164
              G  VV + T  +  D       + +  L ++ L+ ++  G    R    +  MD   
Sbjct: 122 MAEGNVVVVQNTHQSGQD-------KRVAHLPEQALVEQSPTGPLPVRGADGLRPMDAYA 174

Query: 165 C--SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S A GARIAIV+ GLG+SQTG+  A++ LP  +TL FA  GNSL RWM+ A++ G E
Sbjct: 175 AGWSGARGARIAIVIGGLGLSQTGSMEAVDKLPPEVTLGFAPQGNSLQRWMQAARQNGHE 234

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +LQ+PM+ FD         TL V     +    L ++L R T Y GVMNY GA   S  
Sbjct: 235 LVLQLPMEPFDYPRINPGRNTLTVDDGASKNQAFLLWALSRMTNYAGVMNYMGARFTSET 294

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           E+   +  E  KRGL + DDG+S R+    +A    +P+  AD+ +D   +R  I ++L 
Sbjct: 295 EAFSPVLGEIGKRGLYYLDDGTSARSQADRIAGSDAVPFAAADILIDAAQERGAILDRLD 354

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            LE  AR  G AIG   AF  +++ +++W  +   R + +VP+S L +
Sbjct: 355 ELERTARANGSAIGTGSAFAVTVDAVAEWANEVKKRGIEIVPVSALVR 402


>gi|220924600|ref|YP_002499902.1| hypothetical protein Mnod_4734 [Methylobacterium nodulans ORS 2060]
 gi|219949207|gb|ACL59599.1| protein of unknown function DUF610 YibQ [Methylobacterium nodulans
           ORS 2060]
          Length = 404

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 115/392 (29%), Positives = 174/392 (44%), Gaps = 20/392 (5%)

Query: 5   LNHPL--RKKTPKRKSFYSQIISRLGLFLLFCTFIVG-LSIYILISHAFVGTISEMIPYS 61
           L+ PL  R + P R + +   I    +     + +VG L+  I  +   +G     +   
Sbjct: 16  LSRPLGIRNEAPSRLARWRAAIPVRPILAAGSSVLVGALACLIAFTEDPLGGEPHAVVTI 75

Query: 62  VIRE-IAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
            +RE +AP P       E   +P+  D +    +++  S     + +       VV +  
Sbjct: 76  TLREPVAPAP-------EPTLAPAAPDGSRSAGEVERASGVAVTRPEGAAVPDAVVIRVP 128

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV------PAMDKNFCSNASGARIA 174
               +   P  + RL+    K       ++G +          P         A   RIA
Sbjct: 129 DPAELSLAPAPDPRLV---EKGRYGVLPRIGPDGARALDIYARPEATSLRSGAAPAGRIA 185

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +VV+GLGI QT TQ A+  LP  +TLAFA  G+ + +    A++ G E ++Q PM+ FD 
Sbjct: 186 LVVTGLGIGQTVTQEAVTRLPPAVTLAFAPYGSDIGKAATRAREAGHEVLVQAPMEPFDY 245

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
             N+    TL       +   RL + L R  G  GV+NY GA L     S E + +E   
Sbjct: 246 PDNDPGPQTLLAGAKPAENTGRLAFVLARVPGAIGVVNYMGARLTGEAASLEPVLREIGA 305

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGL F DDGSSPR+L   +  +   P   AD  +D Q   D I  +L  LEE AR  G A
Sbjct: 306 RGLGFLDDGSSPRSLALEVGRRTRTPVARADAVVDAQPLPDAIDRELARLEETARRKGFA 365

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           +G A+A   ++E I +W +    R + +VP S
Sbjct: 366 LGTAMALPLTVERILRWSRDLEARGILLVPAS 397


>gi|307942948|ref|ZP_07658293.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773744|gb|EFO32960.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 385

 Score =  152 bits (385), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 127/220 (57%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           AS  +IAIV++GLG+S+ GTQ  ++ LPA+ TL  +  G +LDRW++ A+ KG E +L +
Sbjct: 162 ASTPKIAIVITGLGLSEAGTQNVLDQLPADTTLGLSPYGANLDRWIQGARTKGHEIVLSL 221

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+ FD   N+   +TL V+ T  +L  RL + L R T Y GVM   GA   S + + ++
Sbjct: 222 PMEPFDFPDNDPGPHTLLVSLTQSELTERLTWLLTRITNYVGVMPEMGARYTSTRPTLQL 281

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + ++   RGL+F D+G+S R++   +A +   P+   D+ LD     D+I  KL  LE I
Sbjct: 282 LMEKLRDRGLMFVDNGTSSRSVADEIAEETTTPFSGVDVVLDAVPREDEINAKLLQLEGI 341

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           AR  G A+    A   ++  I +W +    R + +VP+S 
Sbjct: 342 ARARGVAVATGSALPVTVRQIEKWARDLEERGLLLVPVSA 381


>gi|316931861|ref|YP_004106843.1| hypothetical protein Rpdx1_0469 [Rhodopseudomonas palustris DX-1]
 gi|315599575|gb|ADU42110.1| protein of unknown function DUF610 YibQ [Rhodopseudomonas palustris
           DX-1]
          Length = 412

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 125/224 (55%), Gaps = 1/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + IVV GLGI    T  A+  LPA +TLAF   G+   +   EA+ K  E ILQIPM+ F
Sbjct: 190 VTIVVGGLGIGAARTNDAVMKLPAPVTLAFTPYGSDPGKLATEARAKRHEIILQIPMEPF 249

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + + + I ++ 
Sbjct: 250 DYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEPAMQAIIRDA 309

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDG++PR++   LA  L +P+  ADL +D       I + L  LE IA+  G
Sbjct: 310 AKRGLGYLDDGTAPRSVAGTLANSLAIPFARADLTIDQVPAGADIDKALTRLESIAKERG 369

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            AIG+A A   +IE I  W +    R + +VPL+  A L S SS
Sbjct: 370 SAIGMASALPVTIERIVNWSKSLESRGIVLVPLTT-AMLKSKSS 412


>gi|86747385|ref|YP_483881.1| hypothetical protein RPB_0259 [Rhodopseudomonas palustris HaA2]
 gi|86570413|gb|ABD04970.1| Protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris HaA2]
          Length = 405

 Score =  150 bits (378), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 122/215 (56%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAIVV+GLG+    T  A+  LP  +TLAF   G    + +++A+ K  E +LQIPM+ F
Sbjct: 183 IAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGADPGKLVEQARAKQHEVLLQIPMEPF 242

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + + + I +E 
Sbjct: 243 DYPDNDPGPQTLLTSGAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEAAMQPIIREA 302

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDGS+PR++   LA  L +P+  ADL +D      +I + L  LE +A+  G
Sbjct: 303 AKRGLGYLDDGSAPRSVAPALAKSLAMPFARADLAIDSVPTGGEIDKALARLEGLAKERG 362

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            AIG A A   SIE I  W +    R + +VPL+ 
Sbjct: 363 LAIGTASALPLSIERIVSWSKSLESRGILLVPLTT 397


>gi|118589439|ref|ZP_01546845.1| hypothetical protein SIAM614_07838 [Stappia aggregata IAM 12614]
 gi|118438139|gb|EAV44774.1| hypothetical protein SIAM614_07838 [Stappia aggregata IAM 12614]
          Length = 370

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 148/271 (54%), Gaps = 5/271 (1%)

Query: 117 NKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIV 176
           N P  S SI+    + ER   G   K  ++   V   D     + + F S     +IA++
Sbjct: 101 NAPVTSLSINPDSRVSERSDFGFLPK--ISDAGVRPLDAYSRPVVREFTSIP---KIAVI 155

Query: 177 VSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESY 236
           V+GLG+S+TGTQ AI  LPA+ T A A  G  LD WM++A+ KG E +LQ+P++ FD   
Sbjct: 156 VTGLGLSETGTQNAITRLPADTTFALAPYGGDLDVWMQQARTKGHELLLQLPLEPFDFPD 215

Query: 237 NEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRG 296
           N+   +TL V+    ++++RL + L R T Y GV+   GA   + K S E + ++   RG
Sbjct: 216 NDPGPHTLLVSLRPNEMMDRLGFLLTRATNYVGVIPEMGARFTATKPSMEFLLEKLKARG 275

Query: 297 LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIG 356
           L+F D+G+S R++   +A +  +P+   D+ LD+    D I  KL  LE +AR  G A+ 
Sbjct: 276 LMFADNGTSSRSIADEVAKEKRIPFSGVDVVLDEVPREDDIDAKLLQLESVARARGVAVA 335

Query: 357 VAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            A A   ++  + +W+Q    R + +VP+S 
Sbjct: 336 TASALPVTVRQLEKWVQDLEERGLQLVPVSA 366


>gi|39933247|ref|NP_945523.1| hypothetical protein RPA0170 [Rhodopseudomonas palustris CGA009]
 gi|39652872|emb|CAE25614.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 412

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 84/224 (37%), Positives = 124/224 (55%), Gaps = 1/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + IVV GLGI    T  A+  LPA + LAF   G+   +   EA+ K  E ILQIPM+ F
Sbjct: 190 VTIVVGGLGIGAARTNDAVMKLPAAVALAFTPYGSDPGKLATEARAKRHEVILQIPMEPF 249

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + + + + ++ 
Sbjct: 250 DYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEPAMQAVIRDA 309

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDG++PR++   LA  L +P++ ADL +D       I + L  LE IA+  G
Sbjct: 310 AKRGLGYLDDGTAPRSVAGTLAKSLAIPFVRADLTIDQVPAGADIDKSLARLESIAKERG 369

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            A+G+A A   +IE I  W +    R + + PL+  A L S SS
Sbjct: 370 SAVGMASALPVTIERIVNWSKSLESRGILLAPLTT-AMLKSKSS 412


>gi|192288598|ref|YP_001989203.1| hypothetical protein Rpal_0165 [Rhodopseudomonas palustris TIE-1]
 gi|192282347|gb|ACE98727.1| protein of unknown function DUF610 YibQ [Rhodopseudomonas palustris
           TIE-1]
          Length = 412

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 123/224 (54%), Gaps = 1/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + IVV GLGI    T  A+  LPA + LAF   G+   +   EA+ K  E ILQIPM+ F
Sbjct: 190 VTIVVGGLGIGAARTNDAVMKLPAAVALAFTPYGSDPGKLATEARAKRHEVILQIPMEPF 249

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + + + I ++ 
Sbjct: 250 DYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEPAMQAIIRDA 309

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDG++PR++   LA  L +P+  ADL +D       I + L  LE IA+  G
Sbjct: 310 AKRGLGYLDDGTAPRSVAGTLAKSLAIPFARADLTIDQVPAGADIDKSLARLESIAKERG 369

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            A+G+A A   +IE I  W +    R + + PL+  A L S SS
Sbjct: 370 SAVGMASALPVTIERIVNWSKSLESRGILLAPLTT-AMLKSKSS 412


>gi|91975045|ref|YP_567704.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB5]
 gi|91681501|gb|ABE37803.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB5]
          Length = 411

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 127/224 (56%), Gaps = 1/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAIVV+GLG+    T  A+  LP  +TLAF   G+   + +++A+ K  E +LQIPM+ F
Sbjct: 189 IAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGSDPGKLVEQARAKQHEVLLQIPMEPF 248

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++   + + I +E 
Sbjct: 249 DYPDNDPGPQTLLTSGAPEQNLDRLTWHLSRIQGYVGLSNFMGARFVATDAAMQPIIREA 308

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDGS+PR++   LA  L +P+  AD  +D      +I + L  LE +A+  G
Sbjct: 309 AKRGLGYLDDGSAPRSVAPSLAKSLAMPFARADSAIDAVPTAAEIDKALARLEALAKERG 368

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            A+G A A   SIE I  W +    R + +VPL+ +A L S S+
Sbjct: 369 SAVGTASALPVSIERIVSWSKSLESRGILLVPLT-MAMLKSKST 411


>gi|90421691|ref|YP_530061.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB18]
 gi|90103705|gb|ABD85742.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB18]
          Length = 412

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 120/215 (55%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAIVV GLG+    T  AI  LPA +TLAF   G+   + ++ A+ +  E +LQIPM+ F
Sbjct: 185 IAIVVGGLGVGAAKTNDAIMKLPAAVTLAFTPYGSDPAKLVERARAQRHEVLLQIPMEPF 244

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T   +Q ++RL + L R  GY G+ N+ G   ++ + + + I +E 
Sbjct: 245 DYPDNDPGPQTLLTTLPSEQNIDRLYWHLSRFQGYIGITNFMGGRFVTTEPALQPIVREA 304

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDG SPR +  +LA    LP+  ADL +D      +I   L  LE +AR  G
Sbjct: 305 AKRGLGYLDDGQSPRGVAALLATTQTLPFGKADLSIDVVPTALEIDRALYRLESLARDNG 364

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            AIG+A A   SIE I+ W +    R + +VPL+ 
Sbjct: 365 NAIGMASALPISIERIATWSRSLEGRGLLLVPLTT 399


>gi|254504290|ref|ZP_05116441.1| Divergent polysaccharide deacetylase family [Labrenzia alexandrii
           DFL-11]
 gi|222440361|gb|EEE47040.1| Divergent polysaccharide deacetylase family [Labrenzia alexandrii
           DFL-11]
          Length = 372

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 130/216 (60%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +IA+VV+GLG+S+ GTQ AI+ LPA++T A A  G+ LD WM++A+ KG E +LQ+P++ 
Sbjct: 151 KIAVVVTGLGLSEAGTQNAIDSLPADVTFALAPYGSDLDLWMQQARMKGHELLLQLPLEP 210

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           FD   N+   +TL V+    +LL+RL + L R T Y GV+   GA   S + S + + ++
Sbjct: 211 FDFPDNDPGPHTLLVSLQPTELLDRLAFLLTRATNYVGVIGEMGARFSSTRPSMQYLLEK 270

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
              RGL+F D+G++ R++   +A +L +P+   D+ LD+      I  KL  LE +AR  
Sbjct: 271 LETRGLMFVDNGTTSRSIADEVAGELRMPFSGVDVVLDEVPRESNIDAKLLQLESVARAR 330

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           G A+    A   ++  + +W+Q    R + +VP+S 
Sbjct: 331 GYAVAAGSALPVTVRQLQEWVQDLEQRGLQLVPVSA 366


>gi|154251924|ref|YP_001412748.1| hypothetical protein Plav_1471 [Parvibaculum lavamentivorans DS-1]
 gi|154155874|gb|ABS63091.1| protein of unknown function DUF610 YibQ [Parvibaculum
           lavamentivorans DS-1]
          Length = 426

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 73/219 (33%), Positives = 127/219 (57%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           RIA+VVSG+GIS++ T  AI++LP  +TL+FA  G  L  W+  A+  G E +L++PM+ 
Sbjct: 207 RIALVVSGMGISESATSHAIDVLPPEVTLSFAPYGTGLQGWIDRARAAGHEVLLELPMEP 266

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           F    N+   +TL  +   ++ + RL + + R +GY GVMNY+GA   ++  + + +   
Sbjct: 267 FGYPQNDPGPHTLLTSLQPKENIERLEWLMSRFSGYAGVMNYQGARFTTSATALKPVVAA 326

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
              RGLL+ D+G+S R+L   LA +  +P + A   +D   + + I   L  LE+ +  T
Sbjct: 327 LGARGLLYVDNGASARSLAPQLAGESRMPAVQATRIIDPVQNPEVIATSLDMLEKTSSET 386

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G A+GVA  F  +++ +++W +        +VP++ +A+
Sbjct: 387 GSAVGVASGFPVTVDALAEWAKTLRNDGYVLVPVTAIAR 425


>gi|115522300|ref|YP_779211.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisA53]
 gi|115516247|gb|ABJ04231.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisA53]
          Length = 403

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 159/329 (48%), Gaps = 28/329 (8%)

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG---KTVVNKPTRSTSI--DSLPTIE 132
           E K  P+K ++            Q    I +  SG   + VV   T    I  D  PT  
Sbjct: 76  ESKDKPAKSESAAKATPPAEAEGQRTVTIIDGTSGERKQVVVASETAGAKIERDEAPTS- 134

Query: 133 ERLILGLSKKELLAKNKVGREDTEVP-AMD--KNFCSNASGA-----------RIAIVVS 178
              + G++ K LL +++ G     +P A D  K F + A+G+            IAIVV 
Sbjct: 135 ---VAGINPK-LLEQSRYG----AIPIAADGLKPFAAYATGSDADRATAARLPTIAIVVG 186

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
           GLG+    T  AI  LPA +TLAF   G+  +  +  A+ +  E +LQIPM+ F+   N+
Sbjct: 187 GLGVGAAKTADAIMKLPAAVTLAFTPYGSDPNGLVARARAQRHEVLLQIPMEPFEYPDND 246

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
               TL  + + +Q ++RL + L R  GY G+ N+ G   +    +   I KE AKRGL 
Sbjct: 247 PGPQTLLTSLSAEQNIDRLHWHLSRFQGYVGIANFMGGRFVITDTALSPIMKEAAKRGLG 306

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           + DDG +PR+L   LA    +P+  ADL +D      +I + L  LE +AR  G AIG A
Sbjct: 307 YLDDGQAPRSLASSLAAAQTVPFGKADLGIDAVPTALEIDKALSRLEALARENGNAIGTA 366

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            A   SIE I+ W +    R + +VPL+ 
Sbjct: 367 SALPVSIERIAAWAKSLQSRGLLLVPLTT 395


>gi|114571337|ref|YP_758017.1| hypothetical protein Mmar10_2797 [Maricaulis maris MCS10]
 gi|114341799|gb|ABI67079.1| protein of unknown function DUF610, YibQ [Maricaulis maris MCS10]
          Length = 445

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 75/230 (32%), Positives = 119/230 (51%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
           A  + +  +     IA+VV G+G++ T TQ AI+ LP  + L+FA+    L  W+  A+ 
Sbjct: 164 AYARPYHGDPGAPTIAVVVGGMGLNSTVTQAAIDELPPEVALSFAAYARDLQVWIDRARA 223

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
            G E +++ PM+ FD   N+   +TL    T ++   RL + L R TGYFGV NY GA  
Sbjct: 224 AGHEVLIEAPMEPFDYPNNDPGPHTLLADGTAEENSRRLAWVLSRATGYFGVTNYLGARF 283

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            +++++   +F     RG+ F  DG+  R+     A   ++ Y VAD  LD+ +  D I 
Sbjct: 284 SASQDAMRQVFGTLEGRGVAFLHDGAGRRSTIEAAAGATDIEYAVADRILDEDLSPDAID 343

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           E+L  LE +A   G A+G   A+  ++E I  W     +R   + P S +
Sbjct: 344 ERLLALEALAIQNGSALGTGFAYPATVEQIRDWAVSLDLRGYQLAPPSAV 393


>gi|92116147|ref|YP_575876.1| protein of unknown function DUF610, YibQ [Nitrobacter hamburgensis
           X14]
 gi|91799041|gb|ABE61416.1| protein of unknown function DUF610, YibQ [Nitrobacter hamburgensis
           X14]
          Length = 401

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 82/227 (36%), Positives = 125/227 (55%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           D +    A+   IAIVV GLG+    T  AI  LP  +TLAF   G+   + +++A+ + 
Sbjct: 167 DADRAKAATMPVIAIVVGGLGVGAAKTADAIMKLPPAVTLAFTPYGSDPGKLVEQARAQR 226

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
            E +LQ+PM+ +D   N+    TL  T   +Q ++RL + L R  GY G+ N+ GA  ++
Sbjct: 227 HEILLQVPMEPYDYPDNDPGPQTLLTTLGTEQNIDRLHWHLSRFQGYVGLANFMGARFVA 286

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
                + I +E AKRGL + DDGS+PR++   LA    +P+  ADL +D      +I + 
Sbjct: 287 AATVMQPIIREAAKRGLGYLDDGSTPRSVAGQLAEGQAMPFAKADLTIDAVPTSVEIDKA 346

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           L  LE++A+  G AIG+A A   S+E I  W +    R V +VPL+ 
Sbjct: 347 LARLEDLAKERGAAIGMASALPVSVERIGAWAKGLESRGVMLVPLTT 393


>gi|323137511|ref|ZP_08072588.1| protein of unknown function DUF610 YibQ [Methylocystis sp. ATCC
           49242]
 gi|322397137|gb|EFX99661.1| protein of unknown function DUF610 YibQ [Methylocystis sp. ATCC
           49242]
          Length = 413

 Score =  145 bits (365), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 123/221 (55%), Gaps = 1/221 (0%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   RIA+V+ GLG++   +  AI+ LP  +TLAFA  G  LDR +  A+ +G EA+LQ
Sbjct: 173 KADAPRIALVIGGLGLNAATSADAIDQLPEGVTLAFAPYGAELDRLVASARARGHEALLQ 232

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PM+ FD   N    +TL VT       + L++ + R +GY GVMNY G    +++++  
Sbjct: 233 APMEPFDYPQNNPGPHTL-VTGAPDGGADDLQWLMSRFSGYAGVMNYLGGRYTADEQALS 291

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
               E A+RGL F DD ++P++L   LAPK +LP+   D+ +D +     I   L  LE 
Sbjct: 292 GALAEIAQRGLFFLDDRAAPQSLITALAPKFSLPHAKVDVVIDARNTPQSIDAALAQLET 351

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            AR  G AIG A A   +I  ++++ +    R +++ P+S 
Sbjct: 352 QARDKGVAIGFANAVPATISRVARFARDLERRGIALAPVSA 392


>gi|27375546|ref|NP_767075.1| hypothetical protein blr0435 [Bradyrhizobium japonicum USDA 110]
 gi|27348683|dbj|BAC45700.1| blr0435 [Bradyrhizobium japonicum USDA 110]
          Length = 407

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 85/224 (37%), Positives = 120/224 (53%), Gaps = 1/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+ GLG+    T  AI  LPA +TLAF   G+   +  + A+ +  E  LQIPM+ +
Sbjct: 185 VAIVIGGLGVGAAKTTDAIMKLPAAVTLAFTPYGSDPGKIAERARTQRHEIFLQIPMEPY 244

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  + +  Q ++RL + L R  GY G+ N+ GA  ++   + + I +E 
Sbjct: 245 DFPDNDPGPQTLLTSLSADQNMDRLYWHLSRMQGYAGITNFMGARFVATDAAMQPIIREA 304

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL FFDDGSSPR++    A    +P+   D+ +D      +I   L  LE  AR  G
Sbjct: 305 AKRGLGFFDDGSSPRSIAPQAAASQAMPFGKGDIAIDVVPTPAEIDRALNKLESAARERG 364

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            AIG A A   SIE I  W +    R + +VPL+  A L S SS
Sbjct: 365 TAIGTASALPVSIERIGAWTKTLGDRGILLVPLTT-AMLKSKSS 407


>gi|209883750|ref|YP_002287607.1| protein of unknown function, YibQ [Oligotropha carboxidovorans OM5]
 gi|209871946|gb|ACI91742.1| protein of unknown function, YibQ [Oligotropha carboxidovorans OM5]
          Length = 390

 Score =  143 bits (360), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 119/215 (55%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           I++V+ GLG+    T  A+  LP  +TLAF   G+   + +  A+ +  E +LQ+PM+ +
Sbjct: 168 ISLVIGGLGVGSAKTNDAVLRLPGAVTLAFTPYGSDPGKLIARARAQKHEVLLQVPMEPY 227

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T + +Q ++RL + + R  GY G+ N+ G+  + +  + + I +E 
Sbjct: 228 DYPDNDPGPQTLLATASAEQNVDRLMWHMSRFQGYVGLANFMGSRFVVSDAAMQPIVQEA 287

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           A+RGL +FDDGS PR+L   LA     P   ADL +D      +I + L  LE +AR  G
Sbjct: 288 ARRGLAWFDDGSVPRSLAGQLAGAQGAPSTTADLVIDQVPTSAEIDKNLAKLENLARERG 347

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            A+G+A A   SIE I  W Q+   R + +VPL+ 
Sbjct: 348 TAVGMASALPVSIERIGAWAQRLENRGILLVPLTT 382


>gi|85713722|ref|ZP_01044712.1| hypothetical protein NB311A_04259 [Nitrobacter sp. Nb-311A]
 gi|85699626|gb|EAQ37493.1| hypothetical protein NB311A_04259 [Nitrobacter sp. Nb-311A]
          Length = 400

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 194/403 (48%), Gaps = 36/403 (8%)

Query: 4   DLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           DL+ PL +   P+R+  +   + +   FLL    +V L  ++  +H  +G   E +   V
Sbjct: 7   DLSMPLGQNSAPRRRLRFPFTLPQAAGFLLGSILVVFLG-FVFFNHDPLG--GEPVARVV 63

Query: 63  IREIAPIPLTIPLNIEDKQS--PSKRDNNTVCNQLKNDSSQHDGQIQNDISGK---TVVN 117
           IR         P++ E   +  P+ +  ++     ++ + Q    I +  SG     VV 
Sbjct: 64  IRHT-------PVSDEKSAATRPASQQPDSAAVATRSATGQKTITIIDGSSGSRQDVVVA 116

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD--KNFCSNASGAR--- 172
            P      D+     E    G+ ++ LL K++ G     V A D  K F + A G     
Sbjct: 117 GPDS----DAADARSEAAATGIHQR-LLEKSRYGM--IPVVAADGLKAFKAYAMGTEADR 169

Query: 173 --------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                   +AIVVSGLGI  T T  AI  LP+ +TLAF    +   + +++A+ +  E +
Sbjct: 170 AKAATMPVVAIVVSGLGIGTTKTIDAIMKLPSAVTLAFTPYSSDPGKLVEQARAQHHEVL 229

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+PM+  D   N+    TL  T    Q ++RL + L R  GY G+ N+ GA  ++   +
Sbjct: 230 LQLPMEPHDYPDNDPGPQTLLTTLGTDQNIDRLHWQLSRFQGYVGLTNFMGARFVTAVAA 289

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + I +E AKRGL + DDG++P ++   LA    +P++ ADL +D      +I + L  L
Sbjct: 290 MQPIIREAAKRGLGYLDDGTAPTSVAGQLAKGQAMPFIKADLTIDAVPTSVEIDKTLARL 349

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           EE+A+  G A+G+  A   SI+ +  W++    R V +VPL+ 
Sbjct: 350 EELAKGRGTAVGMTSALPVSIDRVGAWIKGLESRGVMLVPLTT 392


>gi|299135455|ref|ZP_07028645.1| protein of unknown function DUF610 YibQ [Afipia sp. 1NLS2]
 gi|298589863|gb|EFI50068.1| protein of unknown function DUF610 YibQ [Afipia sp. 1NLS2]
          Length = 392

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 118/215 (54%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           I+IV+ GLG+    T  AI  LPA +TLAF   G+   + ++ A+ +  E +LQ+PM+ +
Sbjct: 170 ISIVIGGLGVGAAKTNDAIVKLPAAVTLAFTPYGSDPGKLVERARARKHEVLLQLPMEPY 229

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T   +Q ++RL + + R  GY G+ N+ G+  L    + + I ++ 
Sbjct: 230 DYPDNDPGPQTLLATAGPEQNVDRLMWLMSRFQGYVGLTNFMGSRFLVTDSAMQPIIQQA 289

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL + DDGS PR+L   LA    +P   AD  LD      +I + L  LE +AR  G
Sbjct: 290 AKRGLAWLDDGSVPRSLAGQLAGAQGVPTATADAVLDQVPTAAEIDKSLMKLETLARERG 349

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            A+G+A A   SIE I  W Q+   R + +VPL+ 
Sbjct: 350 SAVGMASALPISIERIGAWAQRLESRGILLVPLTT 384


>gi|328545770|ref|YP_004305879.1| Divergent polysaccharide deacetylase family [polymorphum gilvum
           SL003B-26A1]
 gi|326415510|gb|ADZ72573.1| Divergent polysaccharide deacetylase family [Polymorphum gilvum
           SL003B-26A1]
          Length = 375

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 131/220 (59%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
            S  +IAIV+ G+G+S+ G++ A++ LPA++TLA A  GN ++ WM+EA++ G E +LQ+
Sbjct: 149 GSTPKIAIVIGGIGLSEAGSRNALDSLPADVTLALAPYGNEIEGWMQEARQAGHELLLQL 208

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           P++ FD   N+   +TL V+    + ++RL + L R T Y GV+N+ GA   S + S + 
Sbjct: 209 PLEPFDFPDNDPGPHTLLVSLRGAEFMDRLTWLLSRTTNYVGVVNFMGARFSSTEASMQY 268

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +E  +RGL++ DDGSS R++ + +A     P+   D+ LD     D+I  +L  LE +
Sbjct: 269 LLEEVTRRGLMYVDDGSSSRSVAQPVASAAQTPFSKVDVVLDAVPKPDEINARLLQLEAL 328

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           AR  G A+    A   ++  ++ W +    R + +VP+S 
Sbjct: 329 ARARGIAVAAGSALPVTVRQLADWSRDLEQRGLMLVPISA 368


>gi|188581495|ref|YP_001924940.1| hypothetical protein Mpop_2243 [Methylobacterium populi BJ001]
 gi|179344993|gb|ACB80405.1| protein of unknown function DUF610 YibQ [Methylobacterium populi
           BJ001]
          Length = 399

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 129/232 (55%), Gaps = 7/232 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           +G RIA++VSGLGI +  T  AI  LPA ++LA +  G+ L++    A++ G E +LQ+P
Sbjct: 165 TGPRIAVLVSGLGIGENATLGAIARLPAAVSLALSPYGSDLEKTAARAREAGHEVLLQLP 224

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   ++    TL  +    + L+R  +++ R  G+ G +N+ GA L+S+  + E +
Sbjct: 225 MEPFDYPDSDPGPQTLLASSRPGENLDRTAWAMSRFPGFVGAVNFMGAKLMSDPTALEPV 284

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            K+ A RGL F DDG++  +    +A K  LP   AD+ +D     D I  +L  LE +A
Sbjct: 285 LKDLAARGLGFVDDGAASASQVAGVAAKTKLPTARADIVVDAVARPDAIDAELARLETLA 344

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC-------LAKLSS 393
           R  G  +  A A   SI+ +S+W +    R + +VP+S        +AKLSS
Sbjct: 345 RRNGLVLASASASPLSIDRLSRWSRDLEARGIRLVPVSAVLRRPGGVAKLSS 396


>gi|218530515|ref|YP_002421331.1| hypothetical protein Mchl_2561 [Methylobacterium chloromethanicum
           CM4]
 gi|218522818|gb|ACK83403.1| protein of unknown function DUF610 YibQ [Methylobacterium
           chloromethanicum CM4]
          Length = 401

 Score =  139 bits (351), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 123/220 (55%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           +G RIA++VSGLGI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+P
Sbjct: 167 TGPRIAVLVSGLGIGEMATLGAIARLPAAVSLALSPYGTDLEKTAARAREAGHEILLQLP 226

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   ++    TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E +
Sbjct: 227 MEPFDYPDSDPGPQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPV 286

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            K+ + RGL F DDG++P      +A K  LP + A++ +D     D I  +L  LE +A
Sbjct: 287 LKDLSARGLGFVDDGAAPGTQVATVAAKTKLPSVRAEIVIDAVARPDAIDAELARLETLA 346

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G  +  + A   +IE +S+W +    R + +VP+S +
Sbjct: 347 RQKGLVLASSSASPLTIERLSRWSRDLEARGIRLVPVSAI 386


>gi|254470624|ref|ZP_05084027.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211959766|gb|EEA94963.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 387

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 121/217 (55%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           ARIAI+++G+G++   T +AI  LPA+I+L  +  G+ ++ WM+ A+  G E +LQ PM+
Sbjct: 165 ARIAILINGIGLNSDMTIKAIEDLPADISLGLSPYGDDVNSWMESARLSGHEVLLQAPME 224

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            FD   N+    +L      +Q   RL + L + + Y G++N+ G    SN+        
Sbjct: 225 PFDYPDNDAGPQSLLTNLDQKQNDERLSWVLGQTSNYVGLVNFMGDRFTSNETRMSEFLS 284

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           +   RGL++ DDGSSPR+    +A    +P++ ADL LD  +  + I  +L  LE IAR 
Sbjct: 285 KVRDRGLMYVDDGSSPRSKAGQVAGTQKVPFVQADLVLDQNLSAEAIGTQLLELETIARQ 344

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            G A+  A AF  ++  +  W Q+   R +S+VP+S 
Sbjct: 345 RGIAVATATAFPVTLNALEAWSQRLEERGLSLVPVSS 381


>gi|163851709|ref|YP_001639752.1| protein of unknown function DUF610 YibQ [Methylobacterium
           extorquens PA1]
 gi|163663314|gb|ABY30681.1| protein of unknown function DUF610 YibQ [Methylobacterium
           extorquens PA1]
          Length = 418

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 122/220 (55%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           +G RIA++VSGLGI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+P
Sbjct: 184 TGPRIAVLVSGLGIGEMATLGAIARLPAAVSLALSPYGTDLEKTATRAREAGHEILLQLP 243

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   ++    TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E +
Sbjct: 244 MEPFDYPDSDPGPQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPV 303

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            K+ + RGL F DDG++P      +A K  LP   A++ +D     D I  +L  LE +A
Sbjct: 304 LKDLSARGLGFVDDGAAPGTQVATVAAKTKLPSARAEIVIDAVARPDAIDAELARLETLA 363

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G  +  + A   +IE +S+W +    R + +VP+S +
Sbjct: 364 RQKGLVLASSSASPLTIERLSRWSRDLEARGIRLVPVSAI 403


>gi|240138873|ref|YP_002963348.1| hypothetical protein MexAM1_META1p2287 [Methylobacterium extorquens
           AM1]
 gi|240008845|gb|ACS40071.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 409

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 122/220 (55%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           +G RIA++VSGLGI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+P
Sbjct: 175 TGPRIAVLVSGLGIGEMATLGAIARLPAAVSLALSPYGTDLEKTATRAREAGHEILLQLP 234

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   ++    TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E +
Sbjct: 235 MEPFDYPDSDPGPQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPV 294

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            K+ + RGL F DDG++P      +A K  LP   A++ +D     D I  +L  LE +A
Sbjct: 295 LKDLSARGLGFVDDGAAPGTQVATVAAKTKLPSARAEIVIDAVARPDAIDAELARLETLA 354

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G  +  + A   +IE +S+W +    R + +VP+S +
Sbjct: 355 RQKGLVLASSSASPLTIERLSRWSRDLEARGIRLVPVSAI 394


>gi|254561481|ref|YP_003068576.1| hypothetical protein METDI3068 [Methylobacterium extorquens DM4]
 gi|254268759|emb|CAX24720.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 409

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/220 (33%), Positives = 122/220 (55%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           +G RIA++VSGLGI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+P
Sbjct: 175 TGPRIAVLVSGLGIGEMATLGAIARLPAAVSLALSPYGTDLEKTAARAREAGHEILLQLP 234

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   ++    TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E +
Sbjct: 235 MEPFDYPDSDPGPQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPV 294

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            K+ + RGL F DDG++P      +A K  LP   A++ +D     D I  +L  LE +A
Sbjct: 295 LKDLSARGLGFVDDGAAPGTQVATVAAKSKLPSARAEIVIDAVARPDAIDAELARLETLA 354

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G  +  + A   +IE +S+W +    R + +VP+S +
Sbjct: 355 RQKGLVLASSSASPLTIERLSRWSRDLEARGIRLVPVSAI 394


>gi|170742352|ref|YP_001771007.1| hypothetical protein M446_4224 [Methylobacterium sp. 4-46]
 gi|168196626|gb|ACA18573.1| protein of unknown function DUF610 YibQ [Methylobacterium sp. 4-46]
          Length = 396

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 121/231 (52%), Gaps = 3/231 (1%)

Query: 156 EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
           E PA+       A   RIA+VV+GLGI    TQ A+  LP  +TLAFA  G  + R    
Sbjct: 162 EAPALPSG---AAPAGRIALVVTGLGIGAAVTQDAVTRLPPAVTLAFAPYGADVGRQAAR 218

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A++ G E ++Q PM+ FD   N+    TL       +  +RL + L R  G  GV+NY G
Sbjct: 219 AREAGHEVMVQAPMEPFDYPDNDPGPQTLLAGAKPAENADRLGFVLSRIPGAIGVVNYMG 278

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           A L +   + + I +E   RGL F DDG+SPR+L   +  +   P   AD+ +D     D
Sbjct: 279 ARLTAEAGALDPILREIGARGLGFVDDGTSPRSLALDIGRRARAPVARADVVVDAAPLPD 338

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
            +  +L  LEE AR  G A+G A+A   +I+ I++W +    R + +VP S
Sbjct: 339 AVDRELARLEETARRKGFAMGSAMALPLTIDRIARWSRDLEARGILLVPAS 389


>gi|75674648|ref|YP_317069.1| hypothetical protein Nwi_0450 [Nitrobacter winogradskyi Nb-255]
 gi|74419518|gb|ABA03717.1| Protein of unknown function [Nitrobacter winogradskyi Nb-255]
          Length = 400

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 118/401 (29%), Positives = 189/401 (47%), Gaps = 32/401 (7%)

Query: 4   DLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           DL+ PL +   P+R+      + +    LL    +V L  ++  +H  +G   E      
Sbjct: 7   DLSTPLGQNPAPRRRLRLPFSLPQATGLLLGSILVVFLG-FVFFNHDPLG--GEPKARVA 63

Query: 63  IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK---TVVNKP 119
           IR+ AP+    P  I  +  P + D+  V     N   Q    I +  SG     VV+ P
Sbjct: 64  IRQ-APVSDDKPTAI--RPPPQQPDSAAVTAPSAN--GQKTITIIDGSSGSRQDVVVSGP 118

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD--KNFCSNASGAR----- 172
                 D+      + ++G+ ++ LL K++ G     V A D  K F + A+G       
Sbjct: 119 ----GPDAADAGSAKAVVGVDQR-LLEKSRHGM--IPVAAADGLKPFKAYAAGTEADRAK 171

Query: 173 ------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                 +AIVV GLG+  T T  AI  LP  +TLAF   G+   R + +A+ +  E +LQ
Sbjct: 172 AAKMPVVAIVVGGLGVGATKTTDAIMKLPPAVTLAFTPYGSDPGRLVAQARAQRHEVLLQ 231

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+ +D   N+    TL  T   +Q ++RL + L R  GY G+ N+ GA  ++     +
Sbjct: 232 VPMEPYDYPDNDPGPQTLLTTLGAEQNIDRLHWQLSRFQGYVGLTNFMGARFVAAAAVMQ 291

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
               E A+RGL + DDG++P ++   LA    +P+  ADL +D      +I + L  LE+
Sbjct: 292 PFMHEAARRGLGYLDDGAAPLSVAGRLAEGQAMPFARADLIVDAVPTSVEIDKALARLED 351

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           +A   G AIG+  A   S++ I  W++    R V +VPL+ 
Sbjct: 352 LAMKRGVAIGMTSALPVSVDRIGVWIKSLESRGVMLVPLTT 392


>gi|114799786|ref|YP_761883.1| hypothetical protein HNE_3208 [Hyphomonas neptunium ATCC 15444]
 gi|114739960|gb|ABI78085.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 429

 Score =  136 bits (342), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 131/249 (52%), Gaps = 2/249 (0%)

Query: 148 NKVGREDTEVPA--MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASN 205
            +V +  ++ PA    + F ++     +++V+ GLGI+ T T+ AI+ LPA++TL+FA +
Sbjct: 156 EQVSKPASKAPADIYARPFSNSGGQPVVSLVIGGLGINSTQTKLAIDALPADVTLSFAPD 215

Query: 206 GNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGT 265
              LD W+K A++ G E ++++PM+AF+         TL      +  L +L   L R +
Sbjct: 216 AKRLDYWIKTAREDGHEVLIEVPMEAFEYGRMRMHPDTLIAGGDQKANLAKLNQVLSRAS 275

Query: 266 GYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
           GY+GV+NY+GA   ++  S   IF   A+RGL F DDGS  +     +A    L +  A 
Sbjct: 276 GYYGVINYQGAKFGADAGSIAPIFDVLAERGLAFVDDGSVHKAFFGQVADTKGLRFARAA 335

Query: 326 LYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
             +D +     I  +   LE IAR  G AIG   AF  +IE  S W+     + + + P+
Sbjct: 336 GPIDTRQSPQDIAAEFMELETIARQHGGAIGAGFAFPVTIEAASLWIDTLEEKGLVLAPV 395

Query: 386 SCLAKLSSP 394
           S L   ++P
Sbjct: 396 SFLVPDAAP 404


>gi|146337569|ref|YP_001202617.1| hypothetical protein BRADO0424 [Bradyrhizobium sp. ORS278]
 gi|146190375|emb|CAL74371.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 405

 Score =  133 bits (334), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 116/215 (53%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+ GLGI    T  AI  LP  +TLAF   G+   +  + A+ +  E +LQ+PM+ +
Sbjct: 183 VAIVIGGLGIGAAKTVDAIMKLPPAVTLAFTPYGSDPSKLAERARAQRHEILLQVPMEPY 242

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T    Q ++RL + + R  GY G+ N+ GA  ++ + + + I  E 
Sbjct: 243 DYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIGNFMGARFVATETAMQPIVNEA 302

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL  FDDG++PR++   LA    +P+   D+ +D      +I   L  LE +A+  G
Sbjct: 303 AKRGLALFDDGAAPRSVAASLATGRAVPFAKGDVAIDAVPTAVEIDNALAKLESLAKERG 362

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            A+G A A   SI+ I  W++    + + +VPL+ 
Sbjct: 363 VAVGTASALPVSIDRIGTWIKGLDRKGILLVPLTT 397


>gi|197103709|ref|YP_002129086.1| hypothetical protein PHZ_c0243 [Phenylobacterium zucineum HLK1]
 gi|196477129|gb|ACG76657.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 379

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 119/238 (50%), Gaps = 10/238 (4%)

Query: 151 GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
           GR   EV A  + F SN    +I +VV GLG++   T++AI  L   ITL+F      L 
Sbjct: 148 GRTPAEVYA--RPFTSNGR-PKIGLVVGGLGLNARATRQAIETLRPEITLSFVVYAEGLQ 204

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
            W+  A+  G E +L+ P++  D   N+   YTL    +  +   +L + L R +GYFG+
Sbjct: 205 GWIDMARAHGHEVLLETPLEPLDYPDNDPGPYTLMTDASPPETAKKLEWILSRASGYFGL 264

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            NY G+  L++  + E +      RGL F DDG++ R          N+P   A+  +DD
Sbjct: 265 TNYLGSRFLADDRAYEALAASLRARGLAFVDDGTAARR-------GGNVPRATAERVIDD 317

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           Q+    I ++L  LE  A   GQA+G   A+  ++E +++W  +   R   + P S L
Sbjct: 318 QLSAGAIDQQLLALEAGALQRGQALGSGFAYPVTLETVARWANEVEQRGYQLAPASAL 375


>gi|148252020|ref|YP_001236605.1| hypothetical protein BBta_0413 [Bradyrhizobium sp. BTAi1]
 gi|146404193|gb|ABQ32699.1| hypothetical protein BBta_0413 [Bradyrhizobium sp. BTAi1]
          Length = 407

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 115/215 (53%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+ GLG+    T  AI  LP  +TLAF   G    +  + A+ +  E +LQ+PM+ +
Sbjct: 185 VAIVIGGLGVGAAKTVEAIMKLPPAVTLAFTPYGADPTKLAERARAQRHEILLQVPMEPY 244

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T    Q ++RL + + R  GY G+ N+ GA  ++ + + + I  E 
Sbjct: 245 DYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIGNFMGARFVATEAAMQPIVNEA 304

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL  FDDG++PR++   LA    +P+   D+ +D      +I   L  LE +A+  G
Sbjct: 305 AKRGLALFDDGAAPRSVAASLAAGRAMPFAKGDVAIDAVPTPVEIDNALAKLESLAKERG 364

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            AIG A A   SI+ I  W++    + + +VPL+ 
Sbjct: 365 IAIGTASALPVSIDRIGAWIKGLDRKGILLVPLTT 399


>gi|83944752|ref|ZP_00957118.1| hypothetical protein OA2633_08994 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851534|gb|EAP89389.1| hypothetical protein OA2633_08994 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 405

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 124/238 (52%), Gaps = 4/238 (1%)

Query: 161 DKNFCSNASGAR----IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           D+ +  +  GA     ++++V GLG+SQ+ T+RAI +LPA +TL+FA   ++L  W+  A
Sbjct: 135 DQAYAHDFPGAENVPTVSVIVGGLGLSQSLTERAIEVLPAEVTLSFAPYADNLQDWINRA 194

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
           +  G E +L++PM+ FD   N+   +TL V  + Q+   RL + L R  GY GV NY GA
Sbjct: 195 RADGHEVLLELPMEPFDYPNNDPGPHTLLVDASSQENTRRLVWLLSRAAGYTGVANYLGA 254

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            L + +     IF E   RGL  F DG+  R +      + +    +AD  +D       
Sbjct: 255 RLGAAEGPLSEIFSELEARGLSIFHDGAGRRAVLEQAGRQAHARMTIADRVVDSDPTPRA 314

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           I  +L  LE +A   G A+G   A+  +++ I+ W +    R   + P S + ++ SP
Sbjct: 315 IDGRLLELEALALQNGSALGSGFAYPATVDTIAAWAEGLDGRGYQLAPASFVMQIRSP 372


>gi|254292534|ref|YP_003058557.1| hypothetical protein Hbal_0158 [Hirschia baltica ATCC 49814]
 gi|254041065|gb|ACT57860.1| protein of unknown function DUF610 YibQ [Hirschia baltica ATCC
           49814]
          Length = 416

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 139/272 (51%), Gaps = 7/272 (2%)

Query: 129 PTIEERLILGLSKKELLAKN-KVGR-----EDTEVPAMDKNFCSNASG-ARIAIVVSGLG 181
           P  EER  L  +  + L +N  VGR     +D   PA         +G  ++A++V GLG
Sbjct: 133 PVSEERKALVRAPIQGLYENGAVGRLPKIADDGRRPADIYARPHTPNGKPQVALIVGGLG 192

Query: 182 ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDS 241
           I ++ T +AIN LP  +TL+F    + L  W+  A+  G E +L++PM+ +D    +   
Sbjct: 193 IKRSLTMQAINDLPPEVTLSFVPYSSDLQTWVNRARDAGHEVLLEVPMEPYDYPNVDTGP 252

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
            TL  T + Q+   RL+  L + TGYFGV+NY+GA L +       I +E   RGL    
Sbjct: 253 DTLLTTLSAQENERRLKVILGQTTGYFGVINYQGARLATESRVLSPIMREIHNRGLAMIY 312

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF 361
           DG++ R++   +A ++N+ ++ AD  +D     D I + L  +E +A     A+GV  AF
Sbjct: 313 DGAANRSVFPSVAKEINMNFVEADRIVDTVPSADAIDKNLLHIEALALQNKAALGVGFAF 372

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             +++   QW     ++   +VP S L  + +
Sbjct: 373 PVTVDQFKQWSDTLDMKGYELVPASVLTGIQT 404


>gi|329847637|ref|ZP_08262665.1| divergent polysaccharide deacetylase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328842700|gb|EGF92269.1| divergent polysaccharide deacetylase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 405

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 110/216 (50%), Gaps = 7/216 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A++V GLG++ T T++AI+ LP  +TL+F      L  W+  A+  G E I+++PMQ  
Sbjct: 194 VALIVGGLGLNPTATRQAIDQLPPEVTLSFVPYTQGLQGWIDLARASGHEVIVEVPMQPT 253

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           +    +    TL       +L N+L +SL R TG+F V NY+G+  L +K  A+      
Sbjct: 254 NYPDTDPGPQTLMANAKSDELQNKLAWSLSRATGFFAVSNYQGSAFLKDKAGAQTFMSVL 313

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
             RG+ F DDG + R L    +         AD  +D Q++   I+ +L GLE  A+  G
Sbjct: 314 KSRGVAFIDDGQA-RGLQGAWS------RASADRVIDSQINAQAIQAQLIGLETTAKNRG 366

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+G    +  ++ V  +W Q    + + + P S L
Sbjct: 367 SALGTGFGYPVTLAVALRWTQSLEAKGIQLAPASAL 402


>gi|295687690|ref|YP_003591383.1| hypothetical protein Cseg_0245 [Caulobacter segnis ATCC 21756]
 gi|295429593|gb|ADG08765.1| protein of unknown function DUF610 YibQ [Caulobacter segnis ATCC
           21756]
          Length = 393

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 113/236 (47%), Gaps = 8/236 (3%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
           T   A  + F  N    ++++V+ GLG++   T+ AI  LPA ITL+FA     L  W+ 
Sbjct: 165 TAADAYARPFTPNGR-PKVSVVIGGLGLNAQTTRAAIETLPAEITLSFAPYAEGLQGWID 223

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
            A++ G E +L+ PM+  D   N+   YTL      +  + +L + + R TGYFG+ NY 
Sbjct: 224 LAREHGHEVLLETPMEPADYPANDPGPYTLIAANRPEDTVRKLEWLMSRATGYFGLANYL 283

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           GA  + N ++          RGL F DDG + R    +       P   AD  +DD++  
Sbjct: 284 GARFVDNDQAMATFNTVLKTRGLAFIDDGLAARRSGPI-------PRASADRVIDDELSA 336

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             I  +L+ LE  A   GQ++G   A+  +I  +  W      R + + P S LA 
Sbjct: 337 SAIDAQLRALENGASARGQSLGSGFAYPVTINQVRLWAAGLQARGLQLAPASALAH 392


>gi|16127669|ref|NP_422233.1| hypothetical protein CC_3439 [Caulobacter crescentus CB15]
 gi|221236488|ref|YP_002518925.1| hypothetical protein CCNA_03552 [Caulobacter crescentus NA1000]
 gi|13425155|gb|AAK25401.1| hypothetical protein CC_3439 [Caulobacter crescentus CB15]
 gi|220965661|gb|ACL97017.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 394

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 112/240 (46%), Gaps = 10/240 (4%)

Query: 151 GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
           GR   E  A  + F  N    +++IV+ GLG++   T+ AI  LP  +TL+FA     L 
Sbjct: 164 GRTAAE--AYARPFTPNGR-PKVSIVIGGLGLNAQTTRAAIETLPGEVTLSFAPYAEGLQ 220

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
            W+  A+  G E +L+ PM+  D   N+   YTL         + +L + + R TGYFG+
Sbjct: 221 GWIDLARAHGHEVLLETPMEPADYPANDPGPYTLIAANRPDDTVRKLEWLMSRATGYFGL 280

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            NY GA  + N ++          RGL F DDG + R    +       P   AD  +DD
Sbjct: 281 SNYLGARFVDNDQAMNTFNATLKARGLAFIDDGLAARRAGPI-------PRASADRVIDD 333

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           ++    I  +L+ LE  A   GQ++G   A+  +I  +  W      R + + P S LA 
Sbjct: 334 ELSASAIDAQLRALETGAAARGQSLGSGFAYPVTINQVRAWAAGLQARGIQLAPASALAH 393


>gi|288959172|ref|YP_003449513.1| hypothetical protein AZL_023310 [Azospirillum sp. B510]
 gi|288911480|dbj|BAI72969.1| hypothetical protein AZL_023310 [Azospirillum sp. B510]
          Length = 391

 Score =  129 bits (324), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 122/241 (50%), Gaps = 2/241 (0%)

Query: 151 GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
           GR+  +V A  + F +     R+AIV+S LG+S   T  A+  LP  ITLAF      LD
Sbjct: 151 GRKPWQVYA--RPFPATDKRPRVAIVMSDLGLSGVTTGNALAKLPPGITLAFLPYAERLD 208

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
            W++ A+ KG E +L +PM+      ++     L       + + RL +SL +  GY GV
Sbjct: 209 DWVERARTKGHEVMLSLPMEPLTYPRDDPGPNALLTMLGPDRNIERLEWSLGKAVGYVGV 268

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +  G    +N  + + +      RGLL  D   +P+++   LA    +P  + D  +D 
Sbjct: 269 TSTTGGKFTANPTAMQPVIDALKARGLLLVDSRVNPKSVAGPLAMLAGVPRALGDRVIDR 328

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            + R  I ++L+ LEE+ART G A+G A  +  +IE ++ WL     R +++ P+S +  
Sbjct: 329 DLSRGAIDDQLRELEELARTNGAAVGFASPYPTTIERLNLWLTALADRGIALAPVSAVVN 388

Query: 391 L 391
           +
Sbjct: 389 I 389


>gi|315497340|ref|YP_004086144.1| hypothetical protein Astex_0295 [Asticcacaulis excentricus CB 48]
 gi|315415352|gb|ADU11993.1| protein of unknown function DUF610 YibQ [Asticcacaulis excentricus
           CB 48]
          Length = 410

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 121/243 (49%), Gaps = 18/243 (7%)

Query: 154 DTEVPA--MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
           D  VPA    + F SN     ++++V GLG++ T T+ AI  LPA +TL+F  +   L  
Sbjct: 179 DGRVPASAYARPFKSNGK-PMVSLIVGGLGLNPTTTKAAIEQLPAEVTLSFVPHAEGLQG 237

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
           W+  A+ +G E +++IPM+  +    +    TL V Q    +   L + + R TGYFGVM
Sbjct: 238 WIDAARAQGHEVLIEIPMEPTNYPDTDPGPRTLLVGQRPDDMNASLNWLMARATGYFGVM 297

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL----TRVLAPKLNLPYMVADLY 327
           NY+G+  L +K S          RGL F DDG + R++    TR            AD  
Sbjct: 298 NYQGSAYLRDKGSMTAFLNVMKARGLAFIDDGQA-RDVGGGWTRA----------SADRV 346

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           +D Q++   I  +L  +E  A+  G+A+G   A+  ++ V  +W Q    + + + P S 
Sbjct: 347 IDAQINSQSINAQLAAIEAQAKARGRALGSGFAYPVTLAVAIKWTQSLEQKGLQLAPASA 406

Query: 388 LAK 390
           + +
Sbjct: 407 IMR 409


>gi|167648681|ref|YP_001686344.1| hypothetical protein Caul_4726 [Caulobacter sp. K31]
 gi|167351111|gb|ABZ73846.1| protein of unknown function DUF610 YibQ [Caulobacter sp. K31]
          Length = 395

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 114/240 (47%), Gaps = 10/240 (4%)

Query: 151 GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
           GR   E  A  + F ++    ++A+V+ GLG++   T+ AI  LP  ITL+FA     L 
Sbjct: 165 GRTAAE--AYARPFTADGR-PKVALVIGGLGLNPQTTRAAIETLPPEITLSFAPYAEGLQ 221

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
            W+  A+  G E +L+ PM+  D   N+   YTL      +  + +L + + R TGYFG+
Sbjct: 222 GWIDLARSHGHEVLLEAPMEPVDYPANDPGPYTLITANRPEDTVRKLEWLMSRATGYFGL 281

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            NY G+  +++  +          RGL F DDG +      +       P   AD  +DD
Sbjct: 282 TNYLGSRFVTSDTAMTTFTLALKSRGLAFIDDGQASLRGGPI-------PRASADRIIDD 334

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           ++    I  +LK LE  A   GQA+G   A+  +I  +  W      R + + P S +AK
Sbjct: 335 ELAAGSIDGQLKMLETGAAGRGQALGSGFAYPVTITQVRLWAAGLSGRGLQLAPASAMAK 394


>gi|218658574|ref|ZP_03514504.1| hypothetical protein RetlI_02356 [Rhizobium etli IE4771]
          Length = 170

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/116 (51%), Positives = 79/116 (68%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G RIAIVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E +L
Sbjct: 34  SGARGIRIAIVVSGLGLSQTGTQRAITELPEEITLAFAASGNSLQRWMQEARRGGHEILL 93

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           Q+P++ FD   N+    TL  ++ V + +  L  ++   T Y G+MNY G   LS+
Sbjct: 94  QVPLEPFDYPANDPGPETLLTSKPVARNIENLHKAMGEITNYTGIMNYLGGRFLSD 149


>gi|296445175|ref|ZP_06887135.1| protein of unknown function DUF610 YibQ [Methylosinus trichosporium
           OB3b]
 gi|296257349|gb|EFH04416.1| protein of unknown function DUF610 YibQ [Methylosinus trichosporium
           OB3b]
          Length = 402

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/222 (35%), Positives = 119/222 (53%), Gaps = 3/222 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   RIA+VV G+G++   + RAI+ LPA +TLA A  G +++     A+ +G E +L  
Sbjct: 170 AGAPRIALVVGGVGLNARLSDRAIDELPAAVTLALAPYGAAVEATAARARARGHEILLHA 229

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+ +D        +TL+        L  L + + R TGY GV+N+ GA   +   +   
Sbjct: 230 PMEPYDFPVENPGPHTLRAGSDA---LGDLHWLMSRFTGYVGVVNFLGARFTAEAGALRP 286

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  + A RGLL+ DDG+SPR+L   LA  L L    AD  +D +    +I  +L  LE +
Sbjct: 287 VLADIAARGLLYIDDGASPRSLAPSLASGLGLASARADAAIDARAKPQEIDAQLTQLEAL 346

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           AR  GQAI VA A    I  +S + +    R +++VP+S LA
Sbjct: 347 ARRNGQAIAVAEALPGVIARLSHFARDLERRGIALVPVSALA 388


>gi|254420794|ref|ZP_05034518.1| Divergent polysaccharide deacetylase family [Brevundimonas sp.
           BAL3]
 gi|196186971|gb|EDX81947.1| Divergent polysaccharide deacetylase family [Brevundimonas sp.
           BAL3]
          Length = 396

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/282 (27%), Positives = 125/282 (44%), Gaps = 16/282 (5%)

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD--KNFCSNAS 169
           G TV    + S  + +   + +  I GLS+        +   D  VPA    + F SN  
Sbjct: 120 GATVAGGASYSAPVQAASPLAKAPIAGLSQPGASGPLPMIAPDGRVPAQAYARPFRSNGK 179

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             R+A++V GLG++   T+ AI  LP  +TL+F    ++L  W+ +A+ +G E +L++PM
Sbjct: 180 -PRVALIVGGLGLNAVTTRAAIERLPPEVTLSFVPYADNLQSWIDQARAQGHEVMLEMPM 238

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +      N+   YTL  + T   +  ++ + L R  GYFGV NY G    ++        
Sbjct: 239 EPTGYPDNDPGPYTLLASGTPDDVQAKMDWLLGRAVGYFGVTNYLGDRFATSDTGMSAFL 298

Query: 290 KEFAKRGLLFFDDGS---SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
               +RG+ F DDGS    P    R            AD  +D       I   L  LE 
Sbjct: 299 STLRQRGIAFLDDGSFQRRPGAWARA----------SADKVIDQTQSPAAIIAALNSLEA 348

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+  G A+G   ++  ++E  ++W      R + + P S +
Sbjct: 349 QAKLRGSALGTGFSYPVTVEAAARWTAGLEQRGLQLAPASAM 390


>gi|144898156|emb|CAM75020.1| Protein of unknown function DUF610 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 222

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 119/218 (54%), Gaps = 2/218 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IA+V+  LG+ +  ++R +  LPA +TLA+ +  ++L    + A+++G E ++ +PMQ  
Sbjct: 2   IAVVIDDLGVDRKRSER-VTTLPAPLTLAWMTYADNLRPITQAARQRGHELMVHVPMQPQ 60

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
            ESY+      L+V    ++L  RLR+ L R  G+ G+ N+ G+   +++    V+  E 
Sbjct: 61  SESYDPGPD-VLEVGLPTEELRRRLRWGLSRFDGFVGINNHMGSRFTADRAGMNVVMDEI 119

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
             RGLLF D  ++ +++   LA +  +P+    ++LD+++    +R +L   E  AR  G
Sbjct: 120 RARGLLFLDSVTTQKSVAPDLARQYGVPFAARHVFLDNEMTVSAVRGQLAKTEAYARKYG 179

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AI +    D +IE ++ WL     +   +VP++ + K
Sbjct: 180 AAIAIGHPHDGTIEALAGWLPGLEAKGFVLVPVTTIVK 217


>gi|163792328|ref|ZP_02186305.1| hypothetical protein BAL199_15813 [alpha proteobacterium BAL199]
 gi|159182033|gb|EDP66542.1| hypothetical protein BAL199_15813 [alpha proteobacterium BAL199]
          Length = 418

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 118/228 (51%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
           + F  + S  R+AIV+ G+G  +  T++A  LLP  I+L+F+    +++  M  A++ G 
Sbjct: 185 RPFNLDDSRPRVAIVMIGVGFGKDITEKATTLLPGAISLSFSPYVRNIEALMARARQAGH 244

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E ++ +PM+  D   ++    TL  + ++   LNRL + L R  GY GV  + G+   + 
Sbjct: 245 ETLIDLPMEPLDFPRDDPGPSTLLTSLSLVDNLNRLEWVLGRAPGYVGVTTWMGSQFTTV 304

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           +++   + +   +RGL+F D  +S R++   LA  + LP    + ++D       I   L
Sbjct: 305 EDALMPVLQGLRQRGLMFVDSRASSRSIATELASSIQLPRAFNNTFIDQTPSAGTIDRAL 364

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             LE  AR    A+G+A     +IE +S+W      + +++ P+S +A
Sbjct: 365 ASLEATARQQRYAVGIARPLPVTIERLSRWAGTLEGKGIALAPISAIA 412


>gi|302381253|ref|YP_003817076.1| hypothetical protein Bresu_0138 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302191881|gb|ADK99452.1| protein of unknown function DUF610 YibQ [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 399

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 117/260 (45%), Gaps = 16/260 (6%)

Query: 136 ILGLSKKELLAKNKVGREDTEVPAMD--KNFCSNASGARIAIVVSGLGISQTGTQRAINL 193
           I GLS+        V   D  VPA    + F  N     +A++V GLG++   T+ AI  
Sbjct: 147 IAGLSQPGPQGFLPVIASDGRVPAQAYARPFRPNGK-PTVALIVGGLGLNAVTTRAAIER 205

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LPA++TL+F      L  W+  A+ +G E +++IPM+       +   YTL    T   +
Sbjct: 206 LPADVTLSFVPYAEGLQGWINLARAQGHEVMIEIPMEPTGYPNTDPGPYTLLNNATPDDV 265

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS---PRNLT 310
             ++ + L R TGYFGV NY G   +++            +RG+ F DDGS+   P    
Sbjct: 266 QAKMAWLLGRATGYFGVTNYLGDRFVTSDTGMSAFLGILRQRGIAFLDDGSARRRPGAWA 325

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           R            AD  +D+      I   L  LE  A++ G A+G   A+  ++E  ++
Sbjct: 326 RA----------SADSIIDETQTPAAIIGALNMLEATAKSRGAALGTGFAYPVTVEAAAR 375

Query: 371 WLQQEHVRDVSVVPLSCLAK 390
           W      R + + P S + +
Sbjct: 376 WTAGLDARGLQLAPASAMTQ 395


>gi|163795616|ref|ZP_02189582.1| hypothetical protein BAL199_26487 [alpha proteobacterium BAL199]
 gi|159179215|gb|EDP63748.1| hypothetical protein BAL199_26487 [alpha proteobacterium BAL199]
          Length = 264

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 124/239 (51%), Gaps = 7/239 (2%)

Query: 154 DTEVPAMDKNFCSNASGAR----IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSL 209
           D  VPA  + F + A  A     IAIV+  LGI +  + RAI+L PA +TLAF +  N L
Sbjct: 14  DGIVPAW-RRFAAVAEPANGRPMIAIVLDDLGIDKRRSGRAIDL-PAPLTLAFLAYANEL 71

Query: 210 DRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
                 A+ +G E ++ +PMQ      +   +  L +   ++++  R+ +SL++  G+ G
Sbjct: 72  PEQTGRARSRGHELLVHLPMQPHGHDADPGPN-VLDMELGLEEVARRVDWSLKQFDGFVG 130

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           V N+ G++   N +   ++ +     GLLF D  ++P+++   +A  L +P    D++LD
Sbjct: 131 VNNHMGSLFTENADGMRIVAEAMRNNGLLFLDSVTTPKSVGEQVARSLGVPATKRDVFLD 190

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +     ++  +L   E +ARTTG AI +    D ++ V+  W+ +       +VPL+ +
Sbjct: 191 NTDTAAEVELRLAQTERLARTTGTAIAIGHPRDATLNVLEAWIPKAKADGFVLVPLTAV 249


>gi|83593228|ref|YP_426980.1| hypothetical protein Rru_A1893 [Rhodospirillum rubrum ATCC 11170]
 gi|83576142|gb|ABC22693.1| Protein of unknown function DUF610, YibQ [Rhodospirillum rubrum
           ATCC 11170]
          Length = 432

 Score =  109 bits (272), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 113/216 (52%), Gaps = 2/216 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IA+V+  +G+ +  T++ +  L   +TLA+ +  + L   M+  +K G E ++ +PM+  
Sbjct: 194 IALVIDDMGLDRVRTEK-VRKLAGPLTLAYLAYADGLAGQMRGGRKAGHEILMHMPMEPL 252

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N      LKV  +  ++L RLR +L  G  + G+ N+ G+   ++     ++  E 
Sbjct: 253 DAKVNPGPG-ALKVGLSDDEILTRLRRNLDGGAEFVGINNHMGSRFTADSRGMTLVMGEL 311

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            KRGLL+ D  +S  ++   LA    +P++   ++LD+  D+  +  +L  LE  AR  G
Sbjct: 312 KKRGLLWLDSMTSANSVGLTLAEMAGVPHIGRTVFLDNLNDQAAVARQLAKLEAAARQHG 371

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+G+    D +I  +S WL     + +++VP+S L
Sbjct: 372 VAVGIGHPRDGTIGALSVWLPALAAKGITLVPISAL 407


>gi|193084246|gb|ACF09908.1| uncharacterized protein [uncultured marine group III euryarchaeote
           KM3-28-E8]
          Length = 394

 Score =  107 bits (266), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 107/218 (49%), Gaps = 2/218 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAIV+  LG+S    +R I L P  ITLAF     +L +  KE +  G E I+ + M+  
Sbjct: 173 IAIVMDDLGLSPKRVRRTIAL-PGPITLAFLPYARNLRKLAKEGRAAGHELIIHMNMEPK 231

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   +   +  L  +    ++  RL ++L +  GY GV N+ G+         EV+ +  
Sbjct: 232 DHDIDPGPN-ALLTSMDPMEIRERLLWALNQFDGYIGVSNHMGSRFTEWPNGMEVVIRAL 290

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGLL+FD  +S +++   LA      Y   D++LD +     +  +L   E+IAR  G
Sbjct: 291 KRRGLLYFDSLTSTKSVGLTLARAHGTAYARRDVFLDHERFAKAVAWQLAQTEQIARRRG 350

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AI +   +D + +V+  WL     R   +VPLS + +
Sbjct: 351 YAIAIGHPYDVTFDVLENWLPDAEARGFVMVPLSTIVR 388


>gi|218509896|ref|ZP_03507774.1| hypothetical protein RetlB5_21730 [Rhizobium etli Brasil 5]
          Length = 234

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 116/241 (48%), Gaps = 29/241 (12%)

Query: 26  RLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSP 83
           RLG +    C F I G S+Y     AF G   E        + A   L+ P      Q+ 
Sbjct: 3   RLGRIAASLCLFAIGGFSLYT----AFRGEGLERAKPPATEQAASQTLSKPPTATADQA- 57

Query: 84  SKRDNNTVCNQLKNDSSQHDGQIQNDISG-KTVVNKPTRSTSIDSLPTIEERLILGLSKK 142
                    N +     +    ++  I+G  +VV K +      S P + + + +G   +
Sbjct: 58  --------ANGMPRADPRSGANVEQMITGDGSVVTKYSPHPRDGSGPVLVDAMQIGQDPR 109

Query: 143 ELLAKNKVGREDT---EVP--------AMDK--NFCSNASGARIAIVVSGLGISQTGTQR 189
                N+   EDT    +P         MD+     S A G RIAIVVSGLG+SQTGTQR
Sbjct: 110 MAAQPNEALLEDTAFGRLPIVGPDGRRPMDQYARPSSGARGIRIAIVVSGLGLSQTGTQR 169

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           AI  LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ 
Sbjct: 170 AIAELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKP 229

Query: 250 V 250
           V
Sbjct: 230 V 230


>gi|46201425|ref|ZP_00055095.2| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 373

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 111/224 (49%), Gaps = 2/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAI++  LG+ +  ++R +  L   +TL++ +    + R   +A+  G E ++ +PMQ  
Sbjct: 149 IAIIIDDLGVDRRRSER-MAQLKGPLTLSYMTYAEDVARQSHDARAHGHELMVHVPMQPQ 207

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
             SY+   +  L+V    +++  RL + L R  GY G+ N+ G+   S+     V+  E 
Sbjct: 208 SASYDPG-AEVLEVGLPPEEIRRRLDWGLSRFDGYVGINNHMGSRFTSDAAGMRVVMAEL 266

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGL F D  +S   +    A    +P+    ++LD+      +R +L   E  AR  G
Sbjct: 267 RRRGLAFIDSVTSEHTVGAETARHYGVPFAARHVFLDNDQGVAHVRAQLAKTEAYARKHG 326

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            AI +    D +IE ++ WL     R  ++VP+S + ++ + +S
Sbjct: 327 AAIAIGHPHDGTIEALAGWLPGLEARGFALVPVSTIIRMGNGTS 370


>gi|83592567|ref|YP_426319.1| hypothetical protein Rru_A1231 [Rhodospirillum rubrum ATCC 11170]
 gi|83575481|gb|ABC22032.1| Protein of unknown function DUF610, YibQ [Rhodospirillum rubrum
           ATCC 11170]
          Length = 582

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 112/230 (48%), Gaps = 9/230 (3%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
           + F  +A+  R+AI+VSGLG+ +  TQ AI  LP ++TLAF     +L  WM +A++ G 
Sbjct: 349 RPFTGDATRPRVAIIVSGLGMREAATQAAITRLPPDVTLAFDPYAPALPAWMGKARQSGH 408

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYS--LRRGTGYFGVMNYRGAMLL 279
           E +L++P++     Y   D   L +   + ++ NR R    L R  GY GV+        
Sbjct: 409 ETLLELPVEP--TGYPAIDPGPLALLSGLSEIENRSRLETVLGRSGGYVGVLATAAGRFT 466

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGS-SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
               S   +      RGLL+   GS +  N+    AP +N    +    +DD  ++  I 
Sbjct: 467 DTPASLRGLLDALKSRGLLYVHRGSPTAVNVNGDAAPPVN----IVTARIDDTPNQRAID 522

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +L+ L ++AR  G AIGV  A   ++  +++WL       + + P S +
Sbjct: 523 ARLEYLGQVARAQGYAIGVVGASPVALYRLNRWLGGLEGEGLVLAPASAV 572


>gi|83310908|ref|YP_421172.1| hypothetical protein amb1809 [Magnetospirillum magneticum AMB-1]
 gi|82945749|dbj|BAE50613.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 374

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 110/221 (49%), Gaps = 2/221 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAI++  LG+ +  ++R +  L   +TL++ +    +     +A+ +G E ++ +PMQ  
Sbjct: 154 IAIIIDDLGVDRRRSER-MAQLKGPLTLSYMTYAEDVAHQSHDARARGHELMVHVPMQPQ 212

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
             SY+   +  L+V  +  ++  RL + L R  GY G+ N+ G+   S+     V+  E 
Sbjct: 213 SASYDPG-AEVLEVGLSSDEIRRRLDWGLSRFDGYVGINNHMGSRFTSDPAGMRVVMAEL 271

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGL F D  +S R +    A    +P+    ++LD+      +R +L   E  AR  G
Sbjct: 272 RRRGLAFIDSVTSERTVGAETARHYGVPFAARHVFLDNDQGVAHVRAQLAKTEAYARKHG 331

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            AI +    D +IE ++ WL     R  ++VP+S + ++ +
Sbjct: 332 AAIAIGHPHDGTIEALAGWLPGLEGRGFALVPVSTIIRMGN 372


>gi|170746547|ref|YP_001752807.1| protein of unknown function DUF610 YibQ [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653069|gb|ACB22124.1| protein of unknown function DUF610 YibQ [Methylobacterium
           radiotolerans JCM 2831]
          Length = 411

 Score = 99.8 bits (247), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 114/222 (51%), Gaps = 6/222 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
            SG RIAIVV+GLG+ Q  T  A   LPA ++LAF   G  ++R    A+  G E  LQ+
Sbjct: 180 GSGPRIAIVVTGLGVGQAATAGATARLPAAVSLAFLPYGGEVERAAARARDAGHEVFLQL 239

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+ FD   ++    TL       +  +R  +++ R  GY GV+NY G+ L+++  + E 
Sbjct: 240 PMEPFDYPDSDPGPQTLLTALKGLENADRQAWAMARFPGYVGVVNYMGSKLMADA-AFEP 298

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAP--KLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + +E   RGL F DDG++ +     +AP  K   P   A++ LD     D I   L   E
Sbjct: 299 VLREIGARGLGFLDDGTASKP---AVAPANKGKTPVARAEIVLDATPRADAIDAALAQAE 355

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
             AR  G A+  A     S++ I++W ++   R + +VP S 
Sbjct: 356 ARARANGFALVSATGTPLSVDRIARWAKEIESRGLRLVPASV 397


>gi|288958439|ref|YP_003448780.1| hypothetical protein AZL_015980 [Azospirillum sp. B510]
 gi|288910747|dbj|BAI72236.1| hypothetical protein AZL_015980 [Azospirillum sp. B510]
          Length = 375

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 112/218 (51%), Gaps = 3/218 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAIV+  +G+ +  + R  +L    +TL++      L    K A+  G E +L +PM+  
Sbjct: 155 IAIVIDDMGLDRRRSTRMASLH-GPLTLSWLPYARDLSAQSKAARANGHELMLHMPMEPS 213

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
            ++  +     L V+    +++ R R +L    GY GV N+ G+   +++ +   +  E 
Sbjct: 214 VKA--DPGPNALLVSLDKGEIVKRFRAALDSFDGYVGVNNHMGSRFTADRAALAPVLAEL 271

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGLL+ D  ++P +    LA +L +P++  D++LD+Q     ++ +L   E++A+  G
Sbjct: 272 HRRGLLWLDSRTTPNSAGIGLAQELKMPWVGRDVFLDNQETVAAVKAQLAKTEQVAKRQG 331

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            A+ +    D +IE ++ WL     R   +VP+S + +
Sbjct: 332 YAVAIGHPHDATIEALASWLPDVQKRGFVLVPVSAVVR 369


>gi|209963454|ref|YP_002296369.1| hypothetical protein RC1_0107 [Rhodospirillum centenum SW]
 gi|209956920|gb|ACI97556.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 240

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/242 (27%), Positives = 121/242 (50%), Gaps = 7/242 (2%)

Query: 157 VPAMDKNFCSN--ASG-ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
           +PA  +N      A G  RI IV+  +G+    + R + L P  +TLA+      L    
Sbjct: 1   MPAWQRNAVPTPPAEGRPRIVIVIDDMGLDHRRSGRVVAL-PGPLTLAWLPYARDLPIQT 59

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           ++A ++G E I+ +PM+       +     L V Q+ +++ +RLR +L   +GY G+ N+
Sbjct: 60  RQAHQRGHELIVHMPMEP--AGSGDPGPNALLVRQSPEEIRSRLRTNLDAFSGYVGINNH 117

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+   ++  ++ V+ +E A+RGLL  D  ++  +  R  A + ++P    D++LD    
Sbjct: 118 MGSRFTADAAASAVVVEELARRGLLVLDSRTTADSRLRDEAVRRHVPSASRDVFLDHVQT 177

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
              +   L+ +E  AR  G AI +    D + E +++WL     +   +VPLS + + + 
Sbjct: 178 PAAVSAALEKVEATARRQGLAIAIGHPHDVTTEALARWLPTLAGKGFQLVPLSAVVR-TG 236

Query: 394 PS 395
           PS
Sbjct: 237 PS 238


>gi|117926782|ref|YP_867399.1| hypothetical protein Mmc1_3508 [Magnetococcus sp. MC-1]
 gi|117610538|gb|ABK45993.1| protein of unknown function DUF610, YibQ [Magnetococcus sp. MC-1]
          Length = 482

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 107/236 (45%), Gaps = 7/236 (2%)

Query: 153 EDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRW 212
           E   VPA   +        +IA+++  LG +  G  R I  LPA+ITLA    G    + 
Sbjct: 239 EKKPVPAKHSHMV------KIAVIIDDLGYN-GGVGRGIVSLPADITLAVLPGGPYSRQL 291

Query: 213 MKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMN 272
           +  A KKGQE IL  PMQ             L       ++   L ++L R     G+ N
Sbjct: 292 VNMAHKKGQEIILHQPMQPQGYPRVNPGPGALLEGMDADEIAEVLNHNLERFPEVVGINN 351

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+ L  N+     + K   KR L F D  +SPR++    A    +P     ++LD++ 
Sbjct: 352 HMGSALTENRVIMNDVMKVLVKRELYFIDSRTSPRSVAYRAALSHGVPRAKRSVFLDNKR 411

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
               I ++L+  EEIA+ +G AI +   +  +++ + QWL     R + VV  S L
Sbjct: 412 TVAAILKRLQEAEEIAKRSGSAIAIGHPYGVTLQALKQWLPGLQARGIVVVRASNL 467


>gi|23015121|ref|ZP_00054907.1| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 474

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 127/283 (44%), Gaps = 33/283 (11%)

Query: 119 PTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD---------KNFCSNAS 169
           P R   + +LP            KE+  +  +G  D  VP+ D         + +   A 
Sbjct: 206 PERKGEVKALPPA--------PNKEMQKRTAIG--DLPVPSPDGKQPWQVYARPWSGPAD 255

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++A+VV  +G+ +  T+ AI  LP  +TLAF+     LD+W+K+A+  G E ++ +P 
Sbjct: 256 RGKVAVVVMDMGLDKVATEAAIAKLPPEVTLAFSPYAQGLDKWVKKARDYGHEVMMVLP- 314

Query: 230 QAFDESYNEDDSYTLKVTQTV--QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
            A        D   L +T +V  +  L RL   + RG  Y G+++       S  E    
Sbjct: 315 -ADSNGTQPRDPGPLGMTNSVPPESNLARLEGVMSRGAAYTGLISLGDKFAAS--EQVVQ 371

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  +   RGLL+   G++P + T  LAP   +    ADL+      R+ I  +L  +   
Sbjct: 372 MLGQLRDRGLLYVGPGAAPADRTPALAPVTAV--ADADLF------REAIEMRLNQVSIA 423

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           ART G+A+ V      S + +  WL     + + +VP+S L +
Sbjct: 424 ARTKGKALVVINPRPLSFDRLLPWLNDFDGQKLVIVPVSTLVQ 466


>gi|304322188|ref|YP_003855831.1| yibQ gene product [Parvularcula bermudensis HTCC2503]
 gi|303301090|gb|ADM10689.1| yibQ gene product [Parvularcula bermudensis HTCC2503]
          Length = 323

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 108/221 (48%), Gaps = 6/221 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           RIA+V+  +G S     R +N LP  +T+AF          M +A     +AI+ +PM+ 
Sbjct: 94  RIALVIDDMGYSWAAYDR-LNDLPVPLTMAFLPFSADAQE-MIDALWPRHDAIVHLPMEP 151

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             E++       L        +   L  +L +  GY GV N+ G+   +++    V+  E
Sbjct: 152 IAETHLAGPG-MLSTDMDADAIKWGLLAALSQLRGYSGVNNHTGSRFTADRARMAVVLGE 210

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD---DQVDRDKIREKLKGLEEIA 348
             +RGL F D  ++PR +  ++A       +  +++LD   D +   ++R +L  LE IA
Sbjct: 211 LNRRGLFFLDSITTPRPVAHLIAEAEGFSVLERNVFLDSDYDTLTSQQVRTQLAKLERIA 270

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           ++ GQAIG+   +  +++V+ +W +    R  S+V +  LA
Sbjct: 271 QSEGQAIGIGHPYAITLDVVERWAEDVEARGFSLVLVKDLA 311


>gi|83309401|ref|YP_419665.1| skin secretory protein xP2 precursor [Magnetospirillum magneticum
           AMB-1]
 gi|82944242|dbj|BAE49106.1| Skin secretory protein xP2 precursor [Magnetospirillum magneticum
           AMB-1]
          Length = 479

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 131/285 (45%), Gaps = 35/285 (12%)

Query: 121 RSTSIDSLPTI--EERLILGLSKKELLAKNKVGREDTEVPAMD---------KNFCSNAS 169
           +  S + LP    E + +     KE+  +  +G  D  VP+ D         + +   A 
Sbjct: 203 KPPSYEGLPAHKGEVKALPPAPNKEMQKRTAIG--DLPVPSPDGKQPWQVYARPWSGPAD 260

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++A+VV  +G+ +  T+ AI  LP  +TLAF+     LD+W+K+A+  G E ++ +P 
Sbjct: 261 RGKVAVVVMDMGLDKAATEAAIAKLPPEVTLAFSPYAQGLDKWVKKARDYGHEVMMVLPA 320

Query: 230 QAFDESYNEDDSYTLKVTQTV--QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA-E 286
            A        D   L +T +V  +  L RL   + RG  Y G+++      L +K +A E
Sbjct: 321 DA--SGAQPRDPGPLGMTNSVPPESNLARLEGVMARGGAYTGLIS------LGDKFAASE 372

Query: 287 VIFKEFAK---RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
            I +   K    GLL+   G++P + T  LAP   +    ADL+      R+ I  +   
Sbjct: 373 QIVQTLGKLRDHGLLYVGPGAAPADRTPALAPVTAV--ADADLF------REAIEMRFNQ 424

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +   ART G+A+ V      S + +  WL     + + +VP+S L
Sbjct: 425 VSIAARTKGKALVVINPRPLSFDRLLPWLNDFDGQKLVIVPVSTL 469


>gi|258406280|ref|YP_003199022.1| hypothetical protein Dret_2160 [Desulfohalobium retbaense DSM 5692]
 gi|257798507|gb|ACV69444.1| protein of unknown function DUF610 YibQ [Desulfohalobium retbaense
           DSM 5692]
          Length = 403

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 112/231 (48%), Gaps = 8/231 (3%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFA---SNGNSLDRWMKEAK 217
           DK   +  S AR+AIV+  LG      ++A  L+   + L FA   S  ++ D     A 
Sbjct: 173 DKAEQNTKSQARLAIVIDDLG---EDVRKARRLIQTGLPLTFAVLPSCTHTRD-IASLAH 228

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +   E +L  PM+       +  +  L V     Q+   L+ +L +     G+ N+ G+ 
Sbjct: 229 EHNLELLLHQPMEPLSYPATDPGTGALFVGMNASQIRKTLKDNLAQIQHAVGLNNHMGSR 288

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
             S+       F+  A R L F D  +SP ++ R  A + ++PY+  +++LD+  +R+ I
Sbjct: 289 FTSSSAGMRTTFRNIANRQLFFLDSLTSPDSVARETAKRTHVPYLRRNIFLDNTQNREAI 348

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             +L+  E +A + G AI +   ++ ++E I++W  Q   R V ++PLS L
Sbjct: 349 LYQLQKAERLALSRGSAIAIGHPYEATLEAIAKWKTQRDPR-VRLIPLSTL 398


>gi|218462232|ref|ZP_03502323.1| hypothetical protein RetlK5_23383 [Rhizobium etli Kim 5]
          Length = 234

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 115/251 (45%), Gaps = 36/251 (14%)

Query: 1   MSIDLNHPL--RKKTPKRKSFYSQIISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISE 56
           M  DL+ PL   +KT  R+      + RLG +    C F I G S+Y     AF G   E
Sbjct: 1   MGTDLHAPLGRNRKTASRRPG----VLRLGRIAASLCLFAIGGFSLYT----AFRGDGLE 52

Query: 57  MIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG-KTV 115
                   + A          +    P     +   + +     +    ++  I+G  +V
Sbjct: 53  RAKPPTAEQAA---------TQASGKPPTAAADQAADGMPRADPRSGANVEQMITGDGSV 103

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDT---EVP--------AMDK-- 162
           V K +      S P + + + +G   +     N+   EDT    +P         MD+  
Sbjct: 104 VTKYSPRPRDGSGPVLVDAMQIGQDPRMAAQPNEALLEDTAFGRLPIVGPDGRRPMDQYA 163

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA-KKKGQ 221
              S A G RIAIVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA  ++ +
Sbjct: 164 RPSSGARGIRIAIVVSGLGLSQTGTQRAIAELPEEITLAFAASGNSLQRWMQEAPPRRPR 223

Query: 222 EAILQIPMQAF 232
              LQ+P +A 
Sbjct: 224 YFFLQVPARAI 234


>gi|329890925|ref|ZP_08269268.1| divergent polysaccharide deacetylase family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328846226|gb|EGF95790.1| divergent polysaccharide deacetylase family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 173

 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 79/178 (44%), Gaps = 13/178 (7%)

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A+  G E ++++PM+      N+   YTL  +     +  +L + L R TGYFGV NY G
Sbjct: 2   ARAHGHEVMIELPMEPTGYPDNDPGPYTLLSSGGADDVAVKLDWLLARATGYFGVTNYLG 61

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGS---SPRNLTRVLAPKLNLPYMVADLYLDDQV 332
               ++ E    +     +RGL F DDGS    P    R            AD  +D++ 
Sbjct: 62  DRFATSDEGVSALMTNLRQRGLAFLDDGSMRRRPGAFARA----------SADRVVDEEQ 111

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               I  +   LE  A+T G A+G   ++  ++E  ++W      R + + P S + +
Sbjct: 112 TPAAILRQFNALEAAAKTNGAALGTGFSYPITVEAAARWTAGLEARGLQLAPASAMTR 169


>gi|254429372|ref|ZP_05043079.1| Divergent polysaccharide deacetylase superfamily [Alcanivorax sp.
           DG881]
 gi|196195541|gb|EDX90500.1| Divergent polysaccharide deacetylase superfamily [Alcanivorax sp.
           DG881]
          Length = 258

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 109/224 (48%), Gaps = 5/224 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           RIAI++  LG S+   Q AI  LPA +T A         R  + A   G+E ++ +PM A
Sbjct: 26  RIAIIIDDLGYSRQHGQ-AIVDLPAPVTCAVIPFSPHARRLAERASLAGKEVLVHMPMAA 84

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             + +   D   L+      QLL+ +R +L +     G+ N+ G+ L   ++    +  E
Sbjct: 85  --QRHQTLDQGGLRDGMDEPQLLDAVRQALSQIPQARGLNNHMGSALTEQQQPMGWLMTE 142

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
                L F D  +S  ++ + +A ++ L +   D++LD++ +   I E+   L  +AR  
Sbjct: 143 LKAHQLFFVDSRTSSHSVAQQMARQVGLSHAGRDVFLDNERNLVSINEQFNRLIRLARQR 202

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           GQAI +   + E++  + Q L       + VVP+S L  LS+P+
Sbjct: 203 GQAIAIGHPYPETVHYLQQVLPLMQDAGIEVVPVSTL--LSTPA 244


>gi|242279092|ref|YP_002991221.1| hypothetical protein Desal_1620 [Desulfovibrio salexigens DSM 2638]
 gi|242121986|gb|ACS79682.1| protein of unknown function DUF610 YibQ [Desulfovibrio salexigens
           DSM 2638]
          Length = 418

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 105/222 (47%), Gaps = 2/222 (0%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           + +  ++AIV+  +G       + +  L A IT +   N + + + +  AKK G E ++ 
Sbjct: 195 DPNAPKLAIVIDDMG-EDLKLAKGLAALDAKITFSIWPNSSHVKKTIAIAKKSGNEIMVH 253

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQ          +  L V     ++ +    ++ +  G  G+ N+ G+    N     
Sbjct: 254 LPMQPKGYPKVNPGADALLVGMDADKISSITLAAIAKVPGATGLNNHMGSSFTENYNGML 313

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
              K+  K+ L F D  ++P++  R  A K  + +   +++LD+  D   I+ +L    +
Sbjct: 314 AALKQLNKKHLFFLDSRTTPKSACRRAASKAGVTFYERNIFLDNVKDVGAIKYQLSKAAK 373

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IAR +GQAI +     E+++ I QW+  E+   + +VP+S L
Sbjct: 374 IARKSGQAIAIGHPNHETLKAIRQWV-AENKGKIRIVPVSSL 414


>gi|317153225|ref|YP_004121273.1| hypothetical protein Daes_1513 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943476|gb|ADU62527.1| protein of unknown function DUF610 YibQ [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 413

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 102/223 (45%), Gaps = 10/223 (4%)

Query: 170 GARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           G  +AIV+  +G      +  INL  P  +TLA   N +     ++  +  G++ I+  P
Sbjct: 194 GPMLAIVIDDIGEDLHVLKGLINLNFP--VTLAVWPNASQSRESVRLIQASGRDLIIHFP 251

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+          S  L  T + + +  R+  S+ R     GV N+ G+   ++       
Sbjct: 252 MEPMGYPAYNPGSDALFTTMSEEAIRKRVADSVARIPEAIGVNNHMGSKFTAHTPGMTTA 311

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
             EF +RGL F D  +S R++ R +A +   P+   D++LD+  D   I  +L+  E +A
Sbjct: 312 LSEFRQRGLFFLDSLTSARSVARSVARQTGTPFYQRDIFLDNVKDVSAITLQLRKAENVA 371

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVR---DVSVVPLSCL 388
              G AI +   + E++  +  W    H R   ++ V+PLS L
Sbjct: 372 LKNGVAIAIGHPYPETLAALKSW----HARKNPNIRVLPLSLL 410


>gi|110835138|ref|YP_693997.1| hypothetical protein ABO_2277 [Alcanivorax borkumensis SK2]
 gi|110648249|emb|CAL17725.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 259

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 111/234 (47%), Gaps = 11/234 (4%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLA---FASNGNSLDRWMKEAKKKGQ 221
            S  +  RIAI++  LG S+   Q  I+L PA +  A   F+ +G    R  + A   G+
Sbjct: 20  VSGLAAPRIAIIIDDLGYSRQQGQAIIDL-PAPVACAVIPFSPHGR---RLAERASLAGK 75

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E ++ +PM    + + + D   L+      QLL  +R +L +     G+ N+ G+ L   
Sbjct: 76  EVLVHMPMAT--QGHQKLDRGGLQNGMDEPQLLEAVRQALGQIPQARGLNNHMGSALTEQ 133

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
            ++   +  E     L F D  +S   + + +A ++ LP    D++LD+  +   I ++ 
Sbjct: 134 PQTMGWLMAELKAHQLFFVDSRTSSHTVAQQVAQQVGLPNARRDVFLDNNRNPVSINQQF 193

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             L  +AR  GQAI +   + E++  + Q L       + VVP+S L  LS+P+
Sbjct: 194 NRLIRLARQHGQAIAIGHPYPETVHYLQQVLPLMEEAGIDVVPVSSL--LSTPA 245


>gi|332703283|ref|ZP_08423371.1| protein of unknown function DUF610 YibQ [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553432|gb|EGJ50476.1| protein of unknown function DUF610 YibQ [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 505

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 106/225 (47%), Gaps = 16/225 (7%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFA---SNGNSLDRWMKEAKKKGQEAILQI 227
           AR+AIV+  LG S    + A NL    I +AFA   S  NS  R    A+K   E +L  
Sbjct: 219 ARLAIVIDDLGES---VEFASNLSRLGIPVAFAIWPSASNS-QRIAALARKAHMEVLLHQ 274

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF----GVMNYRGAMLLSNKE 283
           PM+    SY EDD     +  ++ +    +R  +     +F    G+ N+ G+    ++ 
Sbjct: 275 PME--PRSYPEDDPGKGAMFISMNEAA--IRAVIMENLAHFPMAVGLNNHMGSRFTEDRR 330

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
              V+  E   RGL + D  +S +++   +  K   P +  D++LD+  D D I  +L+ 
Sbjct: 331 GMSVVMDELRSRGLFYLDSMTSAKSVGTSVGKKAGTPVLRRDVFLDNVADVDAIFLQLRK 390

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            E +A   G+A+ +   + E+++ +  W+ Q   R V  V LS L
Sbjct: 391 AENVALKHGKAVAIGHPYPETLQALRTWVAQRDTR-VEAVTLSSL 434


>gi|90020140|ref|YP_525967.1| hypothetical protein Sde_0491 [Saccharophagus degradans 2-40]
 gi|89949740|gb|ABD79755.1| protein of unknown function DUF610, YibQ [Saccharophagus degradans
           2-40]
          Length = 382

 Score = 76.3 bits (186), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 125/281 (44%), Gaps = 23/281 (8%)

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARI 173
           T  N+P  + +++  P IE           ++AK  V    TE         S  +  RI
Sbjct: 111 TAENEPAAAKAVEDEPAIE-----------VIAKPAVPVNITE--------QSTVTSPRI 151

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           AI++  +G  +    R +  LP  +T AF        R  + AK+  +  +L  PM   +
Sbjct: 152 AIIIDDIGY-RFDEGRELIELPYPLTFAFIPFSPYGARLAELAKQLNKPVMLHAPMATLN 210

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
           ES  E    +L  T    +L+  L   L       GV N+ G++   ++ES + + +  A
Sbjct: 211 ESKWE---ASLNPTMARTELIASLDAMLADIPHVTGVNNHGGSLFTQSRESMQWLSEALA 267

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
           +R L F D  ++ +++ +  A ++N+P+   D++LD++ D   I  +L  L  IA   G+
Sbjct: 268 ERELFFVDSRTTAQSVAKEEAQRVNIPFNERDVFLDNERDLPAIDSQLDKLVAIALKHGE 327

Query: 354 AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           A+ +   + E+++ +   L     + V VV +  L     P
Sbjct: 328 AVAIGHPYPETLQALKARLPLLAAQGVEVVGIELLLNRHRP 368


>gi|331006625|ref|ZP_08329910.1| hypothetical protein IMCC1989_515 [gamma proteobacterium IMCC1989]
 gi|330419564|gb|EGG93945.1| hypothetical protein IMCC1989_515 [gamma proteobacterium IMCC1989]
          Length = 349

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 106/223 (47%), Gaps = 5/223 (2%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AI++  LG +     +A+ L P  IT A   +      + +EA+K  +E +L  PM   
Sbjct: 111 VAIIIDDLGYNYEQGLKAMQL-PGAITYAIIPHSPKAQFFAQEAQKHNKEIMLHAPMSTI 169

Query: 233 DESYNEDDSYT-LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           +      +  T L      +Q+LN+   SL       G+ N+ G++L    +    + + 
Sbjct: 170 NHKPLGKNGLTGLMEEADFKQVLNQSLLSL---PSVKGMNNHMGSLLTQKSQPMSWVMQS 226

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             +R L F D  +S +++   +A +  +P +  D++LD + +   I ++ K L   A+  
Sbjct: 227 LKQRQLYFIDSRTSAQSVAWDIAQQYGIPSLKRDVFLDHEPNEAFIDKQFKLLISTAKHQ 286

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           G A+ +A    E++  +S  L + H   +S+VP S LAK  SP
Sbjct: 287 GYAVAIAHPHPETVAYLSLNLSRLHDAGISLVPASELAKRFSP 329


>gi|119475541|ref|ZP_01615894.1| hypothetical protein GP2143_17016 [marine gamma proteobacterium
           HTCC2143]
 gi|119451744|gb|EAW32977.1| hypothetical protein GP2143_17016 [marine gamma proteobacterium
           HTCC2143]
          Length = 282

 Score = 73.6 bits (179), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 102/231 (44%), Gaps = 10/231 (4%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F    + A I ++V  +G S    QRAINL P  I  AF             A ++ +E 
Sbjct: 31  FGQEKTVANIVLIVDDMGNSLELGQRAINL-PGAINYAFLPYSPHRVSLANIAFRQRKEV 89

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L  PM             T  ++Q  QQ L  L  +L       GV N+ G+++   ++
Sbjct: 90  MLHAPMSNLHSHPVGQGGLTPNMSQ--QQFLQTLNTNLNSVPHVRGVNNHMGSLMTQLRQ 147

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               +     ++ L F D  ++P  + +  A KL +P +  D++LD++   D I  + + 
Sbjct: 148 PMGWLMAALKQQNLYFVDSRTTPLTVAKSTATKLGVPSLRRDIFLDNERQHDAIAMQFER 207

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-------PLSC 387
           L  +A+ TG A+G+     E+++ + + L     R + +V       P++C
Sbjct: 208 LIALAKKTGIAVGIGHPHPETLKYLEKTLPTLEQRGIKLVLASQALKPVNC 258


>gi|298530220|ref|ZP_07017622.1| protein of unknown function DUF610 YibQ [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509594|gb|EFI33498.1| protein of unknown function DUF610 YibQ [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 440

 Score = 73.2 bits (178), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 83/159 (52%), Gaps = 5/159 (3%)

Query: 216 AKKKGQEAILQIPMQAFDESYN---EDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMN 272
           A KK  E +L +PM+   ++Y+   E     L V  T +++  +L +SL +     G+ N
Sbjct: 247 ASKKDFEVMLHMPMEP--DTYHRGVEPGPGALFVDMTPREIRRQLVHSLEQVPQATGMNN 304

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+    + E  +V+F+E  KR + F D  ++P ++ R LA +  L +M   ++LD+  
Sbjct: 305 HMGSAFTRHYEGMQVVFEELEKRDMFFLDSVTTPDSVARRLARETGLDFMQRHVFLDNVR 364

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
               I  +L+  E++A   G A+ +   + E++E + QW
Sbjct: 365 SIQAITYQLQKAEQLASRHGMAVAIGHPYPETLEALQQW 403


>gi|304320591|ref|YP_003854234.1| hypothetical protein PB2503_05087 [Parvularcula bermudensis
           HTCC2503]
 gi|303299493|gb|ADM09092.1| hypothetical protein PB2503_05087 [Parvularcula bermudensis
           HTCC2503]
          Length = 388

 Score = 72.8 bits (177), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 60/216 (27%), Positives = 101/216 (46%), Gaps = 7/216 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A++VSGLG+    T RA+  LPA I ++F++   ++D  +  A   G+EA L+IPM   
Sbjct: 176 LAVMVSGLGLDPVTTDRALLALPAEIGVSFSAYARNVDARLSAALAAGREAALEIPMATR 235

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
             S        L   +  +    RL + L R   Y  V N+ G +  SN E+ +      
Sbjct: 236 GLSEAVLGPAALSPDRAAEGNATRLDWVLSRAPAYPYVTNFEGDLFASNAEAMQAFLNAL 295

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            + GL + DD      + R     LNLPY   DL L  + +  +  ++L+ +   A +  
Sbjct: 296 DRAGLGYLDDTGKGGAIARA----LNLPYGEVDLVL--EPNDPEAADRLRAVSRRALSAE 349

Query: 353 QAIGVAV-AFDESIEVISQWLQQEHVRDVSVVPLSC 387
           + + V V A D +++ +  W+      +V +VP S 
Sbjct: 350 RPLIVKVYASDGNLDAVMAWVDTLQSGEVGLVPPSA 385


>gi|297570178|ref|YP_003691522.1| protein of unknown function DUF610 YibQ [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296926093|gb|ADH86903.1| protein of unknown function DUF610 YibQ [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 359

 Score = 72.4 bits (176), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 110/219 (50%), Gaps = 3/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+A+++  +G S    ++ + L    +T +F        + +   + +G+  +L +P++A
Sbjct: 139 RLALIIDDMGYSPEIEEKMLGLD-LELTFSFIPFAPQRQQILNRTRAQGRAILLHLPLEA 197

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            D+ +N+     L    + ++++     +L       GV N+ G+   +++ + +V+  +
Sbjct: 198 LDDKWNKAPGL-LATGMSEEEIVTGFTAALNEIPMATGVSNHMGSRFTADRRAMQVLLAQ 256

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             +  L F D  ++P ++   +A +L +P++  D+++D   + ++IR ++  L  IA   
Sbjct: 257 LPRYDLYFLDSLTTPDSVGAEIAAELGIPFLRRDIFIDHHREPEQIRTQIDRLLNIAEKR 316

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G A+G+   + E++ V+ Q  + E  R V +V L  L K
Sbjct: 317 GWAVGLGHPYPETLRVL-QEKEGELNRRVRLVKLDQLVK 354


>gi|218782460|ref|YP_002433778.1| hypothetical protein Dalk_4632 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763844|gb|ACL06310.1| protein of unknown function DUF610 YibQ [Desulfatibacillum
           alkenivorans AK-01]
          Length = 359

 Score = 72.0 bits (175), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 99/220 (45%), Gaps = 2/220 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+AI++  +G    G Q     LP  IT +   +          A  KG++ +L +PM+ 
Sbjct: 140 RVAIIIDDMGYG-NGIQHKFLDLPYVITYSILPHSPDQIEIANLAHDKGRQVLLHLPMEP 198

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 +    TL  + T   +++ L+  L       GV N+ G+ L     +   IF  
Sbjct: 199 MQYPEVDPGPGTLLASMTTDTMMDILKEDLAAVPYIAGVNNHMGSRLTMESGALYPIFTV 258

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             K+GL F D  ++  ++ R  A    LP+   D++LD       + ++LK L  +A+  
Sbjct: 259 LKKQGLFFVDSRTTRHSVCRPSARLFQLPFAQRDVFLDHVRTEAFVEKQLKLLVSVAKKR 318

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           GQAIG+   +  + +V++  L      +V +VP S L ++
Sbjct: 319 GQAIGIGHPYKVTYKVLAARLPAVDA-EVRLVPASDLVRV 357


>gi|158522465|ref|YP_001530335.1| protein of unknown function DUF610 YibQ [Desulfococcus oleovorans
           Hxd3]
 gi|158511291|gb|ABW68258.1| protein of unknown function DUF610 YibQ [Desulfococcus oleovorans
           Hxd3]
          Length = 315

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 110/232 (47%), Gaps = 12/232 (5%)

Query: 166 SNASGAR--IAIVVSGLGISQTGTQRAINL-LPANIT-LAFASNGNSLDRWMKEAKKKGQ 221
           ++A  AR  +AI++  +G  +    R +NL +P   + L  +  G  + R    A++KG 
Sbjct: 87  AHAPSARPKVAIIIDDMGYDRALAGRFVNLGIPLTFSILPHSPRGREIART---ARQKGI 143

Query: 222 EAILQIPMQAFDE--SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           E +L +PM+  DE  + N  D   L  +    +L+ R+  +L   +   GV N+ G+ + 
Sbjct: 144 EIMLHLPMEP-DEYPAVNPGDGVLL-TSMGPDELIARMENNLNDISHVAGVNNHMGSKMT 201

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           ++      +F    K GL F D  ++P +  R  A  L +P+   D++LD+  D   I  
Sbjct: 202 ADSARMYQVFSVLKKHGLFFVDSRTTPESQCRPAARLLQVPFAERDVFLDNDSDVAAIEA 261

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           ++  L  +A+  G+A+ +  A   +   + + L     + V +VP S L  L
Sbjct: 262 QIDRLIAVAKRNGKAVAIGHAHGSTCTALEKHLAAL-TQQVELVPASHLVCL 312


>gi|323697918|ref|ZP_08109830.1| protein of unknown function DUF610 YibQ [Desulfovibrio sp. ND132]
 gi|323457850|gb|EGB13715.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           desulfuricans ND132]
          Length = 410

 Score = 71.2 bits (173), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 100/222 (45%), Gaps = 2/222 (0%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A G ++ +V+  +G       + +  L   +T A   + +     ++   K   + ++ 
Sbjct: 188 EAKGPKLVVVIDDVG-EDYRVLKGLAGLDLPLTFAVWPHASHTRECVEWIAKTHHDLLIH 246

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PM+       +     L V+ T  Q+  R+  +L R     GV N+ G+   ++K    
Sbjct: 247 FPMEPMGYPQVKPGDDALFVSMTPDQVRQRVADNLARIPEAIGVNNHMGSRFTADKAGMA 306

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           V   EF + GL F D  +S +++ R  A  + +P+   D +LD+  D + I  +L+  E 
Sbjct: 307 VALTEFKRHGLFFLDSLTSGKSVGRATAKTVGIPFYERDTFLDNVKDVNAILLQLRKTER 366

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +A+  G+AI +   + ++++ +  W Q      + V+ LS L
Sbjct: 367 VAQRQGRAIAIGHPYRQTLDALRAW-QDSRDPAIQVITLSKL 407


>gi|94264377|ref|ZP_01288168.1| Protein of unknown function DUF610, YibQ [delta proteobacterium
           MLMS-1]
 gi|93455206|gb|EAT05422.1| Protein of unknown function DUF610, YibQ [delta proteobacterium
           MLMS-1]
          Length = 359

 Score = 70.9 bits (172), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 103/219 (47%), Gaps = 7/219 (3%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+A++V  +G  +  T+  +      +T +F    + L   ++ A+ + +E +L +P++A
Sbjct: 142 RLALIVDDMGY-RPATELQLLARDWELTFSFIPFADHLYEVLETARLQEREILLHLPLEA 200

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            DE +NE     L        +      +L +     GV N+ G+   ++  + E +  +
Sbjct: 201 QDERWNEAPGMLLTAMDDAA-IATGFADALAQVPMAVGVNNHMGSRFTADARAMEALMAQ 259

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            A   L F D  ++  ++    A +  +P++  DL+LD+  D  KI   LK L EIA   
Sbjct: 260 VAHYDLFFLDSLTTANSVADQAAARHQVPFLKRDLFLDNDQDPGKIIANLKRLLEIAEER 319

Query: 352 GQAIGVAVAFDESIEVISQWLQQ--EHVRDVSVVPLSCL 388
           G A+G+   +  ++  +  +  +  E VR   +VPLS L
Sbjct: 320 GYAVGICHPYPATVTALQDFYPRLAEKVR---LVPLSVL 355


>gi|302338309|ref|YP_003803515.1| protein of unknown function DUF610 YibQ [Spirochaeta smaragdinae
           DSM 11293]
 gi|301635494|gb|ADK80921.1| protein of unknown function DUF610 YibQ [Spirochaeta smaragdinae
           DSM 11293]
          Length = 314

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 97/199 (48%), Gaps = 5/199 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P   +   +  S   +AI++  +G S     R +   P  IT A           +KE  
Sbjct: 80  PLPGQKVPAKPSRGELAIIIDDVGYS-LKELRPLLAFPGPITFAILPGVTYSKEALKEIL 138

Query: 218 KKGQEAILQIPMQAFDESYNEDDS-YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
           + G+EAIL  PM+A   +     + YT   T  V++ L++    LR   G  G+ N+ G+
Sbjct: 139 QAGKEAILHQPMEAIGGNDPGPGAIYTWMDTAAVREQLDKNLKELR---GVKGINNHMGS 195

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + S+    EV+ ++  ++ L+F D  ++   ++R +A +L++PY    ++LD+  +R++
Sbjct: 196 KVTSDPRVMEVVLEDLKEKNLMFIDSRTTAETVSRGIAQRLHIPYQERSVFLDNTQEREE 255

Query: 337 IREKLKGLEEIARTTGQAI 355
           I +  +   + A   G+AI
Sbjct: 256 ILQAFQEGLQKAEKNGRAI 274


>gi|148259913|ref|YP_001234040.1| protein of unknown function DUF610, YibQ [Acidiphilium cryptum
           JF-5]
 gi|146401594|gb|ABQ30121.1| protein of unknown function DUF610, YibQ [Acidiphilium cryptum
           JF-5]
          Length = 327

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 102/223 (45%), Gaps = 16/223 (7%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A+++ G+G ++  ++ AI  LP  ++LA    G  L   +  A+  G E ++ IPMQ  
Sbjct: 107 VAVMMGGIGEARQASRDAIRSLPPAVSLALTPYGPHLRSVVAAARAAGHETLMGIPMQTD 166

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML----LSNKESAEVI 288
            E    +    L+ ++     L  L ++L R  GY GV +  G  +    L+   +   +
Sbjct: 167 REPAITEGDEALRGSELDPVNLKHLDWALSRSAGYVGVTDEIGMSVDETYLTQLLNRHWL 226

Query: 289 FKEFAKRGLLFF--DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            K+    GLL      GS          P   +P  VAD+ +  ++  D+ R  LK L  
Sbjct: 227 GKQLRPTGLLLVTASQGSG--------VPS-GVPGRVADVVIHPEMSVDEQRAALKRLAA 277

Query: 347 IARTTGQAIGV-AVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A  +G A+GV +    + I V++QW Q      + +VP+S L
Sbjct: 278 TAVASGSALGVISSPTADDIAVLAQWCQGLKADGLVLVPVSAL 320


>gi|326403133|ref|YP_004283214.1| hypothetical protein ACMV_09850 [Acidiphilium multivorum AIU301]
 gi|325049994|dbj|BAJ80332.1| hypothetical protein ACMV_09850 [Acidiphilium multivorum AIU301]
          Length = 321

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 102/223 (45%), Gaps = 16/223 (7%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A+++ G+G ++  ++ AI  LP  ++LA    G  L   +  A+  G E ++ IPMQ  
Sbjct: 101 VAVMMGGIGEARQASRDAIRSLPPAVSLALTPYGPHLRSVVAAARAAGHETLMGIPMQTD 160

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML----LSNKESAEVI 288
            E    +    L+ ++     L  L ++L R  GY GV +  G  +    L+   +   +
Sbjct: 161 REPAITEGDEALRGSELDPVNLKHLDWALSRSAGYVGVTDEIGMSVDETYLTQLLNRHWL 220

Query: 289 FKEFAKRGLLFF--DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            K+    GLL      GS   +          +P  VAD+ +  ++  D+ R  LK L  
Sbjct: 221 GKQLRPTGLLLVTASQGSGVPS---------GVPGRVADVVIHPEMSVDEQRAALKRLAA 271

Query: 347 IARTTGQAIGV-AVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A  +G A+GV +    + I V++QW Q      + +VP+S L
Sbjct: 272 TAVASGSALGVISSPTADDIAVLAQWCQGLKADGLVLVPVSAL 314


>gi|315635656|ref|ZP_07890919.1| divergent polysaccharide deacetylase superfamily protein
           [Arcobacter butzleri JV22]
 gi|315479953|gb|EFU70623.1| divergent polysaccharide deacetylase superfamily protein
           [Arcobacter butzleri JV22]
          Length = 359

 Score = 70.1 bits (170), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 119/244 (48%), Gaps = 23/244 (9%)

Query: 140 SKKELLAKNKVGRE------DTEVPAMDKNFCSNASGA-RIAIVVSGLGISQTGTQRAIN 192
           +KKE     ++G E      +   P     +  N     +IAI++  + +S +   +  N
Sbjct: 107 NKKEYEQTTEIGEENIPLVEEKAAPIKKDTYVYNKKDKPKIAIIIDDV-VSDSQKSKISN 165

Query: 193 L-LPANITLAFASNGNSLDRWMKEAKKKGQEA---ILQIPMQAFDESYNEDDSYTLKVTQ 248
           +  P  IT+AF    N+     K++ K  Q     ++  P+QA   ++  ++  TLK+T 
Sbjct: 166 IGYP--ITMAFLPPTNT----HKDSAKIAQNVPFYMIHFPLQA-SSAFKGEEINTLKITD 218

Query: 249 TVQQLLNRLRY--SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
           + + + NR++   S      Y    N+ G++   N E+ + +FK   K   +F D  +S 
Sbjct: 219 SYETIENRVKQLRSWYPNAKYTN--NHTGSVFTENDEAMDKLFKALVKYNFIFVDSKTSA 276

Query: 307 RNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIE 366
           +++ +  A K NLPY+  +++LD++   + I+ +L    E+A+  G A+ +   +D +++
Sbjct: 277 KSVGQKYANKYNLPYISRNIFLDNEKSYEYIKSQLIKTVELAKKHGYAVAIGHPYDITLK 336

Query: 367 VISQ 370
           V+ +
Sbjct: 337 VLKE 340


>gi|77919271|ref|YP_357086.1| hypothetical protein Pcar_1672 [Pelobacter carbinolicus DSM 2380]
 gi|77545354|gb|ABA88916.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 395

 Score = 69.7 bits (169), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 110/225 (48%), Gaps = 11/225 (4%)

Query: 171 ARIAIVVSGLGISQTGTQR--AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           ARIAIVV  LG      +R  AI+L   ++T+A         +  + A + G+E ++ +P
Sbjct: 176 ARIAIVVDDLGRDLRMLRRLLAIDL---DLTMAVMPEEPHTLQSAELAHRAGREVLVHMP 232

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+      N      L + Q   ++  R+           G  N+ G+      E  +++
Sbjct: 233 MEPESYPRNNPGPGALLLGQDRLEIERRVTRMFENVPHAVGGNNHMGSRFTQYAEGLQIV 292

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           F+   K GL F D  +SP ++  + A +  +P +  D++LD+  + D I  +++   ++A
Sbjct: 293 FEVMKKNGLFFVDSRTSPGSVAFLEARRARIPAVSRDIFLDNSQNVDAIARQIREAVKMA 352

Query: 349 RTTGQAIGVAVAFDESIEVISQ---WLQQEHVRDVSVVPLSCLAK 390
           R+ G+ + +   + +++E + Q   +L+Q+   DV VVP+S L +
Sbjct: 353 RSRGKVVAICHPYPQTVEALQQEAAFLRQQ---DVEVVPVSRLLR 394


>gi|157736497|ref|YP_001489180.1| hypothetical protein Abu_0236 [Arcobacter butzleri RM4018]
 gi|157698351|gb|ABV66511.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 359

 Score = 69.7 bits (169), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 117/242 (48%), Gaps = 19/242 (7%)

Query: 140 SKKELLAKNKVGRE------DTEVPAMDKNFCSNASGA-RIAIVVSGLGISQTGTQRAIN 192
           +KKE     ++G E      +   P     +  N     +IAI++  + +S +   +  N
Sbjct: 107 NKKEYEQTTEIGEENIPLVEEKAAPIKKDTYVYNKKDKPKIAIIIDDV-VSDSQKSKISN 165

Query: 193 L-LPANITLAFASNGNSLDRWMKEAKKKGQEA---ILQIPMQAFDESYNEDDSYTLKVTQ 248
           +  P  IT+AF    N+     K++ K  Q     ++  P+QA   ++  ++  TLK+T 
Sbjct: 166 IGYP--ITMAFLPPTNT----HKDSAKIAQNVPFYMIHFPLQA-SSAFKGEEINTLKITD 218

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
           + + + NR++             N+ G++   N E+ + +FK   K   +F D  +S ++
Sbjct: 219 SYETIENRVKQLRNWYPNAKYTNNHTGSVFTENDEAMDKLFKALVKYNFIFVDSKTSAKS 278

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
           + +  A K NLPY+  +++LD++   + I+ +L    E+A+  G A+ +   +D +++V+
Sbjct: 279 VGQKYANKYNLPYISRNIFLDNEKSYEYIKAQLIKTVELAKKHGYAVAIGHPYDITLKVL 338

Query: 369 SQ 370
            +
Sbjct: 339 KE 340


>gi|95928784|ref|ZP_01311530.1| protein of unknown function DUF610, YibQ [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135129|gb|EAT16782.1| protein of unknown function DUF610, YibQ [Desulfuromonas
           acetoxidans DSM 684]
          Length = 328

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 99/226 (43%), Gaps = 3/226 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           ++AI++  +GI++     A+ L +P  + LA           M  A ++  E ++ IPM+
Sbjct: 94  KVAIIMDDIGINRAAALDALQLQMP--LALAIIPGEAHSTEIMNLAYQQHSEILIHIPME 151

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                 N      L V Q+  Q+  R+   +       G  N+ G+    + +    +  
Sbjct: 152 PVSYPKNNPGPLGLFVHQSDSQIKRRIDDIITALPYAIGGNNHMGSEFTQHADKLRPVLL 211

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              + GL F D  +S  ++    A KL L   + D++LD+    + I  +L  L  +A  
Sbjct: 212 ALKQSGLFFVDSLTSKDSVAYQQAQKLGLSCALRDVFLDNVRQVEPILFQLDRLVTLAHR 271

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            G AI +   + ++IE + Q++      DV +VP+S L     PSS
Sbjct: 272 HGSAIAICHPYPQTIEALQQFIADPQRFDVEIVPISQLVHPPVPSS 317


>gi|308272530|emb|CBX29134.1| hypothetical protein N47_J01150 [uncultured Desulfobacterium sp.]
          Length = 301

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 105/221 (47%), Gaps = 2/221 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AI++  +G      ++ + L  A  T +        +  ++ A+KKG+E +L +PM+  
Sbjct: 83  VAIIIDDIGYHPDLEKKYLEL-DAAFTFSVLPFSPYKNITIEAARKKGREIMLHLPMEPN 141

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           +          L  + +  QL++++   +       GV N+ G+ + ++      IF   
Sbjct: 142 EYPEISPGPGALLTSMSPDQLISQINEDIDDVPFIKGVNNHMGSKMSASDVQMNQIFSVL 201

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
             RGL F D  + P+   R  A    L +   D+++D + DR+ I+ ++  L +IA   G
Sbjct: 202 KARGLYFIDSKTGPKTYGRESARLFKLTFAERDVFIDHKQDREFIKNQIYELIKIANRHG 261

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +AI +   +  + +V+S+ L     + +++VP S + K SS
Sbjct: 262 KAIAIMHPYPLTYQVVSEMLPYMK-KKMNIVPASAIVKDSS 301


>gi|256830630|ref|YP_003159358.1| hypothetical protein Dbac_2867 [Desulfomicrobium baculatum DSM
           4028]
 gi|256579806|gb|ACU90942.1| protein of unknown function DUF610 YibQ [Desulfomicrobium baculatum
           DSM 4028]
          Length = 433

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 101/218 (46%), Gaps = 7/218 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   R+ I++  LG S    +R +  LP  ++ +   +     +    A+++  E +L +
Sbjct: 214 AKAPRLVIIIDDLGESMAVAKR-LAALPFAVSFSVLPHNTKARQVSNLARQENLELLLHL 272

Query: 228 PMQ--AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           P +   + ++ N     TL+V  T   L   L  +L R     GV N+ G+ L  +K++ 
Sbjct: 273 PCEPEGYPKTANSGPG-TLRVNMTPADLEQTLADNLARLPDVDGVNNHMGSRLTQDKKAM 331

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            ++      +G  F D  ++P++  R ++  L + Y    ++LD+      +  +LK  E
Sbjct: 332 TIVLGHLQGQGKFFVDSLTTPKSCVRDVSNTLGMRYYRRHIFLDNTAKEHAVLLQLKKAE 391

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
            +A+ TG A+ +   +  ++  +  W +    RD++VV
Sbjct: 392 SLAKRTGLAVAIGHPYPATLSALESWAKS---RDMNVV 426


>gi|89094931|ref|ZP_01167862.1| hypothetical protein MED92_00710 [Oceanospirillum sp. MED92]
 gi|89080797|gb|EAR60038.1| hypothetical protein MED92_00710 [Oceanospirillum sp. MED92]
          Length = 277

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 98/210 (46%), Gaps = 23/210 (10%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ-- 230
           +AIV+  +G ++     AI L P  IT AF  +        K A   G+E IL  PM+  
Sbjct: 30  MAIVIDDIGDNRKKGLAAIEL-PGAITYAFLPHTPHSFELAKTAHFLGKEVILHAPMENK 88

Query: 231 --------AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
                   A    +N     T ++   +   L+ + Y++       G+ N+ G++L  ++
Sbjct: 89  AGLRLGPGALTHRHN-----TAELQHILGDGLDSIPYAV-------GMNNHMGSLLTEDR 136

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           E    I +   +R + F D  ++ + +   +A +  +PY+V D++LD++ +   I  + K
Sbjct: 137 EKMRDIMRVVKQRNMFFLDSMTTSKTVAWKVAHEYGIPYLVRDVFLDNRQEWGYIHNQFK 196

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWL 372
               +A T G A+ +   + E++E +S+ L
Sbjct: 197 QAVSLAVTQGHAVVIGHPYPETVEYLSEAL 226


>gi|317128473|ref|YP_004094755.1| hypothetical protein Bcell_1761 [Bacillus cellulosilyticus DSM
           2522]
 gi|315473421|gb|ADU30024.1| protein of unknown function DUF610 YibQ [Bacillus cellulosilyticus
           DSM 2522]
          Length = 266

 Score = 68.6 bits (166), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 104/227 (45%), Gaps = 7/227 (3%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           N S  R AI++   G +  G +  +N  +P  IT+A     +      K A + G E I+
Sbjct: 27  NHSVYRAAIIIDDFGGNTGGVKEFMNADVP--ITMAIMPFLDESTEQAKRANELGFEVII 84

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +P++      +      +       ++  R+  ++       G+ N+ G+ ++ N+   
Sbjct: 85  HMPLEPKKGKRSWLGPLPITADLETDEVKRRVEKAIENVPHAKGINNHMGSKIVGNERIV 144

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV-DRDKIREKLKGL 344
             I +   K GL   D G+S  ++   +A +LN+PY + D +LDD    R+ + +++  L
Sbjct: 145 RAILEVAKKHGLYVIDSGTSGDSVVPEIAEELNIPYGIRDTFLDDSFSSRNHVYKQMIKL 204

Query: 345 EEIARTTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +I +  GQAI    V V  +++   I   L     +++ +VP+S L
Sbjct: 205 CDIVKKHGQAIAIGHVGVKGNDTFNGIQDALPHLEEKNIQIVPMSHL 251


>gi|78223057|ref|YP_384804.1| hypothetical protein Gmet_1850 [Geobacter metallireducens GS-15]
 gi|78194312|gb|ABB32079.1| protein of unknown function DUF610, YibQ [Geobacter metallireducens
           GS-15]
          Length = 320

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 107/225 (47%), Gaps = 9/225 (4%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFA--SNGNSLDRWMKEAKKKGQEAIL 225
           A    +AI++  +G    G Q A +++   + + F+       + +  +EA+++G EA++
Sbjct: 99  AGSGNLAIIIDDMG---KGMQEARSIIDIGVPVTFSIIPGLPKVRQVAQEAQRRGIEAMI 155

Query: 226 QIPMQ--AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
            +PM+   + E   E++   L  +Q+  +++ R+    +      G  N+ G+    NKE
Sbjct: 156 HLPMEPKGYPERRLEENGLLL--SQSNDEIVVRMNGYFKEVPQAVGANNHMGSAFTENKE 213

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
              ++ +   ++GL F D  +S  ++    A ++ L      ++LD+  D   I ++++ 
Sbjct: 214 KMAIVLRVLKEKGLFFVDSKTSAISVGESTAREMGLRTASRSVFLDNIQDVGYISKQIRQ 273

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              IAR  G AI +      +I+ ++  L +     V++VP S L
Sbjct: 274 AASIARKRGSAIAICHPHPATIQALAAELPKLRDEGVTLVPASSL 318


>gi|258542077|ref|YP_003187510.1| hypothetical protein APA01_09810 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633155|dbj|BAH99130.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636212|dbj|BAI02181.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639267|dbj|BAI05229.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642321|dbj|BAI08276.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645376|dbj|BAI11324.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648431|dbj|BAI14372.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651484|dbj|BAI17418.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654475|dbj|BAI20402.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 363

 Score = 67.4 bits (163), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 103/220 (46%), Gaps = 15/220 (6%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A+++ G+  +   T  AIN LP  ++L  +    + +  M  A++   E +L +P+Q  
Sbjct: 116 VALLIDGIDQTDDLTTEAINSLPGPVSLGISPYAANPEELMNAARQHRHETLLSLPIQDN 175

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY---RGAMLLSNKESAEVIF 289
                +     L +  + QQ ++ L ++L    GY GV N    +        ES + + 
Sbjct: 176 ATKNTDAGPKALGLLLSPQQNMDNLNWALSHLAGYVGVTNAFAGQNGGSFPQSESFKSLV 235

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           K   +RGLL+ D  ++P   T   +         AD+ ++   D   I  +L  L+++AR
Sbjct: 236 KAIDQRGLLYLD--ATPGTQTEGASST-----ATADVVVNTDTDIVNIDIQLLKLQQLAR 288

Query: 350 TTGQAIGVAVAFDE-SIEVISQWLQQEHVRD--VSVVPLS 386
             G+AIG+       ++  +  WL   H++D  +++VP+S
Sbjct: 289 QNGRAIGILGPLRPVAMACLRAWL--PHLKDMGIALVPVS 326


>gi|323141912|ref|ZP_08076773.1| divergent polysaccharide deacetylase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413659|gb|EFY04517.1| divergent polysaccharide deacetylase [Phascolarctobacterium sp. YIT
           12067]
          Length = 423

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 106/220 (48%), Gaps = 5/220 (2%)

Query: 171 ARIAIVVSGLGISQTGTQRAINL-LPANIT-LAFASNGNSLDRWMKEAKKKGQEAILQIP 228
            ++AIV+   G      ++ +N  LP +   L +    + +   ++  K KG+  +L +P
Sbjct: 205 GKVAIVIDDCGYDMAPVRKLLNTGLPFSYAILPYKQYSSDV---LEMVKAKGRVPMLHLP 261

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+  D S   + + T++   +  + L+  R +L    G  GV N++G+   ++K++  V+
Sbjct: 262 MEPIDRSAMSEGAATIRTDLSAAEKLSLTRRALNSLPGVMGVNNHQGSKATADKDTMRVV 321

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +E  ++ L F D  ++  ++ R +A +L++     D++LD+  D   IR+++     +A
Sbjct: 322 LQELRRQKLFFVDSRTNSASVARNMAQQLDVSTARNDIFLDNSSDVQAIRQQIYKAFAMA 381

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              G  I +  A   + +    +  +     ++ VP++ L
Sbjct: 382 EKNGSVIAICHARPNTAKCWEMYAAEFKRTGITFVPVTEL 421


>gi|163749815|ref|ZP_02157060.1| hypothetical protein KT99_01686 [Shewanella benthica KT99]
 gi|161330329|gb|EDQ01308.1| hypothetical protein KT99_01686 [Shewanella benthica KT99]
          Length = 256

 Score = 67.0 bits (162), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 107/241 (44%), Gaps = 29/241 (12%)

Query: 164 FC-------SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASN---GNSLDRWM 213
           FC       S  + A++AI++  +G  Q+    A+  LP NITL+   +   GNS+    
Sbjct: 6   FCFALIFPGSYVNAAQVAIIIDDIGYRQS--DEAVLTLPDNITLSILPHTPLGNSVAHI- 62

Query: 214 KEAKKKGQEAILQIPMQAFDE------SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
             A ++G E +L +PMQA +           D S T  + QT+ Q    + ++       
Sbjct: 63  --AHERGYEVMLHLPMQALNGKKLGPGGITNDMSET-DIKQTISQAFENIPFAK------ 113

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            G  N+ G++L    E  + + +   +  L F D  ++        A KL +P +   ++
Sbjct: 114 -GANNHMGSLLTQLDEPMQWVMESLKQHHLYFVDSMTTRYTKAGSTADKLGIPQLKRQIF 172

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           LD+ V    + ++ + L  +A   GQ + +A    E+IE +   L +     +S+V  S 
Sbjct: 173 LDNDVSPAGLNQQFERLIALAHRQGQVVAIAHPHPETIEYLKLNLPRLQQEGISLVKTSE 232

Query: 388 L 388
           L
Sbjct: 233 L 233


>gi|104779656|ref|YP_606154.1| hypothetical protein PSEEN0377 [Pseudomonas entomophila L48]
 gi|95108643|emb|CAK13337.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 254

 Score = 66.6 bits (161), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 48/215 (22%), Positives = 100/215 (46%), Gaps = 7/215 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A ++I++  LG S     R + L P  +T+A   +      + ++A K G+  IL +PM 
Sbjct: 23  AYMSIIIDDLGQSDERDSRTLAL-PGPVTMAIMPDTPHATDFARQAHKAGRTVILHMPMD 81

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                      Y       +++L  RL  +L +     G+ N+ G+ + + +E    +  
Sbjct: 82  P------ATGPYAWHPGTAIEELARRLDAALAKVPYAAGINNHMGSRMTAQREPMHWLMA 135

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S   +    A  + L ++  D++LDD    + I  +L+   ++AR 
Sbjct: 136 ELQRRHLFFVDSRTSAATVAAAEAQAVGLAHVSRDVFLDDVRTVEAINGQLQQGIDLARK 195

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
            G A+ +   + ++++V+S+ + +   + + +V L
Sbjct: 196 QGSAVLIGHPYPQTLDVLSREIPKLKAQGIELVSL 230


>gi|46205339|ref|ZP_00048666.2| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 143

 Score = 66.2 bits (160), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 65/127 (51%)

Query: 261 LRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLP 320
           + R  G+ GV+N  GA L++   + + + K+ A RGL F DDG+ PR+     A K  LP
Sbjct: 1   MSRFPGFVGVVNAMGAKLMNEASALDPVLKDLAARGLGFVDDGTVPRSQLAGAAAKAKLP 60

Query: 321 YMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDV 380
              A+  +D     D I  +L  LE +AR  G  +    A   +I+ +S+W +    R V
Sbjct: 61  SARAESVIDAVARPDAIDAELTRLETLARQKGFVLASGSASPMTIDRLSRWSRDLETRGV 120

Query: 381 SVVPLSC 387
            +VP+S 
Sbjct: 121 RLVPVSV 127


>gi|149193944|ref|ZP_01871042.1| hypothetical protein CMTB2_02628 [Caminibacter mediatlanticus TB-2]
 gi|149135897|gb|EDM24375.1| hypothetical protein CMTB2_02628 [Caminibacter mediatlanticus TB-2]
          Length = 332

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 101/200 (50%), Gaps = 5/200 (2%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           I  +P  IT +F    N     +  AK      ++ +P++A  ++Y++ +  T+ ++ T 
Sbjct: 137 IKQIPYKITPSFFPPTNRHPNTIYLAKS-FSHYMVHLPLEA--KNYHKPEPNTITISSTY 193

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
           Q++ NR+ Y  +       + N+ G+   S+KES + +FK F K  L F D  +S     
Sbjct: 194 QEIYNRIVYLKKIFPKAKFMNNHTGSTFTSDKESMKKLFKVFKKENLGFVDSVTSANTKG 253

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
            ++    N+P+   +++LD+  D++ IR++L     +A+  G AI  A+     I +I+ 
Sbjct: 254 ELVDKIYNIPFYKRNIFLDNIQDKNYIRKQLLKAVMLAKKHGYAI--AIGHPHKITLITL 311

Query: 371 WLQQEHVRDVSVVPLSCLAK 390
              ++ +++V VV +  L K
Sbjct: 312 KNSKDILKNVDVVYIDELNK 331


>gi|302343200|ref|YP_003807729.1| hypothetical protein Deba_1768 [Desulfarculus baarsii DSM 2075]
 gi|301639813|gb|ADK85135.1| protein of unknown function DUF610 YibQ [Desulfarculus baarsii DSM
           2075]
          Length = 360

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 6/190 (3%)

Query: 200 LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRY 259
           L F+ +G  + R    AK +G++ +L +PM+             L V    Q L  +   
Sbjct: 174 LPFSPHGRQVARM---AKARGRQVLLHLPMEPKSFPRLSPGPGALLVEADEQALARQTAA 230

Query: 260 SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNL 319
            L       GV N+ G+    +  +   +  +  +RGL F D  +SPR+    +A +L L
Sbjct: 231 DLDFLPEAVGVNNHMGSRFTEDATALRPVMTQIGRRGLFFVDSLTSPRSAAYDVAGQLGL 290

Query: 320 PYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVR- 378
                D++LD +VD   IR +++GL  +AR     I +      +I+ +  +  QE +R 
Sbjct: 291 RRARRDMFLDHEVDEQAIRRQIEGLIHLARGGHPVIAIGHPHQATIKALRHY--QERLRQ 348

Query: 379 DVSVVPLSCL 388
           +V + P+S L
Sbjct: 349 EVRLRPVSEL 358


>gi|56459342|ref|YP_154623.1| hypothetical protein IL0231 [Idiomarina loihiensis L2TR]
 gi|56178352|gb|AAV81074.1| Conserved protein [Idiomarina loihiensis L2TR]
          Length = 251

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 105/226 (46%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  ++IAIV+  +G ++   + A  LLP NI+ A          +      + ++ +L +
Sbjct: 18  AYASKIAIVIDDIGNNKNDLKAA--LLPGNISFAVLPYTPYARAFALRGHHQKKQILLHM 75

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+A +   N      +       Q+  +L  +L       GV N+ G+ L       + 
Sbjct: 76  PMEAVEN--NRPGPGVVTADMNNAQIKLQLVDALDSIPYVTGVNNHMGSKLTQLHMPMQA 133

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  A R L F D  +S  ++   +A +  +      ++LD+QVD   ++++ + L  I
Sbjct: 134 VMETLASRKLFFIDSRTSEFSVAEQMAGEFGVRTSHRHVFLDNQVDEPYLQQQFEQLLSI 193

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           A+  GQAIG+   + E++  + + L Q   + + +V +S L  +++
Sbjct: 194 AKRQGQAIGIGHPYPETLSFLQKQLPQLQEQGIELVFVSELTTVAN 239


>gi|282600473|ref|ZP_05974435.2| YibQ protein [Providencia rustigianii DSM 4541]
 gi|282565189|gb|EFB70724.1| YibQ protein [Providencia rustigianii DSM 4541]
          Length = 364

 Score = 65.1 bits (157), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 102/225 (45%), Gaps = 4/225 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            CS AS A++AIV+   G  +      I  +PA I++A   N         +A ++G++ 
Sbjct: 35  ICSQASAAKLAIVIDDFGY-RAKEDNQILAMPAAISIAILPNSPHGIEVATQAYQQGRDI 93

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E D  TL  + + + +   ++ ++ R     G+ N+ G+ + S+  
Sbjct: 94  LIHMPMKPLSKQPLEKD--TLTPSMSAEDVDRIIKNAISRVPHAKGMNNHMGSEMTSSLS 151

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +  ++  L F D  +      +  A +  +P    ++++D+    ++ R +L  
Sbjct: 152 GMRNVMRSLSQSNLFFLDSVTIGNTQAQNAAKEFGVPSTKRNIFIDNHQSEEETRAQLNK 211

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
               AR  G A+ +      ++  + +++      DV +VP+S L
Sbjct: 212 AISYARKHGSAVAIGHPHPSTVRALQKFIPLIPA-DVELVPVSTL 255


>gi|152994760|ref|YP_001339595.1| hypothetical protein Mmwyl1_0726 [Marinomonas sp. MWYL1]
 gi|150835684|gb|ABR69660.1| protein of unknown function DUF610 YibQ [Marinomonas sp. MWYL1]
          Length = 392

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 117/263 (44%), Gaps = 6/263 (2%)

Query: 131 IEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRA 190
           IE +   G  K + L+K+    +   VPA       +    RIAI++  LG ++ G   +
Sbjct: 128 IESKPAGGFPKPDALSKSS---KKEVVPAKILAVDVHPKMPRIAILIDDLGYNRHGMDSS 184

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           + +LP  + LA   +          A+K+ +  +L  PM+   E          K+T+  
Sbjct: 185 L-MLPVEVALAILPSTPFAMETALTAQKQKRITLLHAPMENQRELKLGPGGLYAKMTE-- 241

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            +L   L   L    G  GV N+ G++L +  +S + + +    R L F D  +SP+++ 
Sbjct: 242 HELKATLSKDLDGLPGIQGVNNHMGSLLTTKADSMKWVMETLKGRSLFFIDSLTSPKSVA 301

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           +  A +  L  +  D++LD+      I ++   L ++AR  G A+ +   + E++  + +
Sbjct: 302 KKTAQEYGLETVSRDVFLDNIRTEQAIDKQFSRLLKLARLHGSALAIGHPYPETMAYLKK 361

Query: 371 WLQQEHVRDVSVVPLSCLAKLSS 393
            L       V +V LS L   SS
Sbjct: 362 RLNHLEQDGVRLVRLSDLLTASS 384


>gi|189424978|ref|YP_001952155.1| hypothetical protein Glov_1919 [Geobacter lovleyi SZ]
 gi|189421237|gb|ACD95635.1| protein of unknown function DUF610 YibQ [Geobacter lovleyi SZ]
          Length = 334

 Score = 64.7 bits (156), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 104/223 (46%), Gaps = 5/223 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFAS-NGNSLDRWMKE-AKKKGQEAIL 225
           A  A +A++V  +G S    Q A +L    + + FA   G   DR +   A  KG E +L
Sbjct: 111 AGRAELAVIVDDMGSS---LQEARSLAAIGLPINFAIIPGLRHDREVALFATGKGIEVLL 167

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQ  +      +   L + Q+ ++L +R+R  L       G  N+ G+    N +  
Sbjct: 168 HMPMQPKEYPQRRLEPNGLLLDQSDEELRSRVRGYLELLPQAVGANNHMGSGFTENADKM 227

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            V+     + GL F D  ++P+     +A ++ L     D++LD++ + + IR +L    
Sbjct: 228 RVVLNVLKEHGLFFVDSITTPKTTGLKVAAEIKLASARRDVFLDNEQNEEYIRGQLNQAV 287

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             AR  G+AI +      ++  +++ L +   + +S+V ++ L
Sbjct: 288 ARARKNGRAIAICHPHPVTVATLTKALPELQSKGISLVKVTRL 330


>gi|157377603|ref|YP_001476203.1| protein of unknown function DUF610, YibQ [Shewanella sediminis
           HAW-EB3]
 gi|157319977|gb|ABV39075.1| protein of unknown function DUF610, YibQ [Shewanella sediminis
           HAW-EB3]
          Length = 253

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 102/228 (44%), Gaps = 18/228 (7%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  +++AI++  +G  Q+    A+  LP  +T +   +        K+A   G E +L +
Sbjct: 17  AEASQVAIIIDDIGYRQS--DEAVLSLPNTVTFSVLPHTPLGSEVAKKAHNMGHEIMLHL 74

Query: 228 PMQAFDESY-------NEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           PMQA +          N  D   LK   T+++  + + Y+        G  N+ G++L  
Sbjct: 75  PMQALNGKTMGPGGLTNTMDEAELK--HTLEKAFDNIPYAK-------GANNHMGSLLTQ 125

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
             E    + +   +R L F D  ++        A +L +P +   ++LD+ V +  + E+
Sbjct: 126 LDEPMLWVMESLKQRELYFVDSMTTRFTKASNKAEQLGIPLLRRQVFLDNDVSQSALEER 185

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            + L  +A   GQA+ +A  + E+I+ + + L +     + +V  S L
Sbjct: 186 FEHLISLAHKQGQAVAIAHPYPETIKFLKRNLHRLDKAGIELVKTSSL 233


>gi|296274361|ref|YP_003656992.1| hypothetical protein Arnit_2837 [Arcobacter nitrofigilis DSM 7299]
 gi|296098535|gb|ADG94485.1| protein of unknown function DUF610 YibQ [Arcobacter nitrofigilis
           DSM 7299]
          Length = 388

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 87/168 (51%), Gaps = 6/168 (3%)

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
           A++  P+QA   S   ++  TLKV  + +++  R+    +         N+ G++  S+K
Sbjct: 222 ALVHFPLQAGITSIKFEEQNTLKVGDSYEKIEKRVAQIRKWYPKIKYTNNHTGSVFTSDK 281

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            S E + K   K    F D  ++  ++ R +  +  +PY+  +++LD+  D + I+ +LK
Sbjct: 282 TSMEYLIKALKKYNFQFIDSRTTSHSVVREVTKEFGMPYIARNIFLDNNKDFNYIQNQLK 341

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVI--SQWLQQEHVRDVSVVPLSCL 388
               IA+ TG AI +   +  ++EV+  S++L    ++D+ +V ++ L
Sbjct: 342 KAIRIAKKTGSAIAIGHPYPITMEVLKKSKYL----LKDLDLVYINKL 385


>gi|229016679|ref|ZP_04173614.1| hypothetical protein bcere0030_12500 [Bacillus cereus AH1273]
 gi|228744615|gb|EEL94682.1| hypothetical protein bcere0030_12500 [Bacillus cereus AH1273]
          Length = 256

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 78/165 (47%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT R ++L P  +T+A      S  +    A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTDRMLSL-PIPLTIAVMPFLPSTKQDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIRGKKEWLGPKAITTDLSDEEINNRLEQAIQEIPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILSACKKHGLFYLDSKTNPNSVVPKIGKELGVPVIENQLFFDD 187


>gi|229102031|ref|ZP_04232744.1| hypothetical protein bcere0019_11960 [Bacillus cereus Rock3-28]
 gi|228681418|gb|EEL35582.1| hypothetical protein bcere0019_11960 [Bacillus cereus Rock3-28]
          Length = 256

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             L    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKALTTDLSDEEINNRLEQAIKEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILTACKKHGLFYLDSKTNPNSVVPQIGKELGVPIIENQLFFDD 187


>gi|229095918|ref|ZP_04226896.1| hypothetical protein bcere0020_11690 [Bacillus cereus Rock3-29]
 gi|229114870|ref|ZP_04244283.1| hypothetical protein bcere0017_11670 [Bacillus cereus Rock1-3]
 gi|228668562|gb|EEL23991.1| hypothetical protein bcere0017_11670 [Bacillus cereus Rock1-3]
 gi|228687542|gb|EEL41442.1| hypothetical protein bcere0020_11690 [Bacillus cereus Rock3-29]
          Length = 256

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             L    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKALTTDLSDEEINNRLEQAIKEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILTACKKHGLFYLDSKTNPNSVVPQIGKELGVPIIENQLFFDD 187


>gi|222055713|ref|YP_002538075.1| protein of unknown function DUF610 YibQ [Geobacter sp. FRC-32]
 gi|221565002|gb|ACM20974.1| protein of unknown function DUF610 YibQ [Geobacter sp. FRC-32]
          Length = 314

 Score = 64.3 bits (155), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 106/215 (49%), Gaps = 9/215 (4%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFAS-NGNSLDRWMKE-AKKKGQEAILQIPM- 229
           +AI++  +G S   T+ A +LL  N+ + FA   G +  R + E A  +G E ++ IPM 
Sbjct: 98  VAIIIDDMGRS---TREADSLLAINLPITFAIIPGYAKARAVAEIAHGRGGEVMVHIPME 154

Query: 230 -QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
            Q + E   E +   L   ++ +Q+ ++++  L+      G  N+ G+    ++E  + +
Sbjct: 155 PQGYPEKKMEKNGLLL--GESNEQIASKVKGYLQEIPYAVGANNHMGSRFTESEEKMQPV 212

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +   ++GL F D  +SP++    LA K+ L      ++LD+  +   I  +L+ + + A
Sbjct: 213 LQILQEKGLFFVDSMTSPKSAGFRLARKMGLKSGTRQVFLDNVQNVQAINAQLQQVADAA 272

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
           R  G AI +      +I+ +S  + Q   + ++ V
Sbjct: 273 RRRGSAIAICHPHRTTIQALSGMMPQLKKQGITFV 307


>gi|330987186|gb|EGH85289.1| yibQ gene product [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 260

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 94/204 (46%), Gaps = 7/204 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R + L P  +TLA   +      + +EA + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPARDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMAWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAINRQLQSAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQ 374
            G A+ +   +  +++V+ + L +
Sbjct: 204 HGSAVVIGHPYPVTLDVLERELPK 227


>gi|167036099|ref|YP_001671330.1| hypothetical protein PputGB1_5110 [Pseudomonas putida GB-1]
 gi|166862587|gb|ABZ00995.1| protein of unknown function DUF610 YibQ [Pseudomonas putida GB-1]
          Length = 259

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 98/213 (46%), Gaps = 7/213 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           ++I++  LG S     R + L P  +T+A   +      + ++A + G+  IL +PM   
Sbjct: 30  LSIIIDDLGQSSERDNRTLAL-PGPVTMAIMPDTPHASDFARQAHRAGKTVILHMPMDPA 88

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y       L       +L +RL+ +L +     G+ N+ G+ + + +E    +  E 
Sbjct: 89  TGPYAWHPGAPLP------ELASRLQAALAKVPYAAGINNHMGSRMTAQREPMVWLMGEL 142

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +R L F D  +S   +    A ++ L ++  D++LDD    + I  +L+    +AR  G
Sbjct: 143 QQRHLFFVDSRTSAATVAAAEAQRIGLAHVSRDVFLDDVRTPEAIAAQLQQGVALARKQG 202

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
            A+ +   + ++++V+   +     + + ++PL
Sbjct: 203 SAVLIGHPYPQTLQVLESAMPGLKHQGIELIPL 235


>gi|71736710|ref|YP_277009.1| yibQ gene product [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257483742|ref|ZP_05637783.1| yibQ gene product [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71557263|gb|AAZ36474.1| yibQ gene product [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320326473|gb|EFW82525.1| YibQ [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331766|gb|EFW87704.1| YibQ [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330872598|gb|EGH06747.1| YibO protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|331012105|gb|EGH92161.1| YibO protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 260

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 94/204 (46%), Gaps = 7/204 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R +  LP  +TLA   +      + +EA + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPARDSRTL-ALPGPVTLAIMPDTPHATEFAREAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMAWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAINRQLQSAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQ 374
            G A+ +   +  +++V+ + L +
Sbjct: 204 HGSAVVIGHPYPVTLDVLERELPK 227


>gi|289649391|ref|ZP_06480734.1| yibQ gene product [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 260

 Score = 63.9 bits (154), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 94/204 (46%), Gaps = 7/204 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R + L P  +TLA   +      + +EA + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPARDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMAWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAINRQLQSAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQ 374
            G A+ +   +  +++V+ + L +
Sbjct: 204 HGSAVVIGHPYPVTLDVLERELPK 227


>gi|167621981|ref|YP_001672275.1| hypothetical protein Shal_0040 [Shewanella halifaxensis HAW-EB4]
 gi|167352003|gb|ABZ74616.1| protein of unknown function DUF610 YibQ [Shewanella halifaxensis
           HAW-EB4]
          Length = 230

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 103/219 (47%), Gaps = 10/219 (4%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASN---GNSLDRWMKEAKKKGQEAILQIPM 229
           +AI++  LG  Q+   +A+  LPANITL+   +   G SL R   EA  +G E ++ +PM
Sbjct: 1   MAIIIDDLGYRQS--DKAVLSLPANITLSILPHTPLGQSLAR---EAYLQGNEVLVHLPM 55

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           QA +       + T  +++T  +L  ++  S+       G  N+ G++L         + 
Sbjct: 56  QALNGKAIGPGALTNTMSET--ELKTQIADSINSVPNASGANNHMGSLLTQLNSPMRWVM 113

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  ++       +A  + +P +  +++LD+      + ++      +A 
Sbjct: 114 ESLQQHNLYFIDSMTTKYTRAGAIAESMGVPLLRREIFLDNDRSPAGLEKQFNYAISLAH 173

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           T    + +A  + E+IE +++ L +    ++ +VP S L
Sbjct: 174 TKRNIVVIAHPYPETIEFLNENLHRLQSSNIDLVPTSQL 212


>gi|114569952|ref|YP_756632.1| hypothetical protein Mmar10_1402 [Maricaulis maris MCS10]
 gi|114340414|gb|ABI65694.1| protein of unknown function DUF610, YibQ [Maricaulis maris MCS10]
          Length = 350

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 94/218 (43%), Gaps = 3/218 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +I +V+  +G+     +R + L P  +T+A      +       A+  G + +L +PM+ 
Sbjct: 113 QIVLVIDDVGLDVAAAERVVAL-PIPLTVAILPYAEASAELAALARLNGHDVLLHMPMEP 171

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 +     L++  +   L  R+R+ + R  G  G+ N+ G+   ++  +  V    
Sbjct: 172 V--GLADPGPNALRIGLSDVDLQTRVRWGMARVPGAIGLNNHMGSRFTADPRALRVALSA 229

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +    LF D  ++  +  R +A  L L  +  D++LD     + I  +L    E+AR  
Sbjct: 230 VSHTNPLFLDSLTTGESRGRAVAAGLGLRALERDIFLDHDRSAEAIEARLADAAELARQD 289

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           G A+ +      +++ ++ WL+    + +  V    LA
Sbjct: 290 GFAVVIGHPHTLTLDTLTAWLESPAAQGIDFVTAGTLA 327


>gi|229160384|ref|ZP_04288382.1| hypothetical protein bcere0009_11780 [Bacillus cereus R309803]
 gi|228623108|gb|EEK79936.1| hypothetical protein bcere0009_11780 [Bacillus cereus R309803]
          Length = 244

 Score = 63.5 bits (153), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 12  ANAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 70

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 71  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ + L 
Sbjct: 131 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGHISKQAQLL- 189

Query: 346 EIARTTGQAIGVAVA 360
            I +   + I VA+ 
Sbjct: 190 -IKKIQEKPIMVAIG 203


>gi|302391080|ref|YP_003826900.1| hypothetical protein Acear_0286 [Acetohalobium arabaticum DSM 5501]
 gi|302203157|gb|ADL11835.1| protein of unknown function DUF610 YibQ [Acetohalobium arabaticum
           DSM 5501]
          Length = 380

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 109/223 (48%), Gaps = 8/223 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINL-LPANIT-LAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           AR+A ++  LG ++ GT   + +  P  +  L F     S     ++A + G E +L +P
Sbjct: 163 ARMAFIIDDLGFNRDGTAELMEIDRPLTVAVLPFRPYSTSD---AEKAVQAGHEILLHLP 219

Query: 229 MQAFDE-SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           M+     S  E   YT    + ++  + +   SL  G    GV N+ G+ + ++ ++  V
Sbjct: 220 MEPSSPVSPGEGAIYTDMAPEEIRTTIQKGLASL--GVEVAGVNNHMGSKVTADNKTMSV 277

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +     ++ L F D  ++PR++    A ++   Y V  L++D+  D+++I ++++ L ++
Sbjct: 278 VLDYLHQQDLFFIDSSTAPRSVVPAAAREVGESYAVNHLFIDNIDDKERINKQIQYLADV 337

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           A   G+ I +      +I+ I + + +   + + +V +S L K
Sbjct: 338 ALKQGELITIGHIKPNTIQAIKELIPKLEEKGIQLVYVSELVK 380


>gi|298484779|ref|ZP_07002879.1| Putative periplasmic protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160633|gb|EFI01654.1| Putative periplasmic protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 260

 Score = 63.2 bits (152), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 94/204 (46%), Gaps = 7/204 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R + L P  +TLA   +      + +EA + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPARDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMTWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQ 374
            G A+ +   +  +++V+ + L +
Sbjct: 204 HGSAVVIGHPYPVTLDVLERELPK 227


>gi|83644204|ref|YP_432639.1| hypothetical protein HCH_01349 [Hahella chejuensis KCTC 2396]
 gi|83632247|gb|ABC28214.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 286

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 98/221 (44%), Gaps = 13/221 (5%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ-- 230
           IAI++  +G  Q   +RAI + PA +TL+F       +   + A   G+E +L IPM+  
Sbjct: 39  IAIIIDDMGNYQNMGERAIRI-PAPLTLSFLPFRPHTNSQARLAYAAGKEIMLHIPMENV 97

Query: 231 ---AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
                  S    D  +  +  T +Q +  + Y         GV N+ G+ L  N+ +  +
Sbjct: 98  KRIPLGASGLTSDMSSQNMVATFRQAIKAIPY-------VSGVNNHMGSALTQNRAAMNL 150

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  E     L F D  ++  ++   +A    +P +  D++LD  +    I  + K L +I
Sbjct: 151 VMGELQGYPLYFVDSRTTASSVAHAVAANHAIPTLNRDVFLDHVITTKAIDFQFKRLLDI 210

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           AR  G AI +     E+IE + + L     + V++  +  L
Sbjct: 211 ARKKGTAIAIGHPHRETIEYLEKVLPSLGEQGVAIATIKGL 251


>gi|298505881|gb|ADI84604.1| divergent polysaccharide deacetylase domain protein [Geobacter
           sulfurreducens KN400]
          Length = 295

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 101/220 (45%), Gaps = 5/220 (2%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFA--SNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +A+++  +G    G   A  L+   I L FA       + R  +EA+++G E ++ +PM+
Sbjct: 79  LAVIIDDMG---KGLPEARALMDIGIPLTFAIIPGLPKVRRVAEEARQRGIEVMVHLPME 135

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                    ++  L ++Q   ++  R+   L       G  N+ G+    N++   V+  
Sbjct: 136 PKGYPERRLEANGLLLSQGDDEIAGRVNGYLNEIPQAVGANNHMGSGFTENRQKMAVVMG 195

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              +RGL F D  +SP ++   +A ++ +   V +++LD+  +   I  +L+    IAR 
Sbjct: 196 VLKERGLFFVDSKTSPVSVGDAVAREMGVRTAVRNVFLDNIQESGYITNQLRQAASIARK 255

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            G AI +      +I+ ++  L +     ++ V +S L +
Sbjct: 256 RGNAIAICHPHPATIQTLAVELPRLRDEGITFVTVSRLVR 295


>gi|39996868|ref|NP_952819.1| hypothetical protein GSU1769 [Geobacter sulfurreducens PCA]
 gi|39983756|gb|AAR35146.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
          Length = 290

 Score = 63.2 bits (152), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 101/220 (45%), Gaps = 5/220 (2%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFA--SNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +A+++  +G    G   A  L+   I L FA       + R  +EA+++G E ++ +PM+
Sbjct: 74  LAVIIDDMG---KGLPEARALMDIGIPLTFAIIPGLPKVRRVAEEARQRGIEVMVHLPME 130

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                    ++  L ++Q   ++  R+   L       G  N+ G+    N++   V+  
Sbjct: 131 PKGYPERRLEANGLLLSQGDDEIAGRVNGYLNEIPQAVGANNHMGSGFTENRQKMAVVMG 190

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              +RGL F D  +SP ++   +A ++ +   V +++LD+  +   I  +L+    IAR 
Sbjct: 191 VLKERGLFFVDSKTSPVSVGDAVAREMGVRTAVRNVFLDNIQESGYITNQLRQAASIARK 250

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            G AI +      +I+ ++  L +     ++ V +S L +
Sbjct: 251 RGNAIAICHPHPATIQTLAVELPRLRDEGITFVTVSRLVR 290


>gi|302187492|ref|ZP_07264165.1| hypothetical protein Psyrps6_14148 [Pseudomonas syringae pv.
           syringae 642]
          Length = 260

 Score = 62.8 bits (151), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 98/218 (44%), Gaps = 7/218 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R + L P  +TLA   +      + +EA + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPQRDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMTWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            G A+ +   +  +++V+ + L     + V  + L  +
Sbjct: 204 YGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSM 241


>gi|229108888|ref|ZP_04238492.1| hypothetical protein bcere0018_11640 [Bacillus cereus Rock1-15]
 gi|228674544|gb|EEL29784.1| hypothetical protein bcere0018_11640 [Bacillus cereus Rock1-15]
          Length = 256

 Score = 62.8 bits (151), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKITADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ + L 
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGHISKQAQLL- 201

Query: 346 EIARTTGQAIGVAVA 360
            I +   + I VA+ 
Sbjct: 202 -IKKIQEKPIMVAIG 215


>gi|229043173|ref|ZP_04190897.1| hypothetical protein bcere0027_12270 [Bacillus cereus AH676]
 gi|228726180|gb|EEL77413.1| hypothetical protein bcere0027_12270 [Bacillus cereus AH676]
          Length = 256

 Score = 62.8 bits (151), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAIMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ + L 
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGHISKQAQLL- 201

Query: 346 EIARTTGQAIGVAVA 360
            I +   + I VA+ 
Sbjct: 202 -IKKIQEKPIMVAIG 215


>gi|303246510|ref|ZP_07332789.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           fructosovorans JJ]
 gi|302492220|gb|EFL52095.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           fructosovorans JJ]
          Length = 374

 Score = 62.8 bits (151), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 94/225 (41%), Gaps = 6/225 (2%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A G R+ +V+  +G +    +R + L P  +TLA   N         E    G E IL 
Sbjct: 151 TAKGPRMVVVIDDIGDNPVMARRLMEL-PFPVTLAILPNRPHTRSLAAEIAAHGNETILH 209

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ             L      +++   L  ++ +     G+ N+ G+   S++   +
Sbjct: 210 QPMQPISYPRVNPGPGALFTDMDTRRIQTTLSENIAQLPHIVGINNHMGSAFTSDQAGMD 269

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +       GL F D  +SP +     A K  + Y    ++LD+  +   I  +LK  E 
Sbjct: 270 AVMPVLKAHGLFFMDSVTSPASAAAEAARKAGVHYYRRAVFLDNVRNVRTILGQLKTAER 329

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRD--VSVVPLSCLA 389
            A   G+AI +   ++E+ E +  W ++   RD  VS+V L+ L 
Sbjct: 330 HALKHGRAIAIGHPYNETYEALLLWAKE---RDPHVSLVTLTELG 371


>gi|163939239|ref|YP_001644123.1| protein of unknown function DUF610 YibQ [Bacillus
           weihenstephanensis KBAB4]
 gi|229010728|ref|ZP_04167925.1| hypothetical protein bmyco0001_11830 [Bacillus mycoides DSM 2048]
 gi|229166266|ref|ZP_04294025.1| hypothetical protein bcere0007_12400 [Bacillus cereus AH621]
 gi|163861436|gb|ABY42495.1| protein of unknown function DUF610 YibQ [Bacillus
           weihenstephanensis KBAB4]
 gi|228617211|gb|EEK74277.1| hypothetical protein bcere0007_12400 [Bacillus cereus AH621]
 gi|228750402|gb|EEM00231.1| hypothetical protein bmyco0001_11830 [Bacillus mycoides DSM 2048]
          Length = 256

 Score = 62.8 bits (151), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 90/195 (46%), Gaps = 3/195 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S  +    A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKQDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIRGKKEWLGPKAITTDLSDEEINNRLEQAIQEIPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ + L 
Sbjct: 143 RLILSACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTVSHISKQAQLL- 201

Query: 346 EIARTTGQAIGVAVA 360
            I +   + I VA+ 
Sbjct: 202 -IKKIQDKPIMVAIG 215


>gi|114321714|ref|YP_743397.1| protein of unknown function DUF610, YibQ [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114228108|gb|ABI57907.1| protein of unknown function DUF610, YibQ [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 264

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 98/221 (44%), Gaps = 4/221 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+A+V+  LG      QR ++L P  +T +   +     R  +   + G+E +L +PMQA
Sbjct: 38  RVAVVIDDLGDHLASGQRTVDL-PGPVTCSVLPHTPHARRLAEACHRSGKEVMLHMPMQA 96

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            + +        + + +T  +    +R  L       GV N+ G++   +  +   +   
Sbjct: 97  KNGADRGPGGVDIHMDRTAVEAA--VRKDLDAVPHARGVNNHMGSLYTRHPGNLRWVMDA 154

Query: 292 FAKRGLLFF-DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
               G  +F D  ++ R++   +A +  +P     ++LD   D + IR  L+ L   AR 
Sbjct: 155 LRGEGDYYFVDSRTTARSVAEQVAREAGVPATRRHVFLDHDRDPEMIRHHLERLVRHARR 214

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            G  + +   + E++ V+ + L +     + +VP S L +L
Sbjct: 215 HGYGLAIGHPYPETLAVLEEVLPEWARAGIKLVPASRLVEL 255


>gi|228920144|ref|ZP_04083493.1| hypothetical protein bthur0011_11610 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839600|gb|EEM84892.1| hypothetical protein bthur0011_11610 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 256

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDD 187


>gi|330874211|gb|EGH08360.1| hypothetical protein PSYMP_06329 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 260

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 100/226 (44%), Gaps = 7/226 (3%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +     S A + +++  LG +     R + L P  +TLA   +      + +EA + G+ 
Sbjct: 23  DHAEKTSKAYLTLIIDDLGQNPARDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKT 81

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            IL +PM      Y       L       +L +RL  +L +     G+ N+ G+ + +  
Sbjct: 82  VILHMPMDPATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEP 135

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+
Sbjct: 136 VAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQ 195

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              ++A+  G A+ +   +  +++V+ + L +   + V  + L  +
Sbjct: 196 TAIKLAQKQGSAVVIGHPYPVTLDVLERELPRLKAQGVEWIDLRSM 241


>gi|254282675|ref|ZP_04957643.1| Divergent polysaccharide deacetylase superfamily [gamma
           proteobacterium NOR51-B]
 gi|219678878|gb|EED35227.1| Divergent polysaccharide deacetylase superfamily [gamma
           proteobacterium NOR51-B]
          Length = 252

 Score = 62.8 bits (151), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 96/224 (42%), Gaps = 4/224 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
           C+  S  R+AI++  LG S      A NL PA +TL+   +            ++G+E +
Sbjct: 20  CNEVSHPRLAIIIDDLGYSLNRGLDAANL-PAPLTLSIIPHTPHAHSIATVGVEQGKEIM 78

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM++        D   L            +  +L    G  GV N+ G+ L +N+  
Sbjct: 79  VHMPMES--TKVPPSDPVVLTTALADDDFEATIDAALLSVPGATGVNNHMGSKLTTNRPL 136

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E          + F D  ++  ++   +A  + +P     ++LD+  D  +I  +L   
Sbjct: 137 MERFMARVLDNSMFFIDSRTTAESVAADVATAMAVPNTERSVFLDNTRDPVQIENQLLEA 196

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             IA   G A+ +   + E+++V++Q L +     V +VP S L
Sbjct: 197 VSIALHAGDAVAIGHPYPETLKVLAQALPRLP-SAVQLVPASAL 239


>gi|229149633|ref|ZP_04277864.1| hypothetical protein bcere0011_11920 [Bacillus cereus m1550]
 gi|228633843|gb|EEK90441.1| hypothetical protein bcere0011_11920 [Bacillus cereus m1550]
          Length = 256

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDD 187


>gi|75759334|ref|ZP_00739431.1| Hypothetical exported protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218896364|ref|YP_002444775.1| hypothetical protein BCG9842_B3959 [Bacillus cereus G9842]
 gi|228900013|ref|ZP_04064249.1| hypothetical protein bthur0014_12220 [Bacillus thuringiensis IBL
           4222]
 gi|74493166|gb|EAO56285.1| Hypothetical exported protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218540741|gb|ACK93135.1| conserved hypothetical protein [Bacillus cereus G9842]
 gi|228859627|gb|EEN04051.1| hypothetical protein bthur0014_12220 [Bacillus thuringiensis IBL
           4222]
          Length = 256

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ + L 
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGHISKQAQLL- 201

Query: 346 EIARTTGQAIGVAVA 360
            I +   + I VA+ 
Sbjct: 202 -IKKIQEKPIMVAIG 215


>gi|30019484|ref|NP_831115.1| hypothetical protein BC1334 [Bacillus cereus ATCC 14579]
 gi|206967544|ref|ZP_03228500.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|228907064|ref|ZP_04070928.1| hypothetical protein bthur0013_12370 [Bacillus thuringiensis IBL
           200]
 gi|228951813|ref|ZP_04113911.1| hypothetical protein bthur0006_12270 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228957703|ref|ZP_04119448.1| hypothetical protein bthur0005_12190 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|229068983|ref|ZP_04202276.1| hypothetical protein bcere0025_11910 [Bacillus cereus F65185]
 gi|229078617|ref|ZP_04211174.1| hypothetical protein bcere0023_12820 [Bacillus cereus Rock4-2]
 gi|229126748|ref|ZP_04255760.1| hypothetical protein bcere0015_12050 [Bacillus cereus BDRD-Cer4]
 gi|229144036|ref|ZP_04272452.1| hypothetical protein bcere0012_11990 [Bacillus cereus BDRD-ST24]
 gi|229177839|ref|ZP_04305212.1| hypothetical protein bcere0005_12030 [Bacillus cereus 172560W]
 gi|229189514|ref|ZP_04316530.1| hypothetical protein bcere0002_11930 [Bacillus cereus ATCC 10876]
 gi|296502013|ref|YP_003663713.1| hypothetical protein BMB171_C1177 [Bacillus thuringiensis BMB171]
 gi|29895028|gb|AAP08316.1| hypothetical Exported Protein [Bacillus cereus ATCC 14579]
 gi|206736464|gb|EDZ53611.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|228593959|gb|EEK51762.1| hypothetical protein bcere0002_11930 [Bacillus cereus ATCC 10876]
 gi|228605630|gb|EEK63078.1| hypothetical protein bcere0005_12030 [Bacillus cereus 172560W]
 gi|228639433|gb|EEK95847.1| hypothetical protein bcere0012_11990 [Bacillus cereus BDRD-ST24]
 gi|228656688|gb|EEL12514.1| hypothetical protein bcere0015_12050 [Bacillus cereus BDRD-Cer4]
 gi|228704687|gb|EEL57116.1| hypothetical protein bcere0023_12820 [Bacillus cereus Rock4-2]
 gi|228714095|gb|EEL65977.1| hypothetical protein bcere0025_11910 [Bacillus cereus F65185]
 gi|228801975|gb|EEM48847.1| hypothetical protein bthur0005_12190 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228807736|gb|EEM54257.1| hypothetical protein bthur0006_12270 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228852568|gb|EEM97358.1| hypothetical protein bthur0013_12370 [Bacillus thuringiensis IBL
           200]
 gi|296323065|gb|ADH05993.1| hypothetical protein BMB171_C1177 [Bacillus thuringiensis BMB171]
          Length = 256

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 89/195 (45%), Gaps = 3/195 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ + L 
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGHISKQAQLL- 201

Query: 346 EIARTTGQAIGVAVA 360
            I +   + I VA+ 
Sbjct: 202 -IKKIQEKPIMVAIG 215


>gi|15600328|ref|NP_253822.1| hypothetical protein PA5135 [Pseudomonas aeruginosa PAO1]
 gi|218894234|ref|YP_002443103.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa LESB58]
 gi|254243986|ref|ZP_04937308.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296391985|ref|ZP_06881460.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa PAb1]
 gi|313110177|ref|ZP_07796076.1| hypothetical protein PA39016_002260002 [Pseudomonas aeruginosa
           39016]
 gi|9951434|gb|AAG08520.1|AE004926_10 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126197364|gb|EAZ61427.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218774462|emb|CAW30279.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa LESB58]
 gi|310882578|gb|EFQ41172.1| hypothetical protein PA39016_002260002 [Pseudomonas aeruginosa
           39016]
          Length = 257

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 103/216 (47%), Gaps = 7/216 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + +V+  LG +    +R ++L P  +TLA            +EA ++G+  IL +PM   
Sbjct: 33  LTVVIDDLGQNLARDRRVLDL-PPGVTLAIIPETPHAAELAREAHQRGRTVILHMPMDPA 91

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y    ++  ++TQ  ++   RL  +L +     G+ N+ G+ + + + +   + +E 
Sbjct: 92  GGPY----AWRPELTQ--EERARRLDAALAKVPFVQGLNNHEGSRMTAVRPAMAWLAEEL 145

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGL   D  +S   +    A ++ L  +  D++LD++   + +  +L+    +AR  G
Sbjct: 146 QRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAVSAQLQAGVALARKQG 205

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+ +      +++V+++ L +   + + +VP   L
Sbjct: 206 SALLIGHPHKATLDVLARELPKLRAQGIELVPPQML 241


>gi|107104231|ref|ZP_01368149.1| hypothetical protein PaerPA_01005304 [Pseudomonas aeruginosa PACS2]
 gi|254238163|ref|ZP_04931486.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126170094|gb|EAZ55605.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 257

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 103/216 (47%), Gaps = 7/216 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + +V+  LG +    +R ++L P  +TLA            +EA ++G+  IL +PM   
Sbjct: 33  LTVVIDDLGQNLARDRRVLDL-PPGVTLAIIPETPHAAELAREAHQRGRTVILHMPMDPA 91

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y    ++  ++TQ  ++   RL  +L +     G+ N+ G+ + + + +   + +E 
Sbjct: 92  GGPY----AWRPELTQ--EERARRLDAALAKVPFVQGLNNHEGSRMTAVRPAMAWLAEEL 145

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGL   D  +S   +    A ++ L  +  D++LD++   + +  +L+    +AR  G
Sbjct: 146 QRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAVSAQLQAGVALARKQG 205

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+ +      +++V+++ L +   + + +VP   L
Sbjct: 206 SALLIGHPHKATLDVLARELPKLRAQGIELVPPQML 241


>gi|330967509|gb|EGH67769.1| hypothetical protein PSYAC_23214 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 260

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 100/226 (44%), Gaps = 7/226 (3%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +     S A + +++  LG +     R + L P  +TLA   +      + +EA + G+ 
Sbjct: 23  DHAEKPSKAYLTLIIDDLGQNPVRDSRTLAL-PGPVTLAIMPDTPHATDFAREAHRAGKT 81

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            IL +PM      Y       L       +L +RL  +L +     G+ N+ G+ + +  
Sbjct: 82  VILHMPMDPATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEP 135

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+
Sbjct: 136 VAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQ 195

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              ++A+  G A+ +   +  +++V+ + L +   + V  + L  +
Sbjct: 196 TAIKLAQKQGSAVVIGHPYPVTLDVLERELPRLKAQSVEWIDLRSM 241


>gi|152985938|ref|YP_001351189.1| hypothetical protein PSPA7_5870 [Pseudomonas aeruginosa PA7]
 gi|150961096|gb|ABR83121.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 258

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 104/216 (48%), Gaps = 7/216 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + +V+  LG +    +R ++L P+ +TLA            +EA ++G+  IL +PM   
Sbjct: 34  LTVVIDDLGQNLARDRRVLDL-PSGVTLAIIPETPHAAELAREAHQRGRTVILHMPMDPA 92

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y    ++  ++TQ  ++   RL  +L +     G+ N+ G+ + + + +   + +E 
Sbjct: 93  GGPY----AWRPELTQ--EERARRLDAALAKVPFVQGLNNHEGSRMTAVRPAMAWLAEEL 146

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGL   D  +S   +    A ++ L  +  D++LD++   + +  +L+    +AR  G
Sbjct: 147 QRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAVSAQLQAGVALARRQG 206

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+ +      +++V+++ L +   + + +VP   L
Sbjct: 207 SALLIGHPHKATLDVLARELPKLRAQGIELVPPQML 242


>gi|229029103|ref|ZP_04185201.1| hypothetical protein bcere0028_12050 [Bacillus cereus AH1271]
 gi|228732201|gb|EEL83085.1| hypothetical protein bcere0028_12050 [Bacillus cereus AH1271]
          Length = 244

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 12  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 70

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 71  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 131 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 175


>gi|229183625|ref|ZP_04310848.1| hypothetical protein bcere0004_11970 [Bacillus cereus BGSC 6E1]
 gi|228599868|gb|EEK57465.1| hypothetical protein bcere0004_11970 [Bacillus cereus BGSC 6E1]
          Length = 244

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 12  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 70

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 71  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 131 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 175


>gi|331017072|gb|EGH97128.1| hypothetical protein PLA106_13587 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 260

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 100/226 (44%), Gaps = 7/226 (3%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +     S A + +++  LG +     R + L P  +TLA   +      + +EA + G+ 
Sbjct: 23  DHAEKTSKAYLTLIIDDLGQNPVRDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKT 81

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            IL +PM      Y       L       +L +RL  +L +     G+ N+ G+ + +  
Sbjct: 82  VILHMPMDPATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEP 135

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+
Sbjct: 136 VAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRICLASVSRDVFLDDERTAEAITRQLQ 195

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              ++A+  G A+ +   +  +++V+ + L +   + V  + L  +
Sbjct: 196 TAIKLAQKHGSAVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSM 241


>gi|222095065|ref|YP_002529125.1| hypothetical protein BCQ_1405 [Bacillus cereus Q1]
 gi|221239123|gb|ACM11833.1| conserved hypothetical protein [Bacillus cereus Q1]
          Length = 256

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 80/174 (45%), Gaps = 1/174 (0%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +PA      + A   ++AIV+   G +  GT + ++L P  +T+A      S       A
Sbjct: 15  LPAFLFPIETKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|28872442|ref|NP_795061.1| hypothetical protein PSPTO_5330 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971178|ref|ZP_03399296.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301382306|ref|ZP_07230724.1| hypothetical protein PsyrptM_06718 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058523|ref|ZP_07250064.1| hypothetical protein PsyrptK_00941 [Pseudomonas syringae pv. tomato
           K40]
 gi|302132190|ref|ZP_07258180.1| hypothetical protein PsyrptN_12399 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855697|gb|AAO58756.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213924047|gb|EEB57624.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 260

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 99/226 (43%), Gaps = 7/226 (3%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +     S A   +++  LG +     R + L P  +TLA   +      + +EA + G+ 
Sbjct: 23  DHAEKTSKAYFTLIIDDLGQNPVRDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAGKT 81

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            IL +PM      Y       L       +L +RL  +L +     G+ N+ G+ + +  
Sbjct: 82  VILHMPMDPATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEP 135

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+
Sbjct: 136 VAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQ 195

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              ++A+  G A+ +   +  +++V+ + L +   + V  + L  +
Sbjct: 196 TAIKLAQKHGSAVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSM 241


>gi|188025459|ref|ZP_02958730.2| hypothetical protein PROSTU_00480 [Providencia stuartii ATCC 25827]
 gi|188023551|gb|EDU61591.1| hypothetical protein PROSTU_00480 [Providencia stuartii ATCC 25827]
          Length = 303

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 101/226 (44%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           AS A++AIV+   G  +T     I  LP  IT+A   +         +A ++G+E I+ +
Sbjct: 6   ASAAKLAIVIDDFGY-RTKEDNQILALPTPITIAILPDSPHGQLVANKAHQQGREVIIHM 64

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+   +   E +  TL  T + +++   ++ ++ +     G+ N+ G+ + S+      
Sbjct: 65  PMKPLSKQPLEKN--TLSPTMSAEEIDRIIKRAISQVPYAKGMNNHMGSEMTSSLSGMRH 122

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +    +K    F D  +         A +  +P +   ++LD+    ++ R +L      
Sbjct: 123 VMNSLSKANFFFLDSVTIGNTQAVKAANEFGVPVVRRHIFLDNHQSEEETRVQLNKAVAY 182

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AR  G AI +      ++  + ++L Q    D+ +V +S L + SS
Sbjct: 183 ARKHGNAIAIGHPHPSTVRALQKYLPQLPA-DIELVSVSALLQGSS 227


>gi|116053282|ref|YP_793605.1| hypothetical protein PA14_67820 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115588503|gb|ABJ14518.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 257

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 103/216 (47%), Gaps = 7/216 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + +V+  LG +    +R ++L P  +TLA            +EA ++G+  IL +PM   
Sbjct: 33  LTVVIDDLGQNLARDRRVLDL-PPGVTLAIIPETPHAAELAREAHQRGRTVILHMPMDPA 91

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y    ++  ++TQ  ++   RL  +L +     G+ N+ G+ + + + +   + +E 
Sbjct: 92  GGPY----AWRPELTQ--EERARRLDAALAKVPFVQGLNNHEGSRMTAVRPAMAWLAEEL 145

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +RGL   D  +S   +    A ++ L  +  D++LD++   + +  +L+    +AR  G
Sbjct: 146 QRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAVSAQLQAGIALARKQG 205

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            A+ +      +++V+++ L +   + + +VP   L
Sbjct: 206 SALLIGHPHKATLDVLARELPKLRAQGIELVPPQML 241


>gi|324325449|gb|ADY20709.1| divergent polysaccharide deacetylase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 256

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPLKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|229120971|ref|ZP_04250213.1| hypothetical protein bcere0016_12800 [Bacillus cereus 95/8201]
 gi|228662631|gb|EEL18229.1| hypothetical protein bcere0016_12800 [Bacillus cereus 95/8201]
          Length = 256

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSIVPKIGKELGVPIIENQLFFDD 187


>gi|229154999|ref|ZP_04283113.1| hypothetical protein bcere0010_11930 [Bacillus cereus ATCC 4342]
 gi|228628557|gb|EEK85270.1| hypothetical protein bcere0010_11930 [Bacillus cereus ATCC 4342]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTTDERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|229195628|ref|ZP_04322394.1| hypothetical protein bcere0001_11950 [Bacillus cereus m1293]
 gi|228587877|gb|EEK45929.1| hypothetical protein bcere0001_11950 [Bacillus cereus m1293]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 80/174 (45%), Gaps = 1/174 (0%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +PA      + A   ++AIV+   G +  GT + ++L P  +T+A      S       A
Sbjct: 15  LPAFLFPIEAKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|206977562|ref|ZP_03238456.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217958908|ref|YP_002337456.1| hypothetical protein BCAH187_A1488 [Bacillus cereus AH187]
 gi|229138118|ref|ZP_04266716.1| hypothetical protein bcere0013_12420 [Bacillus cereus BDRD-ST26]
 gi|206744280|gb|EDZ55693.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217063675|gb|ACJ77925.1| conserved hypothetical protein [Bacillus cereus AH187]
 gi|228645463|gb|EEL01697.1| hypothetical protein bcere0013_12420 [Bacillus cereus BDRD-ST26]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|42780521|ref|NP_977768.1| hypothetical protein BCE_1447 [Bacillus cereus ATCC 10987]
 gi|42736441|gb|AAS40376.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|289624111|ref|ZP_06457065.1| yibQ gene product [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|330868929|gb|EGH03638.1| YibO protein [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 260

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 93/204 (45%), Gaps = 7/204 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R + L P  +TLA   +      + +EA +  +  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPARDSRTLAL-PGPVTLAIMPDTPHATEFAREAHRAAKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMAWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAINRQLQSAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQ 374
            G A+ +   +  +++V+ + L +
Sbjct: 204 HGSAVVIGHPYPVTLDVLERELPK 227


>gi|229172071|ref|ZP_04299636.1| hypothetical protein bcere0006_11850 [Bacillus cereus MM3]
 gi|228611414|gb|EEK68671.1| hypothetical protein bcere0006_11850 [Bacillus cereus MM3]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|30261433|ref|NP_843810.1| hypothetical protein BA_1349 [Bacillus anthracis str. Ames]
 gi|47777922|ref|YP_017970.2| hypothetical protein GBAA_1349 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184267|ref|YP_027519.1| hypothetical protein BAS1250 [Bacillus anthracis str. Sterne]
 gi|52144005|ref|YP_082824.1| divergent polysaccharide deacetylase [Bacillus cereus E33L]
 gi|65318702|ref|ZP_00391661.1| COG2861: Uncharacterized protein conserved in bacteria [Bacillus
           anthracis str. A2012]
 gi|118476904|ref|YP_894055.1| divergent polysaccharide deacetylase [Bacillus thuringiensis str.
           Al Hakam]
 gi|165870470|ref|ZP_02215125.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167639335|ref|ZP_02397607.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170686852|ref|ZP_02878072.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170706221|ref|ZP_02896682.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177651538|ref|ZP_02934327.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190568129|ref|ZP_03021039.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196035274|ref|ZP_03102679.1| conserved hypothetical protein [Bacillus cereus W]
 gi|196040679|ref|ZP_03107978.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196046501|ref|ZP_03113726.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|218902539|ref|YP_002450373.1| hypothetical protein BCAH820_1422 [Bacillus cereus AH820]
 gi|225863295|ref|YP_002748673.1| hypothetical protein BCA_1386 [Bacillus cereus 03BB102]
 gi|227815821|ref|YP_002815830.1| hypothetical protein BAMEG_3245 [Bacillus anthracis str. CDC 684]
 gi|228932713|ref|ZP_04095586.1| hypothetical protein bthur0009_11890 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945030|ref|ZP_04107391.1| hypothetical protein bthur0007_11960 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229090385|ref|ZP_04221628.1| hypothetical protein bcere0021_12140 [Bacillus cereus Rock3-42]
 gi|229602452|ref|YP_002865845.1| hypothetical protein BAA_1418 [Bacillus anthracis str. A0248]
 gi|254682505|ref|ZP_05146366.1| hypothetical protein BantC_01448 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254726167|ref|ZP_05187949.1| hypothetical protein BantA1_27540 [Bacillus anthracis str. A1055]
 gi|254733921|ref|ZP_05191635.1| hypothetical protein BantWNA_01941 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254753779|ref|ZP_05205814.1| hypothetical protein BantV_14988 [Bacillus anthracis str. Vollum]
 gi|254758876|ref|ZP_05210903.1| hypothetical protein BantA9_11259 [Bacillus anthracis str.
           Australia 94]
 gi|301052972|ref|YP_003791183.1| divergent polysaccharide deacetylase [Bacillus anthracis CI]
 gi|30255287|gb|AAP25296.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47551627|gb|AAT30445.2| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178194|gb|AAT53570.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
 gi|51977474|gb|AAU19024.1| conserved hypothetical protein; possible divergent polysaccharide
           deacetylase [Bacillus cereus E33L]
 gi|118416129|gb|ABK84548.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|164713965|gb|EDR19487.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167512774|gb|EDR88148.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170128755|gb|EDS97621.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170669375|gb|EDT20118.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172082816|gb|EDT67879.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190560863|gb|EDV14838.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|195991951|gb|EDX55914.1| conserved hypothetical protein [Bacillus cereus W]
 gi|196022685|gb|EDX61367.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|196028469|gb|EDX67077.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|218538662|gb|ACK91060.1| conserved hypothetical protein [Bacillus cereus AH820]
 gi|225786406|gb|ACO26623.1| conserved hypothetical protein [Bacillus cereus 03BB102]
 gi|227004833|gb|ACP14576.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|228692968|gb|EEL46686.1| hypothetical protein bcere0021_12140 [Bacillus cereus Rock3-42]
 gi|228814699|gb|EEM60959.1| hypothetical protein bthur0007_11960 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826971|gb|EEM72732.1| hypothetical protein bthur0009_11890 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|229266860|gb|ACQ48497.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
 gi|300375141|gb|ADK04045.1| conserved hypothetical divergent polysaccharide deacetylase
           [Bacillus cereus biovar anthracis str. CI]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|49479759|ref|YP_035558.1| divergent polysaccharide deacetylase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49331315|gb|AAT61961.1| conserved hypothetical protein, possible divergent polysaccharide
           deacetylase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 259

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPVKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|66048112|ref|YP_237953.1| hypothetical protein Psyr_4888 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258819|gb|AAY39915.1| Protein of unknown function DUF610 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330970736|gb|EGH70802.1| hypothetical protein PSYAR_09607 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 260

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           S A +++++  LG +     R + L P  +TLA   +      + ++A + G+  +L +P
Sbjct: 29  SKAYLSLIIDDLGQNPQRDSRTLAL-PGPVTLAIMPDTPHATEFARQAHRAGKTVMLHMP 87

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M      Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +
Sbjct: 88  MDPATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMTWL 141

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
             E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IA
Sbjct: 142 MAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTAIKIA 201

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G A+ +   +  +++V+ + L     + V  + L  +
Sbjct: 202 RKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSM 241


>gi|167634468|ref|ZP_02392789.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|254740389|ref|ZP_05198080.1| hypothetical protein BantKB_05133 [Bacillus anthracis str. Kruger
           B]
 gi|167530356|gb|EDR93082.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
          Length = 256

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSAKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|253573367|ref|ZP_04850710.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251846895|gb|EES74900.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 307

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 83/171 (48%), Gaps = 1/171 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++A+++  LG    GT+  +NL P  +T+A      +     + A + G + I+ +PM+ 
Sbjct: 69  KVAVIIDDLGNGMAGTEEILNL-PIKLTVAVMPFLETTQEDARRAHEYGHDVIIHMPMEP 127

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                       +  + T +++  R+  ++ +     G+ N+ G+ +  ++    VI + 
Sbjct: 128 KQGKAEWLGPGAILSSMTDEEIRQRVEAAIDQVPYAIGMNNHMGSKVTEDERVMSVILEV 187

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             +RGL F D  ++ R++   L+ K+ LP +  D++LDD      + ++L+
Sbjct: 188 CRERGLFFIDSKTNSRSVVPRLSEKMGLPRLENDIFLDDVGSEAHVTKQLR 238


>gi|170719593|ref|YP_001747281.1| hypothetical protein PputW619_0406 [Pseudomonas putida W619]
 gi|169757596|gb|ACA70912.1| protein of unknown function DUF610 YibQ [Pseudomonas putida W619]
          Length = 259

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 96/214 (44%), Gaps = 7/214 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           ++I++  LG S     R + L P  +T+A   +      + ++A K G+  IL +PM   
Sbjct: 30  MSIIIDDLGQSTERDSRTLAL-PGPVTMAIMPDTPHASEFARQAHKAGKTVILHMPMDPA 88

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y       L       +L  RL  +L +     G+ N+ G+ + + + +   +  E 
Sbjct: 89  TGPYAWHPDIALP------ELARRLDAALAKVPYAAGINNHMGSRMTAQRGAMTWLMGEL 142

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +R L F D  +S   +    A    L ++  D++LDD    + I  +L+    +AR  G
Sbjct: 143 QRRHLFFVDSRTSAATVAAAEAQAQALGHVSRDVFLDDVRTTEAITTQLQQGVALARRQG 202

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
            A+ +   + ++++V+ Q + +   + + +V L+
Sbjct: 203 SAVLIGHPYPQTLQVLEQEMPRLRSQGIELVTLT 236


>gi|228926462|ref|ZP_04089534.1| hypothetical protein bthur0010_11810 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228833286|gb|EEM78851.1| hypothetical protein bthur0010_11810 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 256

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVLKIGKELGVPIIENQLFFDD 187


>gi|228914003|ref|ZP_04077625.1| hypothetical protein bthur0012_12400 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228845608|gb|EEM90637.1| hypothetical protein bthur0012_12400 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 256

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 76/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  AKAHTNKVAIVIDDFGNNMKGTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  ++       G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIHEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVLKIGKELGVPIIENQLFFDD 187


>gi|228938547|ref|ZP_04101155.1| hypothetical protein bthur0008_12120 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228971426|ref|ZP_04132052.1| hypothetical protein bthur0003_12060 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978039|ref|ZP_04138418.1| hypothetical protein bthur0002_12430 [Bacillus thuringiensis Bt407]
 gi|228781700|gb|EEM29899.1| hypothetical protein bthur0002_12430 [Bacillus thuringiensis Bt407]
 gi|228788293|gb|EEM36246.1| hypothetical protein bthur0003_12060 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228821145|gb|EEM67162.1| hypothetical protein bthur0008_12120 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|326939056|gb|AEA14952.1| hypothetical protein CT43_CH1264 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 256

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ATAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P+++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDD 187


>gi|228964394|ref|ZP_04125508.1| hypothetical protein bthur0004_12430 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228795251|gb|EEM42743.1| hypothetical protein bthur0004_12430 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 221

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 77/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +NA   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ANAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDD 187


>gi|94987564|ref|YP_595497.1| hypothetical protein LI1122 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731813|emb|CAJ55176.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 445

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 92/225 (40%), Gaps = 9/225 (4%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           C      RI IV+  +G S     + I L  P  ITL+   + +            G E 
Sbjct: 208 CPIDEKPRITIVIDDIGESIEAANQLIKLDFP--ITLSILPHTHYAKSIAMLTHSTGNEV 265

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++  PM++    Y       +    + +++ N L  ++ +     G+ N+ G+    N++
Sbjct: 266 LIHQPMESIQSPYVSAGPGEIHTKMSAEEISNILCKNIEKIPYASGLNNHMGSCFTCNEK 325

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD-QVDRDKIREKLK 342
               + K  A +GL   D  + P +    +A    LP      ++D        I  +LK
Sbjct: 326 GNHTVCKILASKGLFVLDSKTHPSSSFYNIAKGKGLPAYYRTHFIDHGHHTESSILNQLK 385

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVS--VVPL 385
             E+ A   GQAI +   + E+I  + +W+    +RD S  +VPL
Sbjct: 386 KAEKYAIEKGQAIVIGHPYPETISALKKWIS---LRDTSIHIVPL 427


>gi|224368263|ref|YP_002602426.1| hypothetical protein HRM2_11500 [Desulfobacterium autotrophicum
           HRM2]
 gi|223690979|gb|ACN14262.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 349

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/220 (25%), Positives = 107/220 (48%), Gaps = 8/220 (3%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLA---FASNGNSLDRWMKEAKKKGQEAILQIP 228
           R+AI++  +G  +     AI+ L  +ITL+   +A +  ++   + +   +G E +L +P
Sbjct: 130 RVAIIIDDIGFDKK-ISLAISGLDPHITLSILPYAPHAKAIALLLHQ---RGTETLLHLP 185

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+  +    +     L  T T  +LL++LR  L       GV N+ G+ + S       I
Sbjct: 186 MEPMEYPKIDPGPGALLSTMTPDELLDQLRLDLDIIPFVAGVNNHMGSRMTSLSPQMNQI 245

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           F    +R L F D  ++  +L R  A  L +P+   D++LD+  D D I+++L  L  +A
Sbjct: 246 FTVLKQRNLFFIDSLTAKGSLCRQSARLLRIPFAQRDVFLDNVQDADYIKKQLAQLLAVA 305

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G AIG+   +  +   +   +++   + + +VP S L
Sbjct: 306 QRHGTAIGIGHPYRATYLTLKSEMERLK-KKIRIVPASAL 344


>gi|228996531|ref|ZP_04156170.1| hypothetical protein bmyco0003_11180 [Bacillus mycoides Rock3-17]
 gi|229004182|ref|ZP_04161983.1| hypothetical protein bmyco0002_11470 [Bacillus mycoides Rock1-4]
 gi|228757043|gb|EEM06287.1| hypothetical protein bmyco0002_11470 [Bacillus mycoides Rock1-4]
 gi|228763163|gb|EEM12071.1| hypothetical protein bmyco0003_11180 [Bacillus mycoides Rock3-17]
          Length = 255

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 78/167 (46%), Gaps = 1/167 (0%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F + A   ++AIV+   G +  GT+R ++L P  +T+A      S  +    A +KG E 
Sbjct: 19  FQTYAHTNKVAIVIDDFGNNMKGTERMLSL-PIPLTVAVMPFLPSTKQDAVAAHQKGHEV 77

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+ +PM+             +    +  ++ +R+  +++      G+ N+ G+ + +++ 
Sbjct: 78  IIHMPMEPIKGKKEWLGPKAITTDLSDHEIESRVEQAIQEVPHAIGMNNHMGSKVTADER 137

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
              +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 138 IMRIILSVCKKHGLFYLDSKTNPNSIVPKIGKELGVPIVENQLFFDD 184


>gi|294143080|ref|YP_003559058.1| hypothetical protein SVI_4309 [Shewanella violacea DSS12]
 gi|293329549|dbj|BAJ04280.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 256

 Score = 60.8 bits (146), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 103/229 (44%), Gaps = 14/229 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S  + A++AI++  +G   +    A+  LP NITL+   +          A ++G E +
Sbjct: 14  SSYVNAAQVAIIIDDIGYRHS--DEAVLSLPDNITLSVLPHTPLGRSVAHTAHQRGYEVM 71

Query: 225 LQIPMQAFD-----ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           L +PMQA +          +D   + V + +QQ    + ++        GV N+ G++L 
Sbjct: 72  LHLPMQALNGKKLGPGGITNDMSEIDVKRIIQQDFESIPFAK-------GVNNHMGSLLT 124

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              E    + +   ++ + F D  ++  +     A KL +P +   ++LD+ +    + +
Sbjct: 125 QLDEPMRWVMESLKQKQVYFVDSMTTRFSKAGSTAEKLGIPQLKRQIFLDNDLSPAALNQ 184

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           + + L  +A   GQ + +A  + E+IE +   L +     VS+V  S L
Sbjct: 185 QFERLIALAHRQGQVVAIAHPYPETIEYLKLNLPRLQQAGVSLVKTSDL 233


>gi|322835022|ref|YP_004215049.1| hypothetical protein Rahaq_4336 [Rahnella sp. Y9602]
 gi|321170223|gb|ADW75922.1| protein of unknown function DUF610 YibQ [Rahnella sp. Y9602]
          Length = 309

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 94/214 (43%), Gaps = 13/214 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F      A+++I++   G  Q    + + + P  +++A   N       M +A ++G+E 
Sbjct: 17  FACQVQAAKLSILIDDFGYRQHEENQVLQM-PKAVSVAIFPNAPDSQMMMNKAHQQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYT-----LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           ++ +PM    +   E D+ T      +V + V Q +  + Y++       G+ N+ G+ +
Sbjct: 76  LIHLPMAPLSKQPLEKDTLTPSMSAAEVKRIVDQAIINIPYAI-------GINNHMGSAM 128

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            S+    E + +      L F D  +     +   A    +  +  +++LDD  +  +IR
Sbjct: 129 TSSLTGMENVMQAMNAHNLFFLDSMTIGNTQSVKAAQGTRVKVIKRNVFLDDVQNEAEIR 188

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
            + +   ++AR  G AI +      +++V+ Q L
Sbjct: 189 RQFERAIQLARKNGYAIAIGHPHPTTVKVLQQML 222


>gi|258514447|ref|YP_003190669.1| hypothetical protein Dtox_1161 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257778152|gb|ACV62046.1| protein of unknown function DUF610 YibQ [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 293

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 94/201 (46%), Gaps = 6/201 (2%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA---K 217
           D++       A++AIV+   G  Q+  +  + +L  N  L FA   N L+  +K+A   K
Sbjct: 61  DQSASKKVKKAQVAIVIDDFG--QSNREGVMEMLSINRPLTFAVMPN-LENSVKDAAMAK 117

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +KG E I+ +PMQ             +     V+Q+  R+     +     G  N+ G++
Sbjct: 118 EKGFEIIVHLPMQPISGKSRWMGPGGITFDMGVEQIRQRVLQDFDQVPFAVGFNNHMGSL 177

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + S ++    I +   ++G    D  ++  +    ++  L +P    D++LD+  + + +
Sbjct: 178 ITSKEKLMSPILEVAKEKGFFVLDSRTTEDSKVVSISKSLGIPCAKRDVFLDEVKNYEHM 237

Query: 338 REKLKGLEEIARTTGQAIGVA 358
           +++LK L  IA T G AIG+ 
Sbjct: 238 KKQLKVLSTIALTKGTAIGIG 258


>gi|192359430|ref|YP_001984003.1| Divergent polysaccharide deacetylase family [Cellvibrio japonicus
           Ueda107]
 gi|190685595|gb|ACE83273.1| Divergent polysaccharide deacetylase family [Cellvibrio japonicus
           Ueda107]
          Length = 290

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 101/229 (44%), Gaps = 9/229 (3%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLA---FASNGNSLDRWMKEAKKKGQEAILQ 226
             ++AI++  +G +    +RA +L   + TLA   F  +G  L    + A ++G+E +L 
Sbjct: 34  AGQLAIIIDDIGYNLDAGRRAADL-SGDYTLAVLPFTPHGREL---AERAYRRGKEIMLH 89

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PM   +E +       L+   + +  L  L  +L       GV N+ G+ L   +E   
Sbjct: 90  APMS--NEQHLPLGKGGLESGMSRETFLQVLERNLADIPHVRGVNNHTGSQLTQEEEPMR 147

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E  +RGL F D  ++ +   + +A    LP    D++LDD+ +   +  +L+    
Sbjct: 148 WLMAELKQRGLYFVDSRTTAKTRAQAMAEAAGLPNRKRDVFLDDRPEPAHVASQLELAMA 207

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            AR  G A+ +   +  ++  + +         +++V  S L   S PS
Sbjct: 208 TARRQGSAVAIGHPYPSTLAALEKIAPLLEKYAITLVKASLLMPSSRPS 256


>gi|228990430|ref|ZP_04150395.1| hypothetical protein bpmyx0001_11920 [Bacillus pseudomycoides DSM
           12442]
 gi|228768956|gb|EEM17554.1| hypothetical protein bpmyx0001_11920 [Bacillus pseudomycoides DSM
           12442]
          Length = 255

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 78/167 (46%), Gaps = 1/167 (0%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F + A   ++AIV+   G +  GT+R ++L P  +T+A      S  +    A +KG E 
Sbjct: 19  FQTYAHTNKVAIVIDDFGNNMKGTERMLSL-PIPLTVAVMPFLPSTKQDAVAAHQKGHEV 77

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+ +PM+             +    +  ++ +R+  +++      G+ N+ G+ + +++ 
Sbjct: 78  IIHMPMEPIKGKKEWLGPKAITTDLSDHEIESRVEQAIQEVPHAIGMNNHMGSKVTADER 137

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
              +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 138 IMRIILSVCKKHGLFYLDSKTNPNSVVPKIGKELGVPIVENQLFFDD 184


>gi|77359329|ref|YP_338904.1| hypothetical protein PSHAa0363 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874240|emb|CAI85461.1| conserved protein of unknown function ; putative signal peptide
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 246

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 106/231 (45%), Gaps = 11/231 (4%)

Query: 164 FCS-NASGARIAIVVSGLGISQTGTQRAINLL--PANITLAFASNGNSLDRWMKEAKKKG 220
           F S NA   +IAIV+  +G  Q    R + LL  P  ++ +   +      +   A K  
Sbjct: 13  FASLNAKAKQIAIVIDDIGYHQ----RDLELLTLPGQVSYSILPHTPYAQAFATLASKTN 68

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVT-QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           +E +L IPMQA +       + TL +  + +QQ+L     SL +  G   V N+ G+ L 
Sbjct: 69  KELLLHIPMQALNGKELGPGALTLNMNKEQIQQILGTALASLPQVKG---VNNHMGSALT 125

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              ++   I +   KR L F D  ++  +  +  A  L +  +   ++LD+    ++++ 
Sbjct: 126 QQSQAMRWIMEVLKKRHLYFLDSRTTELSQAQNAANFLGVENIGRHIFLDNITTPEQLQL 185

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           +L  L++ A     AI +A  + E+I  +   L Q   +   +VP+S L +
Sbjct: 186 RLDELKQHATEHKFAIAIAHPYPETIAFLRHVLPQLSKQGFELVPVSKLVE 236


>gi|218235875|ref|YP_002366115.1| hypothetical protein BCB4264_A1385 [Bacillus cereus B4264]
 gi|218163832|gb|ACK63824.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 256

 Score = 60.5 bits (145), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 76/165 (46%), Gaps = 1/165 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A   ++AIV+   G +  GT + ++L P  +T+A      S       A KKG E I+
Sbjct: 24  ATAHTNKVAIVIDDFGNNMKGTNQMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVII 82

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++   
Sbjct: 83  HMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIV 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +I     K GL + D  ++P ++   +  +L +P +   L+ DD
Sbjct: 143 RLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDD 187


>gi|326796766|ref|YP_004314586.1| hypothetical protein Marme_3537 [Marinomonas mediterranea MMB-1]
 gi|326547530|gb|ADZ92750.1| protein of unknown function DUF610 YibQ [Marinomonas mediterranea
           MMB-1]
          Length = 344

 Score = 59.7 bits (143), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/217 (21%), Positives = 103/217 (47%), Gaps = 3/217 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           RI+I++  LG ++ G + ++NL P  + LA   +     +   ++ ++ +  +L  PM+ 
Sbjct: 128 RISIIIDDLGYNRRGMESSLNL-PVEVALAILPHTPFGKKTALKSIEQNRVTLLHAPME- 185

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            ++   +     L  +   ++  + LR  L    G  GV N+ G++L ++ ++   + + 
Sbjct: 186 -NQRELKLGPGGLYASMGEEEFKSVLRDDLASLPGIKGVNNHMGSLLTTDSQAMNWVMQV 244

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
              R L F D  +S  ++   +A + ++     D++LD+     KI ++   L ++A   
Sbjct: 245 IGDRSLFFVDSVTSADSVAYTMALRHSINTTKRDVFLDNIRSEKKIEQQFLKLIQLAHQN 304

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           G AI +   + E++  +S+ L       V +VP+  L
Sbjct: 305 GHAIAIGHPYPETMAYLSKRLADLSKLSVRLVPIDEL 341


>gi|291327262|ref|ZP_06127547.2| polysaccharide deacetylase family protein [Providencia rettgeri DSM
           1131]
 gi|291311023|gb|EFE51476.1| polysaccharide deacetylase family protein [Providencia rettgeri DSM
           1131]
          Length = 338

 Score = 59.7 bits (143), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 101/225 (44%), Gaps = 4/225 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            C   S A++AIV+   G       + + L PA +T+A   +        ++A ++G++ 
Sbjct: 2   MCLPVSAAKLAIVIDDFGYRVKEDNQILALSPA-VTIAILPSSPHGREVAEKAHQQGRDI 60

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E D  TL  + + +++   ++ ++ R     G+ N+ G+ + SN  
Sbjct: 61  LIHMPMKPLSKQPLEKD--TLVPSMSAEEIDRIIKNAITRVPYAKGMNNHMGSEMTSNLV 118

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +  +K  L F D  +         A +  +P +   +++D+    ++ R +L  
Sbjct: 119 GMRNVMQSLSKSNLFFLDSVTIGNTQAGNAAKEYGVPSLRRHIFIDNHQSEEETRTQLNK 178

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
               AR  G A+ +      ++  + ++L Q    DV +V +S L
Sbjct: 179 AVAYARKHGSAVAIGHPHPSTVRALQKYLAQLPA-DVELVAVSAL 222


>gi|26991735|ref|NP_747160.1| hypothetical protein PP_5059 [Pseudomonas putida KT2440]
 gi|148550134|ref|YP_001270236.1| hypothetical protein Pput_4932 [Pseudomonas putida F1]
 gi|24986840|gb|AAN70624.1|AE016705_4 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148514192|gb|ABQ81052.1| protein of unknown function DUF610, YibQ [Pseudomonas putida F1]
          Length = 255

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 92/204 (45%), Gaps = 7/204 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A+ A ++I++  LG S     R + L P  +T+A   +      + ++A K G+  I
Sbjct: 18  AAPANKAYMSIIIDDLGQSPERDSRTLAL-PGPVTMAIMPDTPHATDFARQAHKAGKTVI 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       +++L  RL  +L +     G+ N+ G+ + + +E 
Sbjct: 77  LHMPMDP------ATGPYAWHPGIAIEELARRLDAALVKVPYAAGINNHMGSRMTAQREP 130

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S   +    A   ++ ++  D++LDD    + I  +L+  
Sbjct: 131 MAWLMGELQRRHLFFVDSRTSAATVAAAEAQAHDVAHVSRDVFLDDVRTPEAIDAQLQQG 190

Query: 345 EEIARTTGQAIGVAVAFDESIEVI 368
             +AR  G A+ +   + +++ V+
Sbjct: 191 IALARKQGSAVLIGHPYPQTLAVL 214


>gi|254788252|ref|YP_003075681.1| polysaccharide deacetylase family protein [Teredinibacter turnerae
           T7901]
 gi|237685753|gb|ACR13017.1| polysaccharide deacetylase family protein [Teredinibacter turnerae
           T7901]
          Length = 275

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 97/222 (43%), Gaps = 6/222 (2%)

Query: 168 ASGARIAIVVSGLGISQT-GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           A+   +AI++  LG  +  GT+  I  LP  +T A            + A   G+E ++ 
Sbjct: 41  ANAPEVAIIIDDLGYKRKLGTE--ILALPWPLTAAIIPFTPYATTLAESAHVAGKEVMVH 98

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PM+       E     L ++Q   +   R    L       G+ N+ G+ L ++ +   
Sbjct: 99  APMEPVAPRPWEQG---LAISQDETEFRERCGAMLDAVPYAVGLNNHGGSRLTASSDHMH 155

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E   +   F D  +S  ++   +A  + L     +++LD+  D + I  +L  LE 
Sbjct: 156 WLMAELDAKRFYFIDSRTSADSIAEDIAQTMGLATASRNVFLDNTRDPEAILAQLGKLET 215

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IAR  G AIG+   + E+++ +   L     R +++VP+S L
Sbjct: 216 IARQHGYAIGIGHPYPETLQALQLGLGAMANRGITLVPVSRL 257


>gi|330891664|gb|EGH24325.1| YibO protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 260

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 92/204 (45%), Gaps = 7/204 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A + +++  LG +     R +  LP  +TLA   +      + +EA + G+  +L +PM 
Sbjct: 31  AYLNLIIDDLGQNPARDSRTL-ALPGPVTLAIMPDTPHATEFAREAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMAWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +  L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +IAR 
Sbjct: 144 ELQRCHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAINRQLQSAIKIARK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQ 374
            G A+ +   +  +++V+ + L +
Sbjct: 204 HGSAVVIGHPYPVTLDVLERELPK 227


>gi|332994651|gb|AEF04706.1| hypothetical protein ambt_15995 [Alteromonas sp. SN2]
          Length = 280

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/222 (20%), Positives = 99/222 (44%), Gaps = 21/222 (9%)

Query: 163 NFCSNASGA-------RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
           +F S+A+ +       R+ I++  LG  ++    A   LP+ +T +            ++
Sbjct: 17  SFTSHAAASATIPVKPRVIIILDDLGYRKS--DMAAFALPSEVTFSILPRTPLAQTISRK 74

Query: 216 AKKKGQEAILQIPMQ-----AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
           A+++G+  +L +PMQ     A        D Y   +T T       LR +L+      GV
Sbjct: 75  AEQQGRAVMLHMPMQSTSGKAMGPLGLSTDMYPAAITHT-------LRAALKSVPNAVGV 127

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            N+ G+     + + + I +E  ++GL F D  +S     + +A ++ +P     ++LD+
Sbjct: 128 NNHMGSAFTVEEPAMQTIMEEIKRQGLFFVDSRTSVNTTAQQVADRVGVPNASRQVFLDN 187

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
                 + ++ +  + +A+  G  + +A  + E+I  ++  L
Sbjct: 188 DRSEASLSKQFEYTKRLAKRNGTVVVIAHPYPETITFLAHTL 229


>gi|330720619|gb|EGG98878.1| putative divergent polysaccharide deacetylase [gamma
           proteobacterium IMCC2047]
          Length = 305

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 101/228 (44%), Gaps = 11/228 (4%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANIT---LAFASNGNSLDRWMKEAKKKGQEAI 224
           +S  +I I++  LG +    QRAI L P  +T   L F   G  L    K+A ++ +E +
Sbjct: 24  SSSPQITIIIDDLGNNLRNGQRAIAL-PGAVTYSVLPFTPFGKQL---AKQAHQQDKEVM 79

Query: 225 LQIPMQAFDESYNED-DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           L +PM   D S+        L   Q       +L  ++       G+ N+ G+ L ++ E
Sbjct: 80  LHMPM---DNSHGHPLGPGGLTFKQDRPLFEQQLAAAITATPFVSGINNHMGSGLTTSSE 136

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +S  ++    A  L +P +  D++LD +     I ++ K 
Sbjct: 137 RMQWLMQSLKNYPLYFVDSRTSANSVAGRTALALKIPTLKRDIFLDHETTPAFIDKQFKR 196

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           L + A + G A+ +   +  +++ + + L Q     V +VP S L  L
Sbjct: 197 LLKKAHSKGHAVAIGHPYPSTLDYLEKALPQLDKLGVELVPPSQLLAL 244


>gi|87120387|ref|ZP_01076282.1| hypothetical protein MED121_09348 [Marinomonas sp. MED121]
 gi|86164490|gb|EAQ65760.1| hypothetical protein MED121_09348 [Marinomonas sp. MED121]
          Length = 433

 Score = 59.7 bits (143), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/232 (21%), Positives = 102/232 (43%), Gaps = 17/232 (7%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
           +    N     I I++  LG ++ G + +++L P  + LA   +     +  + A ++ +
Sbjct: 208 QELVENDDRPSITIIIDDLGYNRRGMEESLDL-PVEVALAILPHTPFSKKTARAATEQAR 266

Query: 222 EAILQIPMQAFDES-------YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
             +L +PM+   E        Y + D   LK T         L+  +    G  G+ N+ 
Sbjct: 267 TILLHVPMENERELKLGPGGLYKKMDEAELKKT---------LQEGIESVPGITGINNHM 317

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G++L  + ES + + +      L F D  +SP ++    A   +L     D++LD+  + 
Sbjct: 318 GSLLTQDVESMQWVMEVIQPLELFFVDSLTSPNSVALSKALSFDLTTTRRDVFLDNIQEE 377

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
             I ++ K L  IAR  G+A+ +   +  ++  +++ L Q     V ++ L+
Sbjct: 378 KAIDKQFKRLLAIARKRGKALAIGHPYPATMNYLAKHLSQLEDEGVQLISLA 429


>gi|119505488|ref|ZP_01627560.1| hypothetical protein MGP2080_04180 [marine gamma proteobacterium
           HTCC2080]
 gi|119458597|gb|EAW39700.1| hypothetical protein MGP2080_04180 [marine gamma proteobacterium
           HTCC2080]
          Length = 255

 Score = 59.3 bits (142), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 101/226 (44%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
           C   +   +A+++  LG +    Q A  + PA +T++                K+G+E +
Sbjct: 19  CPLHNHGNLAVIIDDLGYNLDTAQVAAAI-PAPLTMSIIPGTPYALEVADLGAKRGKEVM 77

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM A     +  D   L     V  +  R++ +L+   G  G+ N+ G+ L +N+E+
Sbjct: 78  LHMPMAAVRTRVS--DPLVLDGQLPVADIGQRVQQALQSVPGAAGMNNHMGSALTTNREA 135

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + +  E A + + F D  ++   + R  A    +P     ++LD++ +   +  ++K  
Sbjct: 136 MDALMSELAAQDMFFIDSRTTAETVARDAAKARGVPSASRTVFLDNKPELAAVEIQIKEA 195

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              A   G AI +      ++  +S+ L +    DV+VV  S +A+
Sbjct: 196 VRRALVEGYAIAIGHPHPATLTALSRALPRLPA-DVTVVSASQIAR 240


>gi|304398998|ref|ZP_07380867.1| protein of unknown function DUF610 YibQ [Pantoea sp. aB]
 gi|304353458|gb|EFM17836.1| protein of unknown function DUF610 YibQ [Pantoea sp. aB]
          Length = 300

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 91/209 (43%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           FCS A   +++IV+  +G       + + + P  I++A   N         +A + G E 
Sbjct: 16  FCSAAQAGKLSIVIDDVGYRPAEENKVLQM-PQAISVAVLPNAPHAREMAIKAHQGGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D+ T +++   +++   +R ++       G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLEKDTLTPEMSS--EEVARIMRNAVNNVPYAVGLNNHMGSRMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  D + IR++   
Sbjct: 133 GMQKVMQALNHYNLYFLDSMTIANSQAIPAAQGTQVKVLKRRVFLDDSQDINAIRQQFSR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
             ++A+  G AI +      ++ V+ Q L
Sbjct: 193 AVKLAQRDGYAIAIGHPHPNTVRVLQQML 221


>gi|90414915|ref|ZP_01222879.1| hypothetical protein P3TCK_22160 [Photobacterium profundum 3TCK]
 gi|90323971|gb|EAS40567.1| hypothetical protein P3TCK_22160 [Photobacterium profundum 3TCK]
          Length = 241

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 102/219 (46%), Gaps = 4/219 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            A++AI++  LG         ++ LP  +T++   N         +AKK+ +E +L +PM
Sbjct: 23  AAQLAIIIDDLGYQ--AMPELLSKLPPEVTISILPNTPYDLTVAAQAKKQHRETLLHMPM 80

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +   E     +  TL  T + Q L + LR +L R      + N+ G+ L  N ++   I 
Sbjct: 81  E--PEHLAPLEVNTLTSTMSQQTLQHTLRQALTRVPDAIAINNHMGSALSQNIQAMGWIM 138

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            E  +  L + D  ++ +++ +  A   ++  +   ++LD    ++ + ++L    + A+
Sbjct: 139 AELKQHNLYYLDSRTTAKSIAQQQATSHSVLSLRRHVFLDHYQTKEFVTKQLTSAIKRAK 198

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           T G AI +      ++  +++ L      ++++V LS L
Sbjct: 199 TYGYAIAIGHPHPITLSTLNELLPNLTEEEITLVRLSTL 237


>gi|218888242|ref|YP_002437563.1| hypothetical protein DvMF_3159 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759196|gb|ACL10095.1| protein of unknown function DUF610 YibQ [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 543

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/215 (21%), Positives = 91/215 (42%), Gaps = 2/215 (0%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
            GAR+AIV+  +G S +   R +  L   +T +            + A K  +E ++ +P
Sbjct: 324 GGARLAIVIDDIGESMSAA-RDLAALDYPVTFSVWPRSTHAREAAELAHKARREVMIHLP 382

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+       +     +   Q  Q++   +R ++RR     G+ N+ G+    N  +   +
Sbjct: 383 MEPVRYPQVKPGPGAILSGQQPQEMAALVRDAVRRVPYAVGLNNHMGSRATQNAAAMRTV 442

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +     G+   D  + P +     A +  LP    +++LD   D+  I  +L     IA
Sbjct: 443 CEALDGTGMFVLDSMTHPASKLYFEAKRAGLPAYKRNVFLDVIADKRNIMFQLDKAARIA 502

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
           +  GQAI +     E++  + +W +    R V++V
Sbjct: 503 QAEGQAIAIGHPLPETVAALKEWARTRD-RTVTIV 536


>gi|217971260|ref|YP_002356011.1| hypothetical protein Sbal223_0044 [Shewanella baltica OS223]
 gi|217496395|gb|ACK44588.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS223]
          Length = 251

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 97/229 (42%), Gaps = 14/229 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S +  A+IA+++  +G   T   +A+  LP+ +TL+   +            KKG E +
Sbjct: 14  ISQSHAAQIALIIDDIGYRHT--DQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIM 71

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQ-----TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           L +PMQA +         T  +T+     +V   +N + ++        G  N+ G++L 
Sbjct: 72  LHLPMQALNGKALGLGGLTNTMTEAQIRASVVDAINSVPFA-------KGANNHMGSLLT 124

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              E    + +   ++ L F D  ++        A +L +P +   L+LD+      +  
Sbjct: 125 QLDEPMLWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDTSTKALER 184

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +   +   A T G  + +A  + E++  +   LQ+     + +VP S L
Sbjct: 185 QFNLMISQAHTQGSLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSL 233


>gi|315648451|ref|ZP_07901550.1| divergent polysaccharide deacetylase [Paenibacillus vortex V453]
 gi|315276145|gb|EFU39491.1| divergent polysaccharide deacetylase [Paenibacillus vortex V453]
          Length = 295

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 91/193 (47%), Gaps = 3/193 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++A+++   G  Q GTQ  ++L P  IT+A      +  +  + A K G + I+ +PM+
Sbjct: 62  SKLAVIIDDFGNGQKGTQEMLSL-PVKITVAVMPFLPTSKKDAESAHKMGHDVIIHMPME 120

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                 +      +  + T +++  R+  ++       G+ N+ G+ +  ++    ++  
Sbjct: 121 PKQGRASWLGPGAILSSLTDEEIRKRMEEAIDSVPYAIGINNHMGSKVTGDERIMSIVLD 180

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA-- 348
              +RGL F D  ++ R++   LA +  +P +  D++LDD      + ++L    + A  
Sbjct: 181 VCKERGLFFMDSKTNYRSVVGKLAAEKGMPAIANDIFLDDVHTVQHVSKQLVTAAQHAEE 240

Query: 349 RTTGQAIGVAVAF 361
           RT+  AIG    F
Sbjct: 241 RTSCIAIGHVGVF 253


>gi|308068509|ref|YP_003870114.1| hypothetical protein PPE_01740 [Paenibacillus polymyxa E681]
 gi|305857788|gb|ADM69576.1| Polysacc_deac_2 domain containing protein [Paenibacillus polymyxa
           E681]
          Length = 311

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 78/158 (49%), Gaps = 1/158 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A+++  LG +  GT++ +NL P  IT+A      +  +   EA K+G + I+ +PM+  
Sbjct: 73  VAVIIDDLGNNMKGTEQILNL-PVKITVAVMPFLPTTKQDAMEAHKRGHDVIVHLPMEPK 131

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
                      +K   T +++  ++  +++      G+ N+ G+ + S+K    ++    
Sbjct: 132 QGKPEWLGPGAIKANMTDEEVRAKVTAAIKDVPYAIGMNNHMGSKVTSDKRIMSIVLDVC 191

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            + GL F D  ++  ++   LA K  +P +  D++LDD
Sbjct: 192 KEHGLFFVDSRTNYWSVVPELAAKKGMPPVRNDVFLDD 229


>gi|134299434|ref|YP_001112930.1| hypothetical protein Dred_1577 [Desulfotomaculum reducens MI-1]
 gi|134052134|gb|ABO50105.1| protein of unknown function DUF610, YibQ [Desulfotomaculum reducens
           MI-1]
          Length = 271

 Score = 59.3 bits (142), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 99/228 (43%), Gaps = 11/228 (4%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+   G + T        L   IT+A   N  +     +EA K+G E IL  PM   
Sbjct: 43  LAIVIDDFGGADTHGVAQFMELKQPITVAVMPNLVNSKEHSEEAHKRGHEVILHQPM--- 99

Query: 233 DESYNEDDSY----TLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
            E  +  DS+     +K   + +++      +L       G  N+ G+ + SNK+    +
Sbjct: 100 -EPLHGKDSWLGPGAIKSDMSYEEIKKVFLDNLATVPHAEGFNNHTGSKITSNKDKVAPM 158

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +    +GL   D  +S ++    +A  + +P++  D++LD+   +  I   LK    IA
Sbjct: 159 LEVAKDKGLFVLDSRTSDKSQVIKVAKSMQVPWVKRDVFLDEVKSKAVITRNLKKACAIA 218

Query: 349 RTTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +  G AI    V    + + E + + L       V +VPLS + KL S
Sbjct: 219 KKQGYAISIGHVGPGGNVTAEAVKEALPLIEKEGVKLVPLSQVVKLKS 266


>gi|126176516|ref|YP_001052665.1| hypothetical protein Sbal_4335 [Shewanella baltica OS155]
 gi|125999721|gb|ABN63796.1| protein of unknown function DUF610, YibQ [Shewanella baltica OS155]
          Length = 251

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 98/229 (42%), Gaps = 14/229 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S +  A+IA+++  +G   T   +A+  LP+ +TL+   +    +       KKG E +
Sbjct: 14  ISQSHAAQIALIIDDIGYRHT--DQAVLALPSTVTLSVLPHTPLGEELANAGHKKGHEIM 71

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQ-----TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           L +PMQA +         T  +T+     +V   +N + ++        G  N+ G++L 
Sbjct: 72  LHLPMQALNGKALGLGGLTNTMTEAQIRASVVDAINSVPFA-------KGANNHMGSLLT 124

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              +    I +   ++ L F D  ++        A +L +P +   L+LD+      +  
Sbjct: 125 QLDDPMLWIMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDTSAKALER 184

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +   +   A T G  + +A  + E++  +   LQ+     + +VP S L
Sbjct: 185 QFNLMISQAHTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSL 233


>gi|260892757|ref|YP_003238854.1| N-acetylmuramoyl-L-alanine amidase [Ammonifex degensii KC4]
 gi|260864898|gb|ACX52004.1| N-acetylmuramoyl-L-alanine amidase [Ammonifex degensii KC4]
          Length = 476

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 101/230 (43%), Gaps = 6/230 (2%)

Query: 171 ARIAIVVSGL-GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           AR+AIV+    G S+    R    L   +T A   N        +EA K G E ++ +PM
Sbjct: 232 ARVAIVIDDFAGPSEKKGTREFLSLNKPLTFAVLPNYPLSAPTAREAVKAGFEVLVHLPM 291

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +      +      + V    +++  R+  ++    G  G+ N+ G+   ++      + 
Sbjct: 292 EPLKGDPSWLGPGAIYVHLNDEEIERRVERAIASVPGAVGMNNHMGSRATADPRVIRAVL 351

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  ++ +++   +A +L +PY    L+LD   D   I+E+L+ L ++A 
Sbjct: 352 RVAKRHNLFFLDSKTTNKSVIPQIAKELGVPYAEDGLFLDAVNDVGHIKEQLRKLAQLAL 411

Query: 350 TTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
             G AI    V V    ++  I + L +     + +V +S L  L  P+S
Sbjct: 412 KNGSAIAIGHVGVTGPNTVRAIKEMLPEFERLGIELVYVSTL--LKHPAS 459


>gi|54307443|ref|YP_128463.1| hypothetical protein PBPRA0222 [Photobacterium profundum SS9]
 gi|46911863|emb|CAG18661.1| hypothetical protein PBPRA0222 [Photobacterium profundum SS9]
          Length = 271

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 105/224 (46%), Gaps = 4/224 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            +N   A++AIV+  LG         ++ LP  +T++   N         +AKK+ +E +
Sbjct: 48  STNIHAAQLAIVIDDLGYQ--AMPELLSNLPPEVTISILPNTPFDLAVAAQAKKQHRETL 105

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM+    +  E ++ T  ++Q  Q L + LR +L R      + N+ G+ L  + ++
Sbjct: 106 LHMPMEPEHLAPLEVNTLTSAMSQ--QTLQHTLRQALTRVPNAIAINNHMGSALSQDTQA 163

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              I  E  +  L + D  ++ +++ +  A   ++  +   ++LD    ++ + ++L   
Sbjct: 164 MGWIMAELKQHNLYYLDSRTTAKSIAQQQATSHHVLSLRRHVFLDHYQTKEFVTKQLMSA 223

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            + A+  G AI +      ++  +++ L      D+++V LS L
Sbjct: 224 IKRAKQYGYAIAIGHPHPVTLSTLNELLPNLTEEDITLVRLSTL 267


>gi|127514737|ref|YP_001095934.1| protein of unknown function DUF610, YibQ [Shewanella loihica PV-4]
 gi|126640032|gb|ABO25675.1| protein of unknown function DUF610, YibQ [Shewanella loihica PV-4]
          Length = 251

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 89/200 (44%), Gaps = 6/200 (3%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            A+++I++  +G  QT    A+  LP++ITL+   +    +R    A  KG E +L +PM
Sbjct: 18  AAQVSIIIDDIGYRQT--DEAVLALPSDITLSVLPHTPLGERLAAIAHDKGHEIMLHLPM 75

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF-GVMNYRGAMLLSNKESAEVI 288
           QA +         T    Q  +Q L R      +   Y  GV N+ G++L         +
Sbjct: 76  QALNGKEMGPGGLT---NQMSEQALKRAVDDAFKSVPYAKGVNNHMGSLLTQLDAPMTWL 132

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +   ++   F D  ++  +     A +L +P +   L+LD+ V    +  +   L ++A
Sbjct: 133 MESLKQQDNYFVDSMTTRYSKASDAANRLGIPLLRRQLFLDNDVSPQGLERQFNQLIQLA 192

Query: 349 RTTGQAIGVAVAFDESIEVI 368
              GQ I +A  + E+I  +
Sbjct: 193 NKEGQLIVIAHPYPETISFL 212


>gi|227354766|ref|ZP_03839183.1| protein of hypothetical function DUF610, YibQ [Proteus mirabilis
           ATCC 29906]
 gi|227165084|gb|EEI49915.1| protein of hypothetical function DUF610, YibQ [Proteus mirabilis
           ATCC 29906]
          Length = 304

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/214 (20%), Positives = 92/214 (42%), Gaps = 13/214 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F + A  A++AIV+   G  +    + + L P  +++A   N         +A  +G+E 
Sbjct: 7   FSAPAFSAKLAIVIDDFGYRKKEDNQILQL-PTAVSIAILPNSPHGKEMATKAHAQGREI 65

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQT-----VQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           ++ +PM    +   E D+    + Q      +Q  +NR+ Y++       G+ N+ G+ +
Sbjct: 66  LIHMPMAPISKQPLEKDTLKPSMDQAEINRIIQNAINRVPYAV-------GMNNHMGSAM 118

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            S++++ + + K      L F D  +         A    +P +   ++LD+     + R
Sbjct: 119 TSDRQAMDRVIKALNHSDLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETR 178

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           ++L     +AR  G AI +      ++  + Q L
Sbjct: 179 QQLNRAINLARKNGFAIAIGHPHPSTVRALQQQL 212


>gi|152998595|ref|YP_001364276.1| hypothetical protein Shew185_0040 [Shewanella baltica OS185]
 gi|151363213|gb|ABS06213.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS185]
          Length = 251

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 99/229 (43%), Gaps = 14/229 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S +  A+IA+++  +G   T   +A+  LP+ +TL+   +            KKG E +
Sbjct: 14  ISQSHAAQIALIIDDIGYRHT--DQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIM 71

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQ-----TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           L +PMQA +         T  +T+     +V   +N + ++        G  N+ G++L 
Sbjct: 72  LHLPMQALNGKALGLGGLTNTMTEAQIRASVVDAINSVPFA-------KGANNHMGSLLT 124

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              +    + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  
Sbjct: 125 QLDDPMLWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALER 184

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +   +   A+T G  + +A  + E++  +   LQ+     + +VP S L
Sbjct: 185 QFSLMISQAQTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSL 233


>gi|157964031|ref|YP_001504065.1| hypothetical protein Spea_4220 [Shewanella pealeana ATCC 700345]
 gi|157849031|gb|ABV89530.1| protein of unknown function DUF610 YibQ [Shewanella pealeana ATCC
           700345]
          Length = 251

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/224 (20%), Positives = 103/224 (45%), Gaps = 14/224 (6%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            ++IAI++  +G  Q+   +A+  LPANITL+   +         +A  +G E ++ +PM
Sbjct: 19  ASQIAIIIDDIGYRQS--DKAVLSLPANITLSILPHTPLGKDLASKAYIQGNEILVHLPM 76

Query: 230 QAFDESYNEDDSYT-----LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           QA +       + T     +K    V+  +N + ++        G  N+ G+ L    E 
Sbjct: 77  QALNGKTIGPGALTNTMSEIKFKAQVEDSINSVPHA-------SGANNHMGSFLTQLNEP 129

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              + +   +  + F D  ++      ++A  + +P +  +++LD+   +  + ++ K  
Sbjct: 130 MRWVMESLRQHNIYFIDSMTTKYTRAGIVAESMGIPILRREIFLDNDRSQSGLEKQFKHA 189

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             +A   G+ + +A  + E+I  +++ LQ+    ++ +V  S L
Sbjct: 190 ISLAHAKGKIVVIAHPYPETIAFLTKNLQRLANANIELVHTSQL 233


>gi|220936444|ref|YP_002515343.1| protein of unknown function DUF610 YibQ [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997754|gb|ACL74356.1| protein of unknown function DUF610 YibQ [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 279

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 100/216 (46%), Gaps = 5/216 (2%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAI++  LG +Q G  +    LP  +T+A   +         EA  +G+E +L +PMQA 
Sbjct: 37  IAIIIDDLG-NQPGPGQRTLALPGPVTVAVLPHTPFARPLANEAHAQGKEVMLHLPMQAT 95

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           +         T+ + +  + L      +L       GV N+ G++L  +    +    E 
Sbjct: 96  EALPLGPGGITVDMER--EALRETFLAALASVPHVRGVNNHMGSLLTRHIGHMDWFMAEL 153

Query: 293 AKR-GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE-KLKGLEEIART 350
           A + GL F D  ++  ++ + +A    LP    D++LD   D ++  E ++  L  +A+ 
Sbjct: 154 AAQSGLYFVDSRTTALSVAQRVALHHGLPATRRDVFLDTLPDNEEFVEAQMDQLISLAQR 213

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
            G A+ +   +  +++V+ + L   H   + +VP+S
Sbjct: 214 RGHALAIGHPYGATLDVLERRLATLHEAGIELVPVS 249


>gi|310641393|ref|YP_003946151.1| protein [Paenibacillus polymyxa SC2]
 gi|309246343|gb|ADO55910.1| Putative uncharacterized protein [Paenibacillus polymyxa SC2]
          Length = 311

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 78/164 (47%), Gaps = 1/164 (0%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           N    R+A+++  LG +  GT+  +NL P  IT+A      +  +   EA  +G + I+ 
Sbjct: 67  NQQQKRVAVIIDDLGNNMKGTKEILNL-PVKITVAVMPFLPTTKQDAMEAHNRGHDVIVH 125

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+             +K   T +++  ++  +++      G+ N+ G+ + S+K    
Sbjct: 126 LPMEPKQGKPEWLGPGAIKANMTDEEVRAKVTAAIKDVPYAIGMNNHMGSKVTSDKRIMS 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
           ++     + GL F D  ++  ++   LA K  +P +  D++LDD
Sbjct: 186 IVLDVCKEHGLFFVDSRTNYWSVVPELAAKKGMPPVRNDVFLDD 229


>gi|229084421|ref|ZP_04216701.1| hypothetical protein bcere0022_10610 [Bacillus cereus Rock3-44]
 gi|228698961|gb|EEL51666.1| hypothetical protein bcere0022_10610 [Bacillus cereus Rock3-44]
          Length = 253

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 93/207 (44%), Gaps = 4/207 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+   G +  GT+R ++ LP  +T+A      S  +    A +KG E IL +
Sbjct: 23  AHTNKVAIVIDDFGNNMKGTERMLS-LPIPLTVAVMPFLPSTKQDAVAAHQKGHEVILHM 81

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+             +    + Q++  R+  +++      G+ N+ G+ + +++    +
Sbjct: 82  PMEPIKGKKEWLGPKAITTDLSDQEIEKRIEQAIQDVPHAIGMNNHMGSKVTADERIMRI 141

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           I     K  L + D  ++P ++   +  +L +P +   L+ DD      I ++ + L  +
Sbjct: 142 ILSVCKKHNLFYLDSKTNPNSVVPKIGKELGVPIVENQLFFDDVYTSSHITKQAQVL--L 199

Query: 348 ARTTGQAIGVAVAF-DESIEVISQWLQ 373
            R   + + VA+       E+ SQ +Q
Sbjct: 200 QRIQEKPVVVAIGHVGPPGEITSQVIQ 226


>gi|304412443|ref|ZP_07394050.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS183]
 gi|307305787|ref|ZP_07585533.1| protein of unknown function DUF610 YibQ [Shewanella baltica BA175]
 gi|304349278|gb|EFM13689.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS183]
 gi|306911280|gb|EFN41706.1| protein of unknown function DUF610 YibQ [Shewanella baltica BA175]
          Length = 251

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 98/229 (42%), Gaps = 14/229 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S +  A+IA+++  +G   T   +A+  LP+ +TL+   +            KKG E +
Sbjct: 14  ISQSHAAQIALIIDDIGYRHT--DQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIM 71

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQ-----TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           L +PMQA +         T  +T+     +V   +N + ++        G  N+ G++L 
Sbjct: 72  LHLPMQALNGKALGLGGLTNTMTEAQIRASVVDAINSVPFA-------KGANNHMGSLLT 124

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              +    + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  
Sbjct: 125 QLDDPMLWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALER 184

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +   +   A T G  + +A  + E++  +   LQ+     + +VP S L
Sbjct: 185 QFNLMISQAHTQGSLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSL 233


>gi|260655308|ref|ZP_05860796.1| divergent polysaccharide deacetylase family protein [Jonquetella
           anthropi E3_33 E1]
 gi|260629756|gb|EEX47950.1| divergent polysaccharide deacetylase family protein [Jonquetella
           anthropi E3_33 E1]
          Length = 308

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 109/252 (43%), Gaps = 21/252 (8%)

Query: 140 SKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLL-PA-N 197
           S +  + + + GRE  E           +  A +A+V+   G S T  Q+  +L  P+ +
Sbjct: 60  SPEPTIVEPEAGREPGE----------RSGKALMALVIDDFGTSLTIAQQIASLGGPSRS 109

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL---L 254
            T A   + ++       A K GQ  I+ +PMQA  +     D Y +    + +Q+   +
Sbjct: 110 FTWAIMPDCSASLSCAHLADKIGQPYIVHLPMQAIIDPAGHRD-YLIGTDSSPEQVRRQV 168

Query: 255 NRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA-KRGLLFFDDGSSPRNLTRVL 313
            R+R    R     GV N+RG+   S++ + E      A + G  F D  +S +++ R  
Sbjct: 169 ERMRSLFPRA---LGVNNHRGSKATSSQNTMEAFGAAMADQTGWGFLDSRTSGKSVARST 225

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
             K  +P +    ++D   D D ++ +      IAR+ G  I +  A   ++  + +W+ 
Sbjct: 226 VAKYGVPALANMAFIDGVSDLDYMKGQFAKALRIARSRGVGIAICHARTGTLPFL-RWVC 284

Query: 374 QEHVRDVSVVPL 385
            +    V  VPL
Sbjct: 285 SQQFGGVQFVPL 296


>gi|227824417|ref|ZP_03989249.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904916|gb|EEH90834.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 333

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/231 (23%), Positives = 98/231 (42%), Gaps = 6/231 (2%)

Query: 161 DKNFCSNASGA---RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           D+N    A GA   R+AIV+   G  Q G  R +  LP  +T A      +    +   +
Sbjct: 104 DENSLGLAPGAYKGRLAIVIDDCGY-QLGPVRTLTSLPLKMTFAVIPFKPNSAAALSIIR 162

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
             G  A+L +PM+    S    ++  + V QT  Q+ + ++ ++    G  GV N++G+ 
Sbjct: 163 NSGHTAMLHLPMEPV--SGGSSETRFVGVGQTKAQIASFVQEAIDSLPGISGVNNHQGSK 220

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
             ++  +         + GL F D  ++   +    A  L +P     L+LD+  D   I
Sbjct: 221 ATAHGPTIRAALSVIGENGLFFIDSRTNSATVAEREAGNLGIPTGHNSLFLDNSSDIGAI 280

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            EK+    ++A   G  I +  A   + E   +  +      +++VP + L
Sbjct: 281 EEKIAQAVKLADRYGSVIVICHARPNTAEAWKRSYKAVIQSGITLVPAASL 331


>gi|160873170|ref|YP_001552486.1| hypothetical protein Sbal195_0044 [Shewanella baltica OS195]
 gi|160858692|gb|ABX47226.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS195]
 gi|315265395|gb|ADT92248.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS678]
          Length = 251

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/229 (20%), Positives = 98/229 (42%), Gaps = 14/229 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S +  A+IA+++  +G   T   +A+  LP+ +TL+   +            KKG E +
Sbjct: 14  ISQSHAAQIALIIDDIGYRHT--DQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIM 71

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQ-----TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           L +PMQA +         T  +T+     +V   +N + ++        G  N+ G++L 
Sbjct: 72  LHLPMQALNGKALGLGGLTNTMTEVQIRASVVDAINSVPFA-------KGANNHMGSLLT 124

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
              +    + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  
Sbjct: 125 QLDDPMLWVMETLKQKHLYFVDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALER 184

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +   +   A T G  + +A  + E++  +   LQ+     + +VP S L
Sbjct: 185 QFSLMISEAHTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSL 233


>gi|109899910|ref|YP_663165.1| protein of unknown function DUF610, YibQ [Pseudoalteromonas
           atlantica T6c]
 gi|109702191|gb|ABG42111.1| protein of unknown function DUF610, YibQ [Pseudoalteromonas
           atlantica T6c]
          Length = 255

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/224 (20%), Positives = 101/224 (45%), Gaps = 3/224 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A  A+IAI++  +G +      A+ L P N+ ++   + +   ++   A ++ +E +
Sbjct: 20  TSAALSAQIAIIIDDVGNNSHRDAAALGL-PINVAISILPHKHLSQKYALMAHEQHREFL 78

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM++      E  S  L  + + ++++  L  +        G+ N+ G+ L   +  
Sbjct: 79  LHMPMESMAGIKQE--SNVLLASMSDKRIVQTLNDAFASVPNALGLNNHMGSRLTQLETP 136

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
                    + GL+F D  ++       +A +  +P +   ++LD+ +   KI  +   L
Sbjct: 137 MRTTMSYLHRHGLIFVDSRTTALTRAEAIAKQTKVPALRRHVFLDNDLSEAKIERQFNIL 196

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            + AR  G+++ +     ++I  + + L      DV ++PLS +
Sbjct: 197 VKRARKYGRSLAIGHPHMQTIAYLKKRLPTLAQDDVQLIPLSAM 240


>gi|71278442|ref|YP_271042.1| hypothetical protein CPS_4393 [Colwellia psychrerythraea 34H]
 gi|71144182|gb|AAZ24655.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 259

 Score = 58.2 bits (139), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 92/223 (41%), Gaps = 4/223 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A   ++AIV+  +G   T  + A+ L P  IT AF  +     +   +A     + ++
Sbjct: 26  SIAQANQVAIVIDDMGYRYTD-KHALTL-PGAITYAFLPHTTYGKKLAMQANSTNHDVLI 83

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            IPM++  E+  +     L      Q     L  S        G+ N+ G+ L    +  
Sbjct: 84  HIPMES--ENRKKLGPGALTSNMDEQAFSQSLTKSFAEIPFAIGINNHMGSYLTQLYQPM 141

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
                   +  L F D  +SP +  +  A    +P     ++LD+++    I ++ K L 
Sbjct: 142 AWTMTFLKQHDLFFLDSKTSPHSQAQQAAIDFGVPVKARHIFLDNELTEKYISQQFKQLI 201

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             A+    AI +A    E++  +++ +    +  + +VPLS L
Sbjct: 202 HFAQKHQTAIAIAHPHPETVATLNKLIPTLKLHGIELVPLSRL 244


>gi|258645566|ref|ZP_05733035.1| polysaccharide deacetylase [Dialister invisus DSM 15470]
 gi|260402924|gb|EEW96471.1| polysaccharide deacetylase [Dialister invisus DSM 15470]
          Length = 375

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 94/223 (42%), Gaps = 3/223 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S++   R+A+V+   G+    +QR    +   +TLA   N         E  + G   IL
Sbjct: 153 SSSVTGRLAVVIDDAGLDLE-SQRIYEEIGVPLTLAVMPNKMYTSEAAAEWSRYGMPVIL 211

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
             PM+    S  E+   T+  + + + +   L+ SL +     G+ N++G+   ++    
Sbjct: 212 HQPMEPVSGSGMEEK--TILTSMSDEAIRYMLKESLEQIPQAVGINNHQGSRATTDARVM 269

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            V+  E + RGL FFD  ++        A    +PY   DL++D+  D  +IR  ++   
Sbjct: 270 RVVMNELSHRGLFFFDSRTNTTTAADSAAASYGVPYARNDLFVDNSADEGEIRAMIQEGA 329

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             A+  G  I +      +  V    + Q   + +  V +S L
Sbjct: 330 NRAKARGSYIIIGHCRPHTAAVFRDIVPQLQAQGIEFVYVSSL 372


>gi|227114297|ref|ZP_03827953.1| hypothetical protein PcarbP_15088 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 315

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 92/201 (45%), Gaps = 3/201 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISIAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E D  TL+   + +++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLERD--TLRPDMSSEEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A   N+  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTNVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWL 372
           G AI +      +I V+ Q L
Sbjct: 202 GSAIAIGHPHPSTIRVLQQML 222


>gi|317494739|ref|ZP_07953151.1| divergent polysaccharide deacetylase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917341|gb|EFV38688.1| divergent polysaccharide deacetylase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 305

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 103/239 (43%), Gaps = 18/239 (7%)

Query: 165 CSNASG--ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           CS AS    ++AIV+   G  +   +  I  +P  I++A             +A  +G+E
Sbjct: 16  CSAASAYAGKLAIVIDDFGY-RPQEENKILQMPLAISVAVLPTAPHAREMATKAHAQGRE 74

Query: 223 AILQIPMQAFDESYNEDDSYT-----LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
            ++ +PM    +   E D+        ++ + + Q +N + Y++       G+ N+ G++
Sbjct: 75  ILIHLPMAPISKQPLEKDTLQPSMSEAEIQRIIHQAVNSVPYAV-------GMNNHMGSL 127

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRN--LTRVLAPKLNLPYMVADLYLDDQVDRD 335
           + SN +  + + +   +   L+F D  +  N  +T   A    +  +   ++LDD  +  
Sbjct: 128 MTSNLQGMQKVMRTLEQYHFLYFLDSMTIGNSQVTNASA-GTGIKVIKRRVFLDDSQNEA 186

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
            IR++     +IAR  G AI +      ++ V+ Q L       V V P S L   S P
Sbjct: 187 SIRQQFNRAIQIARKNGSAIAIGHPHPSTVRVLQQMLPSLPADIVLVRPSSLLNGASVP 245


>gi|70733871|ref|YP_257511.1| polysaccharide deacetylase family protein [Pseudomonas fluorescens
           Pf-5]
 gi|68348170|gb|AAY95776.1| polysaccharide deacetylase family protein [Pseudomonas fluorescens
           Pf-5]
          Length = 268

 Score = 57.8 bits (138), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/229 (18%), Positives = 102/229 (44%), Gaps = 7/229 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A  A +++++  LG +    +R + L P  +T A   +      + +EA + G+  I
Sbjct: 33  TAAAPKAYLSLIIDDLGQNLPRDRRVLAL-PGPVTTAIMPDTPHAAEFAREAHRAGKIVI 91

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            +       +++L  RL  + +      G+ N+ G+ + +  ++
Sbjct: 92  LHMPMDP------ATGPFAWHPELPIEELQKRLEAAFQAVPYTSGINNHMGSRMTAQPQA 145

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  +  +R   F D  +S + +    A K+ L  +  D++LDD+     I ++L+  
Sbjct: 146 MAWLMADLQRRHKFFVDSRTSAQTVAAAEAQKIGLASVSRDVFLDDERTEAAISQQLQTA 205

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            ++AR  G A+ +   + +++ V+ + L +   + +  + +  +  L S
Sbjct: 206 IKLARKQGSAVMIGHPYPQTLAVLERELPRLKAQGIEWIDIKSMISLRS 254


>gi|212712560|ref|ZP_03320688.1| hypothetical protein PROVALCAL_03655 [Providencia alcalifaciens DSM
           30120]
 gi|212684776|gb|EEB44304.1| hypothetical protein PROVALCAL_03655 [Providencia alcalifaciens DSM
           30120]
          Length = 357

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/220 (19%), Positives = 98/220 (44%), Gaps = 4/220 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           S A++AIV+   G  +      I  LP  I++A   N          A ++G++ ++ +P
Sbjct: 23  SAAKLAIVIDDFGY-RVKEDNQILALPVAISIAILPNSPHGAEVAATAYQQGRDILIHMP 81

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+   +   E D  TL  + + +++   ++ ++ R     G+ N+ G+ + S+      +
Sbjct: 82  MKPLSKQPLEKD--TLAPSMSAEEVDRIIKNAISRVPHAKGMNNHMGSEMTSSLSGMRNV 139

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +  ++  L F D  +         A +  +P    ++++D+    ++ R +L      A
Sbjct: 140 MRSLSQSNLFFLDSVTIGNTQAVNAAKEFGVPSAKRNIFIDNHQSEEETRTQLNKAIAYA 199

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G A+ +      ++  + +++ Q    D+ +VP+S L
Sbjct: 200 RKHGSAVAIGHPHPSTVRALQKFIPQVPA-DIELVPVSTL 238


>gi|237728916|ref|ZP_04559397.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226909538|gb|EEH95456.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 311

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 89/209 (42%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F +     ++AIV+   G  +  T+  +  +P+ I++A   N         +A   G E 
Sbjct: 18  FATPVFAGKLAIVIDDFGY-RPHTENQVLAMPSTISVAVLPNAPHAREMAIKAHNSGHEV 76

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R ++ +     G+ N+ G+ + S+  
Sbjct: 77  LIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIRDAVSKVPNAVGLNNHMGSAMTSSLF 134

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 135 GMQKVMQALERYDLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
             E+AR  G AI +      ++ V+ Q L
Sbjct: 195 AVELARRNGSAIAIGHPHPSTVRVLQQML 223


>gi|329929364|ref|ZP_08283112.1| divergent polysaccharide deacetylase [Paenibacillus sp. HGF5]
 gi|328936451|gb|EGG32896.1| divergent polysaccharide deacetylase [Paenibacillus sp. HGF5]
          Length = 293

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 39/187 (20%), Positives = 90/187 (48%), Gaps = 3/187 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++A+++   G  Q GT+  +NL P  IT+A      +  +  + A ++G + I+ +PM+ 
Sbjct: 61  KLAVIIDDFGNDQKGTEEMLNL-PVKITVAVMPFLPTSKKDAEAAHQQGHDVIIHMPMEP 119

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +  + T +++  R+  ++       G+ N+ G+ +  ++    ++   
Sbjct: 120 KQGRSSWLGPGAILSSLTDEEIRKRMEEAIDSVPYAVGINNHMGSKVTGDERVMSIVLDV 179

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE--IAR 349
             +RGL F D  ++  ++   LA  + +P +  D++LDD      + ++L+   +  + R
Sbjct: 180 CRERGLFFVDSKTNYYSVVGKLAASMGMPSIANDIFLDDVHTVQHVSKQLQTAAQHAVER 239

Query: 350 TTGQAIG 356
           T+  AIG
Sbjct: 240 TSCIAIG 246


>gi|238760441|ref|ZP_04621579.1| hypothetical protein yaldo0001_39810 [Yersinia aldovae ATCC 35236]
 gi|238701336|gb|EEP93915.1| hypothetical protein yaldo0001_39810 [Yersinia aldovae ATCC 35236]
          Length = 336

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/211 (20%), Positives = 90/211 (42%), Gaps = 3/211 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G       + + + P  I++A   N         +A  +G+E 
Sbjct: 17  LASAAQAGKLSIVIDDFGYRPQNENKILQM-PLPISVAILPNAPHAKEMAMKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYAKGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
             E+AR  G AI +      +I+V+ Q L Q
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQ 224


>gi|261408347|ref|YP_003244588.1| hypothetical protein GYMC10_4558 [Paenibacillus sp. Y412MC10]
 gi|261284810|gb|ACX66781.1| protein of unknown function DUF610 YibQ [Paenibacillus sp.
           Y412MC10]
          Length = 293

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/187 (21%), Positives = 90/187 (48%), Gaps = 3/187 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++A+++   G  Q GT+  +NL P  IT+A      +  +  + A ++G + I+ +PM+ 
Sbjct: 61  KLAVIIDDFGNDQKGTEEMLNL-PVKITVAVMPFLPTSKKDAEAAHQQGHDVIIHMPMEP 119

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +  + T +++  R+  ++       G+ N+ G+ +  ++    ++   
Sbjct: 120 KQGRSSWLGPGAILSSLTDEEIRKRMEEAIDSVPYAVGINNHMGSKVTGDERVMSIVLDV 179

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA--R 349
             +RGL F D  ++  ++   LA K  +P +  D++LDD      + ++L+   + A  R
Sbjct: 180 CRERGLFFVDSKTNYYSVVGKLAAKKGMPSISNDIFLDDVHTVQHVSKQLQTAAQHAEER 239

Query: 350 TTGQAIG 356
           T+  AIG
Sbjct: 240 TSCIAIG 246


>gi|91795046|ref|YP_564697.1| protein of unknown function DUF610, YibQ [Shewanella denitrificans
           OS217]
 gi|91717048|gb|ABE56974.1| protein of unknown function DUF610, YibQ [Shewanella denitrificans
           OS217]
          Length = 245

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 88/205 (42%), Gaps = 4/205 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F     GA++AI++  +G  QT    A+  LP  ITL+   +     +  ++  KKG E 
Sbjct: 2   FIQPVFGAKLAIIIDDIGYRQT--DEAVLSLPNTITLSVLPHTPLGQKLAQDGHKKGHEI 59

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +    E     L    T  Q+  +L  ++       G  N+ G++L   ++
Sbjct: 60  MLHLPMQALNGK--ELGPGGLTNVMTEGQIKQQLHSAVSSIPFAKGANNHMGSLLTQMQD 117

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  L F D  ++        A  L +P +   ++LD+ +    ++ +   
Sbjct: 118 PMRWVMESLKQNNLYFVDSMTTRFTKATASAQSLGVPTLKRQIFLDNDISEAALQRQFNL 177

Query: 344 LEEIARTTGQAIGVAVAFDESIEVI 368
           +   A+   Q I +A    E+I  +
Sbjct: 178 IMVKAKQEQQVIAIAHPHPETIRFL 202


>gi|288555887|ref|YP_003427822.1| putative polysaccharide de-acetylase [Bacillus pseudofirmus OF4]
 gi|288547047|gb|ADC50930.1| putative polysaccharide de-acetylase [Bacillus pseudofirmus OF4]
          Length = 271

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 86/179 (48%), Gaps = 4/179 (2%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           +EA   G E I+ +P++      +      +    + +++  R+  ++       G+ N+
Sbjct: 77  EEAHHAGLEVIIHLPLEPKKGKASWLGPKGITSDLSNEEVRKRVEEAIEDVPHAVGLNNH 136

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV- 332
            G+ ++ ++    VI     + GL   D G+S +++   LA +  +PY + D++LDD + 
Sbjct: 137 MGSKIVEDRRIMGVILDVVKEHGLYVIDSGTSNKSVISELAEERRIPYSIRDVFLDDSLS 196

Query: 333 DRDKIREKLKGLEEIARTTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            R  + ++++ L+++A   G AIG   V V  +E+   I   L+      V +VP S +
Sbjct: 197 SRSHVAKQMRLLQKVAAVEGDAIGIGHVGVKGEETAAGILSSLRDLEKNKVQIVPASHI 255


>gi|148263945|ref|YP_001230651.1| protein of unknown function DUF610, YibQ [Geobacter uraniireducens
           Rf4]
 gi|146397445|gb|ABQ26078.1| protein of unknown function DUF610, YibQ [Geobacter uraniireducens
           Rf4]
          Length = 313

 Score = 57.4 bits (137), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 95/202 (47%), Gaps = 5/202 (2%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFAS-NGNSLDRWMKEAKK-KGQEAILQIPMQ 230
           +AI+V  +G S    Q   +L+  +I + F+   G +  + + EA    G E ++ +PM+
Sbjct: 97  VAIIVDDMGSS---MQEVRSLMAIDIPVTFSIIPGLAKSKGVAEAAHGNGGEVMVHMPME 153

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                    +   L ++++ +++  +++  L+      G  N+ G+    N+E  + + K
Sbjct: 154 PKGYPKQRMEKNGLLLSESDEEIAAKVKAYLQAVPYAVGANNHMGSRFTENEEKMQSVLK 213

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
               R + F D  +SP ++   LA K+ L      ++LD+  +   I+ +L+ + + AR 
Sbjct: 214 VLKGREMFFVDSKTSPASVGYSLARKMGLKAGTRQVFLDNVQNVAAIKAQLQQVADTARK 273

Query: 351 TGQAIGVAVAFDESIEVISQWL 372
            G AI +      +I+ +S  L
Sbjct: 274 RGSAIAICHPHQTTIQALSSML 295


>gi|332307949|ref|YP_004435800.1| hypothetical protein Glaag_3602 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175278|gb|AEE24532.1| protein of unknown function DUF610 YibQ [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 273

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 87/195 (44%), Gaps = 2/195 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP N+ ++   + +   ++   A ++ +E +L +PM++      E +   L  +   + +
Sbjct: 60  LPVNVAISILPHKHFSQKYALLAHEQRREYLLHMPMESMAGLKQEAN--VLLASMNDKTI 117

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
           +  L  +        G+ N+ G+ L   +           + GL+F D  +S +     +
Sbjct: 118 VQTLHAAFASVPNALGMNNHMGSRLTQLETPMRTTMDYLHRHGLIFVDSRTSAQTQAEAI 177

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A + N+P +   ++LD+ +  DKI  +   L   AR  G++I +     ++I  + + L 
Sbjct: 178 AKQQNVPALRRHVFLDNVLAEDKIALQFNLLVRKARKYGRSIAIGHPHKQTIAYLQKRLP 237

Query: 374 QEHVRDVSVVPLSCL 388
                +V +VPLS +
Sbjct: 238 TLAQENVQLVPLSAM 252


>gi|114045553|ref|YP_736103.1| hypothetical protein Shewmr7_0040 [Shewanella sp. MR-7]
 gi|113886995|gb|ABI41046.1| protein of unknown function DUF610, YibQ [Shewanella sp. MR-7]
          Length = 251

 Score = 57.0 bits (136), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 99/221 (44%), Gaps = 4/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           ++ A+IA+++  +G   T    A+  LP+ +TL+   +    ++  K A  KG E +L +
Sbjct: 17  SNAAQIALIIDDIGYRHT--DEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHEIMLHL 74

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQA +         T  +++T  Q+ + +  ++       G  N+ G++L    +    
Sbjct: 75  PMQALNGKALGVGGLTNNMSET--QIRSSVLAAIASVPFAKGANNHMGSLLTQLDDPMLW 132

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +   ++ L F D  ++        A  L +P +   L+LD+ V    + ++   +   
Sbjct: 133 VMETLKQKQLYFVDSMTTKFTKAGDKADSLGVPLLRRQLFLDNDVSAAALEKQFNLMISQ 192

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A + G  + +A  + E+I  +   L +     + +VP S L
Sbjct: 193 AHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSL 233


>gi|330961870|gb|EGH62130.1| hypothetical protein PMA4326_25287 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 258

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 97/218 (44%), Gaps = 7/218 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +     R + L P  +TLA   +      + ++A + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNPERDSRTLAL-PGPVTLAIMPDTPHATDFARQAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLA------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMAWLMA 143

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R L F D  +S + +    A +  L  +  D++LDD+   + I  +L+   ++A  
Sbjct: 144 ELQRRHLFFVDSRTSAKTVAAAEAQRAGLASVSRDVFLDDERTAEAITRQLQTAVKLAHK 203

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            G A+ +   +  +++V+ + L +   + V  + L  +
Sbjct: 204 QGSAVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSM 241


>gi|170729198|ref|YP_001763224.1| hypothetical protein Swoo_4880 [Shewanella woodyi ATCC 51908]
 gi|169814545|gb|ACA89129.1| protein of unknown function DUF610 YibQ [Shewanella woodyi ATCC
           51908]
          Length = 251

 Score = 57.0 bits (136), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 91/204 (44%), Gaps = 4/204 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S    A++AI++  +G  Q+    A+  LP NITL+   +          A ++G E +
Sbjct: 13  SSFTHAAQVAIIIDDIGYRQS--DEAVLTLPENITLSVLPHTPLGHSVASAAHERGHEIM 70

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PMQA +         T  + ++  +L   ++ +        G  N+ G++L   +E 
Sbjct: 71  VHLPMQALNGKALGPGGLTNTMGES--ELKKSIQSAFLSVPFAKGANNHMGSLLTQLEEP 128

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              + +   ++ L F D  ++        A +L +P +  +L+LD+ +    +  +   L
Sbjct: 129 MLWVMESLKQQDLYFVDSMTTRFTKAGTTADQLGIPQLKRELFLDNDISAAALDRQFSKL 188

Query: 345 EEIARTTGQAIGVAVAFDESIEVI 368
             +A   GQ + +A  + E+IE +
Sbjct: 189 ITLAHNQGQIVAIAHPYPETIEFL 212


>gi|116750484|ref|YP_847171.1| hypothetical protein Sfum_3062 [Syntrophobacter fumaroxidans MPOB]
 gi|116699548|gb|ABK18736.1| protein of unknown function DUF610, YibQ [Syntrophobacter
           fumaroxidans MPOB]
          Length = 430

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/217 (20%), Positives = 97/217 (44%), Gaps = 1/217 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+   G +    ++ +++ P  ++ A   N        + A    +E +L +PM+ 
Sbjct: 203 KVAIVIDDFGQNLEVAKKFLSI-PLPLSFAILPNQRHTAEIAELAHAHHREVLLHLPMEP 261

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 +  S  L  + +  +L   L  +L     + GV N+ G+    N  S  V+  E
Sbjct: 262 QGYPKMDPGSGALLTSMSRGRLRRTLLAALDSTPYFIGVNNHMGSKFTENTPSMRVVMSE 321

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
              R L F D  ++  ++   LA +  +P    D++LD  +  + ++ ++  L   A+  
Sbjct: 322 LRHRKLFFLDSATTGDSVGFALAREYGIPARKRDIFLDHTLTDEAVQSQVDQLIRKAKIE 381

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           G A+ +    + +++ + + + +    +V+VVP S L
Sbjct: 382 GTALAIGHPHEVTLKALIEGVDRFKEENVAVVPSSEL 418


>gi|83858363|ref|ZP_00951885.1| polysaccharide deacetylase family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853186|gb|EAP91038.1| polysaccharide deacetylase family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 322

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 101/223 (45%), Gaps = 4/223 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AI++  +G+     ++ + L  A +TL+      +     + A   G+E  + +PM+ 
Sbjct: 98  QLAIIMDDVGLDVAAAEQLLAL-DAPLTLSILPYAEAAPVIARRAADAGREVFVHLPMEP 156

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 +   Y L   Q+  ++ +R+R++  R  G  G  N+ G+ L S++ + + +F  
Sbjct: 157 V--GVEDPGPYALTEFQSADEMSSRIRWAFSRVPGATGFNNHMGSRLTSDRRAMDALFTA 214

Query: 292 FA-KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
            A    L+F D  + PR+     A    L  +  D++LD   D   +  +L     +A  
Sbjct: 215 GAFPSQLIFVDSLTHPRSQAARSARAAGLNALTRDVFLDHAPDEASVSAQLNLALALALQ 274

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            GQAI +     +++ V++   ++     V +V +  L+  +S
Sbjct: 275 NGQAIAIGHPRPQTLAVLADLTRRAEAVGVELVTVQALSATAS 317


>gi|227328077|ref|ZP_03832101.1| hypothetical protein PcarcW_12385 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 315

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/201 (20%), Positives = 91/201 (45%), Gaps = 3/201 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLERD--TLRPDMSSDEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A   N+  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTNVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWL 372
           G AI +      +I V+ Q L
Sbjct: 202 GSAIAIGHPHPSTIRVLQQML 222


>gi|238794396|ref|ZP_04638007.1| hypothetical protein yinte0001_39420 [Yersinia intermedia ATCC
           29909]
 gi|238726297|gb|EEQ17840.1| hypothetical protein yinte0001_39420 [Yersinia intermedia ATCC
           29909]
          Length = 343

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 96/221 (43%), Gaps = 3/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDFGYRPQNENKILQM-PLPISVAILPNAPYAREMAIKAHNQGREILIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSKQPLERD--TLQPSMSSEEIQRIMRQAVNNVPYAKGMNNHMGSAMTSSFSGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +E     L F D  +   +     A   ++  +   ++LDD  +   IR++     E+
Sbjct: 138 VMQELDHYQLYFLDSVTIGNSQAGRAAEGTHVKVIKRKVFLDDSQNEAAIRQQFNRAVEL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           AR  G AI +      +I+V+ Q L Q     V V P + L
Sbjct: 198 ARRNGSAIAIGHPHPATIKVLQQMLPQLPADIVLVRPSALL 238


>gi|308188636|ref|YP_003932767.1| hypothetical protein Pvag_3176 [Pantoea vagans C9-1]
 gi|308059146|gb|ADO11318.1| Uncharacterized protein yibQ precursor [Pantoea vagans C9-1]
          Length = 300

 Score = 56.6 bits (135), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 91/214 (42%), Gaps = 13/214 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++AIV+  +G       + + + P  I++A   N         +A + G E 
Sbjct: 16  FSYAAQAGKLAIVIDDVGYRPAEENKVLQM-PQAISVAVLPNAPHAHEMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLK-----VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           ++ +PM    +   E D+ T +     VT+ ++  +N + Y++       G+ N+ G+ +
Sbjct: 75  LIHLPMAPLSKQPLEKDTLTPEMSSEEVTRIMRNAVNNVPYAV-------GLNNHMGSRM 127

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            S+    + + +      L F D  +   +     A    +  +   ++LDD  D + IR
Sbjct: 128 TSSLPGMQKVMQALNHYNLYFLDSMTIANSQAIPAAQGTQVKVLKRRVFLDDSQDINAIR 187

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           ++     ++A+  G AI +      ++ V+ Q L
Sbjct: 188 QQFSRAVKLAQRDGYAIAIGHPHPTTVRVLQQML 221


>gi|114565173|ref|YP_752687.1| protein of unknown function DUF610, YibQ [Shewanella frigidimarina
           NCIMB 400]
 gi|114336466|gb|ABI73848.1| protein of unknown function DUF610, YibQ [Shewanella frigidimarina
           NCIMB 400]
          Length = 238

 Score = 56.2 bits (134), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 45/226 (19%), Positives = 103/226 (45%), Gaps = 14/226 (6%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A+  ++AI++  +G   T    A   LP++ITL+   +     +  ++   KG E +L +
Sbjct: 3   ATATKLAIIIDDIGYRLT--DEAALSLPSSITLSVLPHTPLGQKLAQDGYHKGHEIMLHL 60

Query: 228 PMQAFD-----ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
           PMQA +          +D    ++ Q +Q   + + ++        G  N+ G++L    
Sbjct: 61  PMQALNGKALGPGGLTNDMNEAQIKQQLQSAFSNIPFAK-------GANNHMGSLLTQMD 113

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           E    + +   ++ L F D  ++        A +L +P +   ++LD+ +    +  + +
Sbjct: 114 EPMLWVMQSLKQQQLFFVDSFTTKYTKASSKAMQLGVPSLRRHIFLDNDIGERALERQFQ 173

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +   ++  G+ + +A  + E+I  ++  L + +  D+++VP S L
Sbjct: 174 QMITQSKQQGKLVVIAHPYPETIRFLNANLARLNDNDITLVPTSQL 219


>gi|222823948|ref|YP_002575522.1| polysaccharide deacetylase domain protein [Campylobacter lari
           RM2100]
 gi|222539170|gb|ACM64271.1| conserved hypothetical protein, polysaccharide deacetylase domain
           protein [Campylobacter lari RM2100]
          Length = 355

 Score = 56.2 bits (134), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 84/163 (51%), Gaps = 4/163 (2%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +P+ A    Y++ +  TL     +Q++  R+ +   +      + N+ G++  +NK+
Sbjct: 194 MVHLPLAAI--KYDKAELNTLHPGDDMQKIGKRVAFVKEQFPKVKFINNHTGSLFTANKQ 251

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E +F  F +   +F D  +  ++  + LA + N PY+  D++LD++ D   I+ +LK 
Sbjct: 252 AMEKLFSAFKQNDFVFVDSRTIGKSKAKNLASQFNQPYIARDVFLDNEDDIVYIKNQLKQ 311

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
             E A+  G AI +    +++ + + Q   +E +  V +V L+
Sbjct: 312 AVEEAKKKGFAIAIGHPREKTFKALVQ--SKELLNSVELVYLN 352


>gi|311695899|gb|ADP98772.1| secreted protein containing DUF610, YibQ [marine bacterium HP15]
          Length = 271

 Score = 56.2 bits (134), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 3/216 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAI++  +G S    +R  NL    +TLAF       D   + A K+ +E +L  PM A 
Sbjct: 32  IAIIIDDMGHSLVEGERLANL-DQPLTLAFLPYRPHTDSLARLAYKQHKEIMLHAPM-AN 89

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
             +Y       L      Q +   LR +L+      GV N+ G++L    +  + + KE 
Sbjct: 90  TRNYGLGPG-GLTPEMDEQSMATTLRRALQSIPHVQGVNNHMGSLLTQQLQPMDWVMKEL 148

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +  + F D  +   ++   +A    +P M  D++LD +   + +  + K L + A+  G
Sbjct: 149 FRYPVYFIDSRTIASSVAGDVAAAYRIPTMTRDVFLDHEQTEEFVDRQFKLLIKRAKENG 208

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            AIG+      +++ + + L +   + +++  +S L
Sbjct: 209 SAIGIGHPHKVTVDYLEKHLPKLDEQGIAIATVSGL 244


>gi|170718741|ref|YP_001783929.1| protein of unknown function DUF610 YibQ [Haemophilus somnus 2336]
 gi|168826870|gb|ACA32241.1| protein of unknown function DUF610 YibQ [Haemophilus somnus 2336]
          Length = 285

 Score = 56.2 bits (134), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 102/219 (46%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G  +      I  LP  +++A   +     +  ++AK++ ++ ++ +PMQ 
Sbjct: 32  KLAIVIDDIG-YRLKEDNQIYSLPKEVSVAIIPSAPHAKQRDQQAKQQNRDILIHLPMQP 90

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            ++   ED    L ++Q   ++  R+R +        G+ N+ G+   ++K+    +   
Sbjct: 91  LNQQKIEDGGIKLGMSQP--EVYQRVRNAKSILPNAIGMNNHMGSAATADKDLMNKLMTA 148

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  R++   +A +  +P +   ++LDD      ++ +     + AR  
Sbjct: 149 LLQQNLFFLDSRTIGRSVAGKIAREFGIPTLERHIFLDDSDKLSDVQRQWNAAIQYARKR 208

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   ++Q   +D+ +V +  L +
Sbjct: 209 GTAIVIGHPRKNTIAVLQMGIKQLP-KDIQLVGIGSLWR 246


>gi|94499747|ref|ZP_01306283.1| hypothetical protein RED65_14537 [Oceanobacter sp. RED65]
 gi|94427948|gb|EAT12922.1| hypothetical protein RED65_14537 [Oceanobacter sp. RED65]
          Length = 293

 Score = 56.2 bits (134), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 103/236 (43%), Gaps = 8/236 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S+ S A++AI++  +G S      AI  LP NIT A   +     +  + A + G+E +
Sbjct: 22  ASSPSVAQLAIIIDDIGNSWQKGLDAI-ALPGNITFAVMPHRKHSIQLAERAGRLGKEVM 80

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L  PM   +       +    + + + +L  RLR+++       G+ N+ G+ L ++  +
Sbjct: 81  LHAPMATMNNRELGAGALHENLGEKLFKL--RLRFAIDNIPYVRGINNHMGSRLTTSTNA 138

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +     ++ L F D  +   ++    A +  L     D++LD +   D +  + K  
Sbjct: 139 MGWVMDVLKEKQLFFVDSRTHANSIAFEQAQQYGLASAKRDVFLDHERTLDAVHRQFKLA 198

Query: 345 EEIARTTGQAIGVAVAFDESI----EVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
             IA+  G AI +    + ++     VI Q L+Q H+  + V  L      S P++
Sbjct: 199 VTIAKEYGNAIAIGHPHNVTLRYLEHVIPQ-LEQHHIETIFVSALLKTGNQSRPNT 253


>gi|325275726|ref|ZP_08141608.1| hypothetical protein G1E_20175 [Pseudomonas sp. TJI-51]
 gi|324099130|gb|EGB97094.1| hypothetical protein G1E_20175 [Pseudomonas sp. TJI-51]
          Length = 259

 Score = 56.2 bits (134), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 89/200 (44%), Gaps = 7/200 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           ++I++  LG S     R + L P  +T+A   +      + ++A K G+  IL +PM   
Sbjct: 30  MSIIIDDLGQSPNRDSRTLAL-PGPVTMAIMPDTPHATDFARQAHKAGKTVILHMPMDPA 88

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
              Y              ++L  RL  +L +     G+ N+ G+ + + +E    +  E 
Sbjct: 89  TGPYAWHPGIA------GEELARRLDSALLKVPYAAGINNHMGSRMTAQREPMAWLMGEL 142

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +R L F D  +S   +    A    L ++  D++LDD    + I  +L+    +A   G
Sbjct: 143 QRRHLFFVDSRTSAATVAAAEAQAQGLAHVSRDVFLDDVRTTEAIAGQLQQGVALAHKQG 202

Query: 353 QAIGVAVAFDESIEVISQWL 372
            A+ +   + +++EV+++ L
Sbjct: 203 SAVLIGHPYPQTLEVLAREL 222


>gi|311030007|ref|ZP_07708097.1| divergent polysaccharide deacetylase [Bacillus sp. m3-13]
          Length = 257

 Score = 56.2 bits (134), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 101/209 (48%), Gaps = 8/209 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           S  ++AIV+   G +  GT+  ++L P  +T+A     ++ ++  + A + G E IL +P
Sbjct: 28  SSNKVAIVIDDFGNNMKGTEEILHL-PVPLTVAVMPFLSTTEQDAEMAHRLGHEVILHLP 86

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+      +      +    T +++  R+  ++       G+ N+ G+ + ++K    +I
Sbjct: 87  MEPLKGKSSWLGPGAITSNLTDKEIYKRVNDAIDSVPYAVGINNHMGSKITADKRIMRII 146

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
                +R L + D  ++ +++   LA +L +P++  +L+ D+    + I ++   L  I 
Sbjct: 147 LGICKERNLYYLDSKTTKKSVVAELATELGVPFLENELFFDEVYSTNHIVKQTNHL--IK 204

Query: 349 RTTGQ----AIG-VAVAFDESIEVISQWL 372
           +T       AIG V V  +++  V+ Q++
Sbjct: 205 KTEVDDSIIAIGHVGVVGEKTAGVLKQYI 233


>gi|332139955|ref|YP_004425693.1| hypothetical protein MADE_1002730 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549977|gb|AEA96695.1| hypothetical protein MADE_1002730 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 313

 Score = 56.2 bits (134), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/179 (18%), Positives = 82/179 (45%), Gaps = 2/179 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  +T +            + A+K+G+  +L +PMQA  ++        L        +
Sbjct: 47  LPKEVTFSILPQTPLASEIAQRAEKEGRAVMLHMPMQA--QNGKNMGPLGLSTDMYAGAI 104

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            + +R +++      G+ N+ G+     +E+ E + KE  ++GL F D  ++  +  + +
Sbjct: 105 THNVRRAMKSVPNAVGINNHMGSAFTGQREAMEALLKEVKRQGLFFVDSRTTVLSKGKEI 164

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           A +L +P     ++LD +++   + ++   ++ IA+  G+ + +      +I+ +   L
Sbjct: 165 AEQLGVPNASRQVFLDHRLEPAFLLQQFNEMKRIAKREGRVLVIGHPHPATIDFLQTHL 223


>gi|197286993|ref|YP_002152865.1| exported polysaccharide deacetylase [Proteus mirabilis HI4320]
 gi|194684480|emb|CAR46240.1| putative exported polysaccharide deacetylase [Proteus mirabilis
           HI4320]
          Length = 321

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 90/210 (42%), Gaps = 13/210 (6%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+   G  +    + + L P  +++A   N         +A  +G+E ++ +
Sbjct: 28  AFSAKLAIVIDDFGYRKKEDNQILQL-PTAVSIAILPNSPHGKEMATKAHAQGREILIHM 86

Query: 228 PMQAFDESYNEDDSYTLKVTQT-----VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
           PM    +   E D+    + Q      +Q  +NR+ Y++       G+ N+ G+ + S++
Sbjct: 87  PMAPISKQPLEKDTLKPSMDQAEINRIIQNAINRVPYAV-------GMNNHMGSAMTSDR 139

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           ++ + + K      L F D  +         A    +P +   ++LD+     + R++L 
Sbjct: 140 QAMDRVIKALNHSDLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLN 199

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWL 372
               +AR  G AI +      ++  + Q L
Sbjct: 200 RAINLARKNGFAIAIGHPHPSTVRALQQQL 229


>gi|311277460|ref|YP_003939691.1| hypothetical protein Entcl_0129 [Enterobacter cloacae SCF1]
 gi|308746655|gb|ADO46407.1| protein of unknown function DUF610 YibQ [Enterobacter cloacae SCF1]
          Length = 313

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 90/205 (43%), Gaps = 3/205 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +   +  +  LP NI++A   N         +A   G+E ++ +
Sbjct: 21  AWAGKLAIVIDDVGY-RPQQENQVLALPVNISVAVLPNAPHAREMATKAHNGGREVLIHM 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+   +  ++   +R ++ +     G+ N+ G+ + SN    + 
Sbjct: 80  PMAPLSKQPLEKD--TLRPDMSSDEIERIIRDAVSKVPYAVGMNNHMGSAMTSNLFGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  ++  L F D  +   +     A    +  +   ++LDD  +   IR +     ++
Sbjct: 138 VMQALSRYNLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDDTQNEADIRFQFNRAIQL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWL 372
           AR TG AI +      ++ V+ Q +
Sbjct: 198 ARRTGSAIAIGHPHPSTVRVLQQMV 222


>gi|15614055|ref|NP_242358.1| hypothetical protein BH1492 [Bacillus halodurans C-125]
 gi|10174109|dbj|BAB05211.1| BH1492 [Bacillus halodurans C-125]
          Length = 273

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 86/183 (46%), Gaps = 6/183 (3%)

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A+  G E I+ +P++      +      +    +V ++ +R+R +        G+ N+ G
Sbjct: 76  AQAAGLEVIVHMPLEPKKGKISWLGPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMG 135

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD-QVDR 334
           + ++ N++    I +   ++     D G+SP +L   LA +L +PY    ++LD+    R
Sbjct: 136 SKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSR 195

Query: 335 DKIREKLKGLEEIARTTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            ++ + ++ L + A+   + IG   V V  DE+   I   L +     + +VP+S L  L
Sbjct: 196 KEVIKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQL--L 253

Query: 392 SSP 394
            SP
Sbjct: 254 PSP 256


>gi|113968388|ref|YP_732181.1| hypothetical protein Shewmr4_0042 [Shewanella sp. MR-4]
 gi|113883072|gb|ABI37124.1| protein of unknown function DUF610, YibQ [Shewanella sp. MR-4]
          Length = 251

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 102/226 (45%), Gaps = 5/226 (2%)

Query: 164 FC-SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            C ++++ A+IA+++  +G   T    A+  LP+ +TL+   +    ++  K A  KG E
Sbjct: 12  LCIASSNAAQIALIIDDIGYRHT--DEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHE 69

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +L +PMQA +         T  +++   Q+ + +  ++       G  N+ G++L    
Sbjct: 70  IMLHLPMQALNGKALGVGGLTNNMSEA--QIRSSVLAAIASVPFAKGANNHMGSLLTQLD 127

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           +    + +   ++ L F D  ++        A  L++P +   L+LD+ V    + ++  
Sbjct: 128 DPMLWVMETLKQKQLYFVDSMTTKFTKAGDKADSLSVPLLRRQLFLDNDVSAAALEKQFN 187

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +   A + G  + +A  + E+I  +   L +     + +VP S L
Sbjct: 188 LMISQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSL 233


>gi|119390469|pdb|2NLY|A Chain A, Crystal Structure Of Protein Bh1492 From Bacillus
           Halodurans, Pfam Duf610
          Length = 245

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 86/183 (46%), Gaps = 6/183 (3%)

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A+  G E I+ +P++      +      +    +V ++ +R+R +        G+ N+ G
Sbjct: 48  AQAAGLEVIVHMPLEPKKGKISWLGPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMG 107

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD-QVDR 334
           + ++ N++    I +   ++     D G+SP +L   LA +L +PY    ++LD+    R
Sbjct: 108 SKIVENEKIMRAILEVVKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSR 167

Query: 335 DKIREKLKGLEEIARTTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            ++ + ++ L + A+   + IG   V V  DE+   I   L +     + +VP+S L  L
Sbjct: 168 KEVIKNMRKLAKKAKQGSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQL--L 225

Query: 392 SSP 394
            SP
Sbjct: 226 PSP 228


>gi|229587895|ref|YP_002870014.1| hypothetical protein PFLU0334 [Pseudomonas fluorescens SBW25]
 gi|229359761|emb|CAY46611.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 262

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/184 (20%), Positives = 80/184 (43%), Gaps = 6/184 (3%)

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
           R +  LP  +T A   +      + +EA K G+  IL +PM            +      
Sbjct: 45  RRVLALPGPVTTAIMPDTPHAAEFAREAHKAGKIVILHMPMDP------ATGPFAWHPEL 98

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
            +++L  RL  + +      G+ N+ G+ + +   +   +  E  +R   F D  +S + 
Sbjct: 99  PIEELGKRLDAAFQAVPYTAGINNHMGSRMTAQPAAMAWLMAELQRRNKFFVDSRTSAQT 158

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
           +    A K+ L ++  D++LDD+     I  +L+   ++A   G A+ +   + +++ V+
Sbjct: 159 VAAAEAQKIGLAHVSRDVFLDDERTEAAITTQLQTAIKLAHKQGSAVMIGHPYPQTLAVL 218

Query: 369 SQWL 372
            + L
Sbjct: 219 EREL 222


>gi|62182199|ref|YP_218616.1| hypothetical protein SC3629 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197248431|ref|YP_002148639.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|224585506|ref|YP_002639305.1| hypothetical protein SPC_3788 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|62129832|gb|AAX67535.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197212134|gb|ACH49531.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|224470034|gb|ACN47864.1| hypothetical protein SPC_3788 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322716687|gb|EFZ08258.1| Uncharacterized protein yibQ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 320

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVLKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|154175021|ref|YP_001408001.1| polysaccharide deacetylase family protein [Campylobacter curvus
           525.92]
 gi|112803301|gb|EAU00645.1| divergent polysaccharide deacetylase family [Campylobacter curvus
           525.92]
          Length = 464

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 76/160 (47%), Gaps = 3/160 (1%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQA  + ++  +  TL    + + +L R+R           + N+ G+   S+ +
Sbjct: 302 MIHLPMQA--KHFDHPEIGTLNTNDSFESILKRIRKIRADFPRAVYMNNHTGSKFTSDYD 359

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + +  ++ F     +F D  +    +   +A K + PY+  D++LDD   R  +R +L  
Sbjct: 360 AMDKAYRAFISEKFIFMDSKTIGHTVVAEVARKYSQPYISRDIFLDDDPSRSGVRRQLVN 419

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
             E+A+    AI +      +I++I +  +   +RDV VV
Sbjct: 420 AVELAKKRSYAIAIGHPKKNTIDIIKES-KDTILRDVDVV 458


>gi|85710828|ref|ZP_01041889.1| hypothetical protein OS145_02335 [Idiomarina baltica OS145]
 gi|85695232|gb|EAQ33169.1| hypothetical protein OS145_02335 [Idiomarina baltica OS145]
          Length = 235

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 86/198 (43%), Gaps = 8/198 (4%)

Query: 194 LPANITLA---FASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           LP +IT A   F   G S   +  +A  +G++ +  +PMQA   + N      L    + 
Sbjct: 26  LPGDITFAILPFTPYGRS---FALKAHHQGKQIMAHVPMQAL--AGNALGLGALTADMSS 80

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++  +LR  L       G+ N+ G+ L    +  + + +      L F D  ++   + 
Sbjct: 81  AEIKLKLRQVLDDIPYVAGINNHMGSQLTQLTQPMQAVMESLKNHDLYFIDSRTTEYTVA 140

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
             +A    +P     +++D++ D   + E+   L +IA   G AI +   + E+I+ + Q
Sbjct: 141 EKMAQSYQVPVARRHVFIDNETDEQYLTEQFDELIQIAHAHGSAIAIGHPYPETIKFLKQ 200

Query: 371 WLQQEHVRDVSVVPLSCL 388
            L+     DV +V  S L
Sbjct: 201 RLKSLKEDDVQLVFASEL 218


>gi|16762604|ref|NP_458221.1| hypothetical protein STY4089 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144093|ref|NP_807435.1| hypothetical protein t3813 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213163814|ref|ZP_03349524.1| hypothetical protein Salmoneentericaenterica_28901 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213420031|ref|ZP_03353097.1| hypothetical protein Salmonentericaenterica_20595 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213427149|ref|ZP_03359899.1| hypothetical protein SentesTyphi_16972 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647904|ref|ZP_03377957.1| hypothetical protein SentesTy_11844 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824144|ref|ZP_06543741.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25367617|pir||AD0974 probable exported protein STY4089 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504909|emb|CAD03288.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139730|gb|AAO71295.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 TIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|168235310|ref|ZP_02660368.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194735049|ref|YP_002116641.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710551|gb|ACF89772.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197291430|gb|EDY30782.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|204928803|ref|ZP_03220002.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204322236|gb|EDZ07434.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|322612872|gb|EFY09824.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618937|gb|EFY15824.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625286|gb|EFY22113.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630047|gb|EFY26820.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634238|gb|EFY30973.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635861|gb|EFY32570.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643053|gb|EFY39629.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322643820|gb|EFY40369.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649830|gb|EFY46253.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653036|gb|EFY49371.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661145|gb|EFY57373.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662366|gb|EFY58579.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667244|gb|EFY63410.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674379|gb|EFY70472.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678413|gb|EFY74474.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680919|gb|EFY76953.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687145|gb|EFY83118.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192105|gb|EFZ77338.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198212|gb|EFZ83319.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323200832|gb|EFZ85902.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206586|gb|EFZ91544.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210501|gb|EFZ95387.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216211|gb|EGA00939.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220434|gb|EGA04888.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225297|gb|EGA09531.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228411|gb|EGA12542.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234232|gb|EGA18320.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237217|gb|EGA21284.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244736|gb|EGA28740.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249217|gb|EGA33135.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250928|gb|EGA34804.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257323|gb|EGA41022.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262248|gb|EGA45809.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264541|gb|EGA48045.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268831|gb|EGA52289.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|168232551|ref|ZP_02657609.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194470628|ref|ZP_03076612.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194456992|gb|EDX45831.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333317|gb|EDZ20081.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|168464987|ref|ZP_02698879.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|195632452|gb|EDX50936.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|168260540|ref|ZP_02682513.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205350154|gb|EDZ36785.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|16766991|ref|NP_462606.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167994326|ref|ZP_02575418.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168241884|ref|ZP_02666816.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194447310|ref|YP_002047737.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197265013|ref|ZP_03165087.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|200387258|ref|ZP_03213870.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|16422273|gb|AAL22565.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194405614|gb|ACF65833.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197243268|gb|EDY25888.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|199604356|gb|EDZ02901.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205327801|gb|EDZ14565.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338812|gb|EDZ25576.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261248854|emb|CBG26707.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995965|gb|ACY90850.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160243|emb|CBW19765.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914732|dbj|BAJ38706.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226758|gb|EFX51808.1| putative divergent polysaccharide deacetylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|323132066|gb|ADX19496.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990555|gb|AEF09538.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|161616784|ref|YP_001590749.1| hypothetical protein SPAB_04603 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168818465|ref|ZP_02830465.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194445745|ref|YP_002042956.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|198245856|ref|YP_002217668.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205354691|ref|YP_002228492.1| hypothetical protein SG3725 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858943|ref|YP_002245594.1| hypothetical protein SEN3528 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238910259|ref|ZP_04654096.1| hypothetical protein SentesTe_03869 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|161366148|gb|ABX69916.1| hypothetical protein SPAB_04603 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404408|gb|ACF64630.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197940372|gb|ACH77705.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205274472|emb|CAR39505.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205344542|gb|EDZ31306.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|206710746|emb|CAR35107.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|320088125|emb|CBY97887.1| Uncharacterized protein yibQ Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|326625452|gb|EGE31797.1| Uncharacterized protein yibQ [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629830|gb|EGE36173.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 320

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|56415596|ref|YP_152671.1| hypothetical protein SPA3558 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364523|ref|YP_002144160.1| hypothetical protein SSPA3321 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56129853|gb|AAV79359.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197096000|emb|CAR61587.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 320

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 84/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|332982318|ref|YP_004463759.1| hypothetical protein Mahau_1756 [Mahella australiensis 50-1 BON]
 gi|332699996|gb|AEE96937.1| protein of unknown function DUF610 YibQ [Mahella australiensis 50-1
           BON]
          Length = 267

 Score = 55.5 bits (132), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 91/204 (44%), Gaps = 3/204 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           IAI++   G +  GT+  + L +P  +T A   N    +     A   G E I+  PMQ 
Sbjct: 41  IAIIIDDFGNNGDGTKEMLELSIP--LTAAVMPNLPYTEHDANMAHDAGLEVIMHTPMQP 98

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            +   +      +       ++  R+   L +     G+ N+ G+    +K   + + + 
Sbjct: 99  INGKPSWLGPKGITTDLPDDEIKARINEGLEQIKWAIGMNNHMGSKATQDKRVMKSVLEI 158

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             +R + F D   +  ++   +A  LN+P +  D++LD+  ++  I+++L+ L  IA   
Sbjct: 159 AKQRNMFFVDSKVTANSVIDEVASSLNVPCVSRDIFLDNSKNQHDIQKQLEKLGNIAVEK 218

Query: 352 GQAIGVAVAFDESIEVISQWLQQE 375
           G AIG+     E   V ++ ++ E
Sbjct: 219 GYAIGIGHVGPEGGVVTAKAIRTE 242


>gi|290477275|ref|YP_003470196.1| hypothetical protein XBJ1_4335 [Xenorhabdus bovienii SS-2004]
 gi|289176629|emb|CBJ83438.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 335

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 95/211 (45%), Gaps = 6/211 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F  NA  AR+AIV+   G  +   +  I  +P  +++A   +        ++A K+G+E 
Sbjct: 28  FTLNAHAARLAIVIDDFGY-RVHHENKILQMPTAVSIAILPDSPHGREMAQKAHKQGREI 86

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E +  TL  + + +++   +  ++++     G+ N+ G+ + S+  
Sbjct: 87  LIHLPMAPLSKQPLEKN--TLHPSMSREEIGRIIHDAIQKVPHAMGMNNHMGSAMTSSLN 144

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVA--DLYLDDQVDRDKIREKL 341
             E + +  +    L+F D S     T+V    +  P  V    ++LD+     + R +L
Sbjct: 145 GMENVMQVLSSYHHLYFLD-SVTIGKTQVTKAAMGTPVQVLRRHVFLDNVQTEAETRHQL 203

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
                +AR  G AI +   +  ++  + Q L
Sbjct: 204 NRAIALARKQGSAIAIGHPYPTTVRALQQAL 234


>gi|313501034|gb|ADR62400.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 255

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 90/208 (43%), Gaps = 7/208 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A+ A ++I++  LG S     R + L P  +T+A   +      + ++A K G+  I
Sbjct: 18  AAPANKAYMSIIIDDLGQSAERDNRTLAL-PGPVTMAIMPDTPHATDFARQAHKAGKTVI 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM      Y       L       +L  RL  +L +     G+ N+ G+ + + ++ 
Sbjct: 77  LHMPMDPATGPYAWHPEVPLT------ELARRLDTALAKVPYAAGINNHMGSRMTAQRQP 130

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S   +    A    L ++  D++LDD    + I  +L   
Sbjct: 131 MAWLMGELQQRHLFFVDSRTSAATVAAAEAQAQGLAHVSRDVFLDDVRTTEAITRQLHQG 190

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWL 372
             +A   G  + +   + +++EV+ + L
Sbjct: 191 IALASKQGSVVLIGHPYPQTLEVLEREL 218


>gi|303252828|ref|ZP_07338987.1| hypothetical protein APP2_1780 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302648258|gb|EFL78455.1| hypothetical protein APP2_1780 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
          Length = 264

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 99/206 (48%), Gaps = 5/206 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +T    AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 8   AQAGKLAIVIDDIGY-RTKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 66

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY-FGVMNYRGAMLLSNKESAE 286
           PMQ  +  +   +S  L V  + ++ + RL  + R    Y  G+ N+ G+   +++++ E
Sbjct: 67  PMQPKNR-HQPIESGALMVGAS-KENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 124

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P    +V A +L +  +  +L+LDD     +++ +      
Sbjct: 125 HLMTELSKQQLFFLDSKTGPSVAAKV-ARELGVNALERNLFLDDNDALHEVQNQFHLALH 183

Query: 347 IARTTGQAIGVAVAFDESIEVISQWL 372
            AR  G AI +      SIEV+ + L
Sbjct: 184 YARKHGSAILIGHPRKNSIEVLEKGL 209


>gi|152974861|ref|YP_001374378.1| protein of unknown function DUF610 YibQ [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023613|gb|ABS21383.1| protein of unknown function DUF610 YibQ [Bacillus cytotoxicus NVH
           391-98]
          Length = 256

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/192 (19%), Positives = 86/192 (44%), Gaps = 1/192 (0%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           +A   ++AIV+   G +  GT+  ++L P  +T+A      S  +    A KKG E I+ 
Sbjct: 24  HAHTNKVAIVIDDFGNNMKGTKEMLSL-PIPLTVAVMPFLPSTKQDAIAAHKKGHEVIIH 82

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+  +          +    +  ++ +R+  ++       G+ N+ G+ + +++    
Sbjct: 83  MPMEPINGKKEWLGPKAITTDLSDDEIKHRIEQAIEAVPYAIGMNNHMGSKVTADERIMR 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I     K GL + D  ++  ++   +  +L++P +   ++ DD      I ++ + L +
Sbjct: 143 IILTVCKKHGLFYLDSKTNSNSVVSRIGKELDVPIIENQMFFDDIYTSSHILKQAQFLLQ 202

Query: 347 IARTTGQAIGVA 358
             R T   + + 
Sbjct: 203 KTRKTPVVVAIG 214


>gi|238783976|ref|ZP_04627992.1| hypothetical protein yberc0001_4960 [Yersinia bercovieri ATCC
           43970]
 gi|238715084|gb|EEQ07080.1| hypothetical protein yberc0001_4960 [Yersinia bercovieri ATCC
           43970]
          Length = 342

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 89/207 (42%), Gaps = 3/207 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAREMAVKAHNQGREILIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYAKGMNNHMGSAMTSSLPGMQR 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+
Sbjct: 138 VMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVEL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQ 374
           AR  G AI +      +I+V+ Q L Q
Sbjct: 198 ARRNGSAIAIGHPHPATIKVLQQMLPQ 224


>gi|238798823|ref|ZP_04642292.1| hypothetical protein ymoll0001_38940 [Yersinia mollaretii ATCC
           43969]
 gi|238717331|gb|EEQ09178.1| hypothetical protein ymoll0001_38940 [Yersinia mollaretii ATCC
           43969]
          Length = 352

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 90/211 (42%), Gaps = 3/211 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G       + + + P  I++A   N         +A  +G+E 
Sbjct: 17  IANAAQAGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAREMAVKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVSNVPYAKGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
             E+AR  G AI +      +I+V+ Q L Q
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQ 224


>gi|253690446|ref|YP_003019636.1| hypothetical protein PC1_4085 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251757024|gb|ACT15100.1| protein of unknown function DUF610 YibQ [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 315

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 90/201 (44%), Gaps = 3/201 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLERD--TLRPDMSSDEIQRIIRQSVNNVPHAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWL 372
           G AI +      +I V+ Q L
Sbjct: 202 GSAIAIGHPHPSTIRVLQQML 222


>gi|319652983|ref|ZP_08007088.1| hypothetical protein HMPREF1013_03703 [Bacillus sp. 2_A_57_CT2]
 gi|317395332|gb|EFV76065.1| hypothetical protein HMPREF1013_03703 [Bacillus sp. 2_A_57_CT2]
          Length = 257

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 102/225 (45%), Gaps = 15/225 (6%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
            +AIV+  LG +  GT   + L P  +T+A      +     + A + G E I+ +PM+ 
Sbjct: 29  ELAIVIDDLGNNMKGTAEMMEL-PVTLTVAIMPFMPTTKEDAELASENGHEVIVHMPMEP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +    T +++ +R+  +++      G+ ++ G+    N+    ++ K 
Sbjct: 88  KRGKRSWLGPGAITTDLTDEEIRSRVESAIKEVPHAVGMNHHMGSRATENERVMRIVLKV 147

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD-------QVDRDKIREKLKGL 344
             + GL + D  ++ +++   LA ++ +PY+  +++ DD           D++ EKL   
Sbjct: 148 CKEHGLFYLDSKTTGKSVVGKLAKEIGVPYVENNIFFDDIYTTAHITKQADRLAEKLVKN 207

Query: 345 EEIARTTGQAIG-VAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           E I      AIG V +   + + V+ +++   +     +VPLS L
Sbjct: 208 ERII-----AIGHVGITGTKMVNVLKEYIPV-YKEKAEIVPLSEL 246


>gi|261823559|ref|YP_003261665.1| hypothetical protein Pecwa_4366 [Pectobacterium wasabiae WPP163]
 gi|261607572|gb|ACX90058.1| protein of unknown function DUF610 YibQ [Pectobacterium wasabiae
           WPP163]
          Length = 313

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 91/205 (44%), Gaps = 3/205 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +
Sbjct: 21  ALAGKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + 
Sbjct: 80  PMAPMSKQPLERD--TLRPDMSSDEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +I
Sbjct: 138 VMQALSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFARAVQI 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWL 372
           AR +G AI +      +I V+ Q L
Sbjct: 198 ARRSGSAIAIGHPHPSTIRVLQQML 222


>gi|156936214|ref|YP_001440130.1| hypothetical protein ESA_04113 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534468|gb|ABU79294.1| hypothetical protein ESA_04113 [Cronobacter sakazakii ATCC BAA-894]
          Length = 313

 Score = 54.7 bits (130), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 82/198 (41%), Gaps = 3/198 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IV+   G  + GT+  +  +PA +++A   N         +A  +G + ++ +PM    +
Sbjct: 28  IVIDDFGY-RPGTENQVLAMPAEVSVAVLPNAPHAREMATKAHNQGHDVLIHLPMAPLSK 86

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              E D  TL+   +  ++   +R ++       G+ N+ G+ + S+    + +    A 
Sbjct: 87  QPLEKD--TLRPDMSADEIARIIREAVNSVPYAIGMNNHMGSAMTSSLPGMQKVMASLAH 144

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
             L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G A
Sbjct: 145 YNLFFLDSMTIGNSQAMRAAAGTGVKVIKRKVFLDDTQNDADIRYQFNRAVALARRNGSA 204

Query: 355 IGVAVAFDESIEVISQWL 372
           I +      ++ V+ Q L
Sbjct: 205 IAIGHPHPSTVRVLQQML 222


>gi|46143439|ref|ZP_00204471.1| COG2861: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208306|ref|YP_001053531.1| hypothetical protein APL_0830 [Actinobacillus pleuropneumoniae L20]
 gi|307247817|ref|ZP_07529853.1| hypothetical protein appser2_8060 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250063|ref|ZP_07532027.1| hypothetical protein appser4_8510 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307256881|ref|ZP_07538659.1| hypothetical protein appser10_8850 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307261313|ref|ZP_07542988.1| hypothetical protein appser12_8790 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|126097098|gb|ABN73926.1| hypothetical protein APL_0830 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306855619|gb|EFM87786.1| hypothetical protein appser2_8060 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857923|gb|EFM90015.1| hypothetical protein appser4_8510 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306864615|gb|EFM96520.1| hypothetical protein appser10_8850 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306869044|gb|EFN00846.1| hypothetical protein appser12_8790 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 282

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 98/206 (47%), Gaps = 5/206 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +T    AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 26  AQAGKLAIVIDDIGY-RTKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 84

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY-FGVMNYRGAMLLSNKESAE 286
           PMQ     +   +S  L V  + ++ + RL  + R    Y  G+ N+ G+   +++++ E
Sbjct: 85  PMQP-KNRHQPIESGALMVGAS-KENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P    +V A +L +  +  +L+LDD     +++ +      
Sbjct: 143 HLMTELSKQQLFFLDSKTGPSVAAKV-ARELGVNALERNLFLDDNDALHEVQNQFHLALH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWL 372
            AR  G AI +      SIEV+ + L
Sbjct: 202 YARKHGSAILIGHPRKNSIEVLEKGL 227


>gi|167549047|ref|ZP_02342806.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325644|gb|EDZ13483.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 320

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 83/207 (40%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  I  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQILALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G  I +      ++ V+ Q
Sbjct: 194 AIELARRNGSTIAIGHPHPATVRVLQQ 220


>gi|161505759|ref|YP_001572871.1| hypothetical protein SARI_03935 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867106|gb|ABX23729.1| hypothetical protein SARI_03935 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 320

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 85/207 (41%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP +I++A   N         +A   G E 
Sbjct: 17  FAQPVFAGKLAIVIDDFGY-RPHTENQVLALPPDISVAVLPNAPQAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R +++      G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPEMSSDEIDRIIREAVKNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+AR  G AI +      ++ V+ Q
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQ 220


>gi|117918507|ref|YP_867699.1| hypothetical protein Shewana3_0048 [Shewanella sp. ANA-3]
 gi|117610839|gb|ABK46293.1| protein of unknown function DUF610, YibQ [Shewanella sp. ANA-3]
          Length = 251

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/221 (20%), Positives = 97/221 (43%), Gaps = 4/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           ++ A+IA+++  +G   T    A+  LP+ +TL+   +    ++  K A  KG E +L +
Sbjct: 17  SNAAQIALIIDDIGYRHT--DEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHEIMLHL 74

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQA +         T  +++   Q+ + +  ++       G  N+ G++L    +    
Sbjct: 75  PMQALNGKALGVGGLTNNMSEA--QIRSSVLAAIASVPFAKGANNHMGSLLTQLDDPMLW 132

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +     ++ L F D  ++        A  L +P +   L+LD+ V    + ++   +   
Sbjct: 133 VMDTLKQKQLYFVDSMTTKFTKAGDKADSLGVPLLRRKLFLDNDVSAAALEKQFNLMISQ 192

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A + G  + +A  + E+I  +   L +     + +VP S L
Sbjct: 193 AHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSL 233


>gi|332289073|ref|YP_004419925.1| Divergent polysaccharide deacetylase [Gallibacterium anatis UMN179]
 gi|330431969|gb|AEC17028.1| Divergent polysaccharide deacetylase [Gallibacterium anatis UMN179]
          Length = 273

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 105/220 (47%), Gaps = 4/220 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           + A++AIV+  +G  +     AI  LP  + +A   +     +  K+A ++G++A++ +P
Sbjct: 20  NAAQLAIVIDDIGY-RAHEDNAIFALPLAVNVAIIPSAPYAQQRAKQAHQQGRDALIHMP 78

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           MQ       E +   L +T    Q+ +R+  +        G+ N+ G+   S+     ++
Sbjct: 79  MQPKSNIKLEANGLVLGLTPA--QVSHRIDLAQNIVPNAIGMNNHMGSAATSDSGLMHIL 136

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            ++ A+RGL F D  +   ++   +A +  +  +  +++LDD  +   I+++ +   + A
Sbjct: 137 MQQLAQRGLSFLDSKTIGSSVAGKIAKQYGVSALERNIFLDDNNEYANIQQQFQQAIQYA 196

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R    AI +      +I V+ Q L Q    D+ +V +S L
Sbjct: 197 RKHQTAIVIGHPRKNTIAVLQQQLSQLPA-DIELVKISRL 235


>gi|283850893|ref|ZP_06368179.1| protein of unknown function DUF610 YibQ [Desulfovibrio sp. FW1012B]
 gi|283573816|gb|EFC21790.1| protein of unknown function DUF610 YibQ [Desulfovibrio sp. FW1012B]
          Length = 378

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 90/220 (40%), Gaps = 2/220 (0%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           G R+ +V+  +G       R +  LP  +TLA   N         +A + G E IL  PM
Sbjct: 158 GPRMVVVIDDIG-DHPVMARNLMELPIPVTLAILPNRPRTRSIAAQAAEHGLEIILHQPM 216

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           Q             L      +++   L  +L +     G+ N+ G+   S+      + 
Sbjct: 217 QPGSYPRVNPGPGALFPDMDEKRIQATLTDNLSQLPHVVGINNHMGSAFTSDGPGMAAVM 276

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
                +GL F D  +S  +     A +  +P+    ++LD+  +   I  +LK  E  A 
Sbjct: 277 PILKAKGLFFMDSVTSATSAAPEAARRAGVPFYRRAVFLDNVRNTRTILGQLKTAERHAL 336

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             G+AI +   + E+ E +  W ++   R +++V L+ L 
Sbjct: 337 KHGRAIAIGHPYGETYEALKIWAKERDPR-IALVTLTELG 375


>gi|238897058|ref|YP_002921804.1| hypothetical protein KP1_5309 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040666|ref|ZP_06013904.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|238549386|dbj|BAH65737.1| hypothetical protein KP1_5309 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042030|gb|EEW43063.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 315

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 86/207 (41%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G  +  T+  +  LPA I++A   N         +A  +G E 
Sbjct: 17  LAAPAFAGKLSIVIDDFGY-RPQTENQVLALPATISVAVLPNAPHAREMATKAHNQGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAVGLNNHMGSAMTSNLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +         A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRNQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
              +AR  G AI +      ++ V+ Q
Sbjct: 194 AIALARRNGSAIAIGHPHPTTVRVLQQ 220


>gi|238789568|ref|ZP_04633352.1| hypothetical protein yfred0001_24040 [Yersinia frederiksenii ATCC
           33641]
 gi|238722321|gb|EEQ13977.1| hypothetical protein yfred0001_24040 [Yersinia frederiksenii ATCC
           33641]
          Length = 337

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/221 (20%), Positives = 94/221 (42%), Gaps = 3/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAKEMAVKAHNQGREILIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +   +     A    +  +   ++LDD  +   IR++     ++
Sbjct: 138 VMQTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVDL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           AR  G AI +      +I+V+ Q L Q     V V P + L
Sbjct: 198 ARRNGSAIAIGHPHPATIKVLQQMLPQLPADIVLVRPSALL 238


>gi|50119129|ref|YP_048296.1| hypothetical protein ECA0169 [Pectobacterium atrosepticum SCRI1043]
 gi|49609655|emb|CAG73088.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 315

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 91/205 (44%), Gaps = 3/205 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +
Sbjct: 21  ALAGKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D+    ++    QL+  +R S+       G+ N+ G+ + ++    + 
Sbjct: 80  PMAPMSKQPLERDTLRPDMSSDEIQLI--IRQSVSNVPYAVGLNNHMGSAMTASLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +I
Sbjct: 138 VMQALSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQI 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWL 372
           AR +G AI +      +I V+ Q L
Sbjct: 198 ARRSGSAIAIGHPHPSTIRVLQQML 222


>gi|332159700|ref|YP_004296277.1| hypothetical protein YE105_C0076 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325663930|gb|ADZ40574.1| hypothetical protein YE105_C0076 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861126|emb|CBX71390.1| uncharacterized protein yibQ [Yersinia enterocolitica W22703]
          Length = 334

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 88/205 (42%), Gaps = 3/205 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+AR
Sbjct: 140 QTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQ 374
             G AI +      +I+V+ Q L Q
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQ 224


>gi|150392120|ref|YP_001322169.1| protein of unknown function DUF610, YibQ [Alkaliphilus
           metalliredigens QYMF]
 gi|149951982|gb|ABR50510.1| protein of unknown function DUF610, YibQ [Alkaliphilus
           metalliredigens QYMF]
          Length = 286

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 101/227 (44%), Gaps = 19/227 (8%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ-- 230
           +AIV+   G + +GT   +N++   +T A            K A K G E I+ IPM+  
Sbjct: 62  VAIVIDDFGNNGSGTDEMMNIIQP-LTFAVIPFLPYSQEEAKRANKAGHEVIVHIPMEPK 120

Query: 231 AFDESYNEDDSYTLKVTQ-----TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
             +  +  D   T  +T       V + +  ++Y++       G  N+ G+ +  +K   
Sbjct: 121 KGNPKWLGDRGITSNLTSEEVHSIVLEAIEDVQYAV-------GANNHMGSKITEDKRIM 173

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           E + +      +   D  +S  ++ + +A + N+P +   ++LD++ + + I+ +++ L 
Sbjct: 174 EAVMQVLKANDMYMIDSKTSQTSIVKEVADQYNVPVLERAIFLDNEKNVEAIKRQIEKLA 233

Query: 346 EIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCL 388
            +A  +G A+ +     E    + E I Q L     + + ++P S L
Sbjct: 234 VVALESGSAVAIGHVGPEGGRITAEAIKQMLPYLQEKGIEIMPASKL 280


>gi|238764340|ref|ZP_04625291.1| hypothetical protein ykris0001_18390 [Yersinia kristensenii ATCC
           33638]
 gi|238697491|gb|EEP90257.1| hypothetical protein ykris0001_18390 [Yersinia kristensenii ATCC
           33638]
          Length = 336

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/219 (20%), Positives = 93/219 (42%), Gaps = 3/219 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLERD--TLQPSMSSEEVQRIIRQAVSNVPYATGMNNHMGSAMTSSFPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+AR
Sbjct: 140 QALEHYQLYFLDSMTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             G AI +      +I+V+ Q L Q     V V P + L
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQLPADIVLVRPSALL 238


>gi|300721222|ref|YP_003710492.1| hypothetical protein XNC1_0147 [Xenorhabdus nematophila ATCC 19061]
 gi|297627709|emb|CBJ88235.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 349

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 94/210 (44%), Gaps = 3/210 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +F  NA  AR+AIV+  +G  +   +  I  +P  +++A   +         +A ++G+E
Sbjct: 29  SFTLNARAARLAIVIDDVGY-RIHEENKILQMPIAVSVAILPDSPHGREMAVKAYQQGRE 87

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E +  TL    + +++   ++ ++++     G+ N+ G+ + S+ 
Sbjct: 88  VLIHLPMAPLSQQPLEKN--TLHPAMSREEIGRIIQEAIQKVPHAVGMNNHMGSAMTSDL 145

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              E + +  ++  L F D  +         A   ++P +  +++LD+     + R +  
Sbjct: 146 TGMEKVMQVLSRHHLYFLDSVTIGNTQVTKAATGTSVPVIRRNIFLDNVQTEAETRHQFN 205

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWL 372
               +AR  G AI +      ++  + Q L
Sbjct: 206 RAITLARKKGSAIAIGHPHPTTVRALQQAL 235


>gi|113461585|ref|YP_719654.1| hypothetical protein HS_1442 [Haemophilus somnus 129PT]
 gi|112823628|gb|ABI25717.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 270

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/219 (19%), Positives = 102/219 (46%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G  +      I  LP  +++A   +     +  ++AK++ ++ ++ +PMQ 
Sbjct: 17  KLAIVIDDIG-YRLKEDNQIYSLPKEVSVAIIPSAPHAKQRDQQAKQQDRDILIHLPMQP 75

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            +    ED    L ++Q   ++ +R+R +        G+ N+ G+   ++K+    +   
Sbjct: 76  LNLQKIEDGGIKLGMSQP--EVYHRVRNAKSILPNAIGMNNHMGSAATADKDLMNKLMTA 133

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  R++   +A +  +P +   ++LDD      ++ +     + AR  
Sbjct: 134 LLQQDLFFLDSRTIGRSVAGKIAREFGIPTLERHIFLDDSDKLSDVQRQWNAAIQYARKR 193

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   ++Q   +D+ +V +  L +
Sbjct: 194 GTAIVIGHPRKNTIAVLQMGIKQL-PKDIQLVGIGSLWR 231


>gi|228984507|ref|ZP_04144684.1| hypothetical protein bthur0001_12120 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228775210|gb|EEM23599.1| hypothetical protein bthur0001_12120 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 215

 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 67/145 (46%), Gaps = 1/145 (0%)

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
           GT + ++L P  +T+A      S       A KKG E I+ +PM+             + 
Sbjct: 3   GTDKMLSL-PIPLTVAVMPFLPSTKEDAIAAHKKGHEVIIHMPMEPIKGKKEWLGPKAIT 61

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
              + +++ NRL  +++      G+ N+ G+ + +++    +I     K GL + D  ++
Sbjct: 62  TDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIVRLILAACKKHGLFYLDSKTN 121

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDD 330
           P+++   +  +L +P +   L+ DD
Sbjct: 122 PKSVVPKIGKELGVPIIENQLFFDD 146


>gi|239995835|ref|ZP_04716359.1| hypothetical protein AmacA2_15321 [Alteromonas macleodii ATCC
           27126]
          Length = 302

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/179 (19%), Positives = 78/179 (43%), Gaps = 2/179 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  IT +              A+++G+  +L +PMQA  +S  +     L        +
Sbjct: 47  LPKEITFSILPQTPLASEIALRAEQEGRAVMLHMPMQA--QSGKDMGPLGLTTDMFAGAI 104

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              LR +++      GV N+ G+     ++  E + KE  ++GL F D  ++       +
Sbjct: 105 TYNLRKAMKSVPNAVGVNNHMGSAFTGQQKGMEALLKEVKRQGLFFVDSRTTVLTKGEEI 164

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           A +L +P     ++LD +++   + ++   ++ IA+  G  + +     E+++ +   +
Sbjct: 165 AQRLGVPSASRQVFLDHKLEPAFLLKQFNHMKRIAKKNGHVVVIGHPHPETVDFLKTHI 223


>gi|37528651|ref|NP_931996.1| hypothetical protein plu4842 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36788090|emb|CAE17214.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 271

 Score = 53.9 bits (128), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            AR+AIV+   G       + + + P  I++A   +        ++A K+G+E ++ +PM
Sbjct: 29  AARLAIVIDDFGYRPHNENKILQM-PVAISIAILPDSPHGREMAEKAYKQGREILIHLPM 87

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+ T + + +   ++ ++++     G+ N+ G+ + S+    + + 
Sbjct: 88  APLSKQLLEPD--TLQPTMSSEDIDRIIQRAIQKVPYAVGINNHMGSAMTSSLPGMQKVM 145

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  +   L F D  +         A    +  +  +++LDD     + R +L     IAR
Sbjct: 146 RSLSGYNLYFLDSVTIGNTQATKAAQGTPVRVIRRNVFLDDVQSEAETRHQLNRAISIAR 205

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G AI +      +I  + Q L
Sbjct: 206 KNGSAIAIGHPHSTTIRALQQML 228


>gi|238750811|ref|ZP_04612309.1| hypothetical protein yrohd0001_10680 [Yersinia rohdei ATCC 43380]
 gi|238710955|gb|EEQ03175.1| hypothetical protein yrohd0001_10680 [Yersinia rohdei ATCC 43380]
          Length = 341

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/207 (20%), Positives = 89/207 (42%), Gaps = 3/207 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDFGYRPQNENKILQM-PLPISVAILPNAPYAREMAVKAHNQGREILIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+
Sbjct: 138 VMQVLEHYQLYFLDSVTIGNSQASNAAQGTGVKVIKRKVFLDDSQNEAAIRQQFTRAVEL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQ 374
           AR  G AI +      +I+V+ Q L Q
Sbjct: 198 ARRNGSAIAIGHPHPSTIKVLQQMLPQ 224


>gi|167945841|ref|ZP_02532915.1| hypothetical protein Epers_04577 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 240

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 94/201 (46%), Gaps = 3/201 (1%)

Query: 188 QRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT 247
           +RA+ L    +T +F  +     +   +A +  +E +L +PM++ +     + +  L   
Sbjct: 13  ERALALR-GKVTYSFLPHTPYARQQADQAYRLEREVMLHLPMESLEALPLGEGA--LLTG 69

Query: 248 QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPR 307
            T Q+    L  ++       G+ N+ G+M+ ++  + +         GL F D  ++ +
Sbjct: 70  MTSQEQAEVLAAAVSSVPHLAGINNHMGSMMTADGVAMQQFMALIRDTGLFFLDSRTTDK 129

Query: 308 NLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
            L    A +  +     D++LD+    + IR + K L  +AR+ G AIG+A    E++EV
Sbjct: 130 TLAEQSAQENLVATGRRDVFLDNLRQPEAIRAQFKRLLALARSQGHAIGIAHPHPETLEV 189

Query: 368 ISQWLQQEHVRDVSVVPLSCL 388
           +   L +   + + +VP+S L
Sbjct: 190 LEALLPELEQQGIRLVPVSQL 210


>gi|157373053|ref|YP_001481042.1| hypothetical protein Spro_4821 [Serratia proteamaculans 568]
 gi|157324817|gb|ABV43914.1| protein of unknown function DUF610 YibQ [Serratia proteamaculans
           568]
          Length = 318

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 93/209 (44%), Gaps = 4/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            C+  +G +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E 
Sbjct: 18  VCAAQAG-KLSIVIDDVGY-RPHEEGAVLQMPTAISVAVLPNAPHAHLMATRAHSQGREV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHMPMAPLSKQPLERD--TLQPSMSSEEIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +      L F D  +   +     A   ++  +   ++LDD  +   IR +   
Sbjct: 134 AMQKVMQALDSYQLYFLDSMTIGNSQATRAAAGTHVKVIKRKVFLDDTANEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
             E+AR  G AI +      ++ V+ Q L
Sbjct: 194 AVELARRNGSAIAIGHPRPATVRVLQQML 222


>gi|307718431|ref|YP_003873963.1| hypothetical protein STHERM_c07330 [Spirochaeta thermophila DSM
           6192]
 gi|306532156|gb|ADN01690.1| hypothetical protein STHERM_c07330 [Spirochaeta thermophila DSM
           6192]
          Length = 271

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 67/145 (46%), Gaps = 2/145 (1%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           +  ++ G+   L +PM+   E   +     L V+ +  ++ + +   L    G  GV N+
Sbjct: 94  RRVREAGKTLFLHLPMEP--EGNEDPGPGALYVSMSRAEIEHVIAEDLASVPGVQGVNNH 151

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+    +    E I    A  GLLF D  ++P ++ R  A +L +P M  D++LD++  
Sbjct: 152 MGSRFTKDPLRMEWILSILAAGGLLFVDSRTTPESVVRETAFRLGVPVMERDVFLDNEQT 211

Query: 334 RDKIREKLKGLEEIARTTGQAIGVA 358
              + +      +IAR  G+A+ + 
Sbjct: 212 AVYVEQAFMHAVQIARRRGRAVAIG 236


>gi|307721625|ref|YP_003892765.1| hypothetical protein Saut_1709 [Sulfurimonas autotrophica DSM
           16294]
 gi|306979718|gb|ADN09753.1| protein of unknown function DUF610 YibQ [Sulfurimonas autotrophica
           DSM 16294]
          Length = 328

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 110/228 (48%), Gaps = 33/228 (14%)

Query: 169 SGARIAIVVSGLGISQTGTQ-RAINLLPANITLAF----ASNGNSLDRWMKEAKKKGQEA 223
           S  ++AI++  +   QT +Q RA+  L  N+T++F    A+  NS       AK    E 
Sbjct: 115 SKPKLAIIIDDM---QTTSQVRAVKSLHLNVTMSFLPPRAARPNS-------AKLASHEK 164

Query: 224 --ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLR--YSLRRGTGYFGVMNYRGAMLL 279
             ++ +PM+A    ++ ++ +TL++  + Q++  +++    L    GY    N+ G+   
Sbjct: 165 FYMVHLPMEAMH--FSAEEPHTLRIYDSQQKISAKIKDIKKLFPKVGYIN--NHTGSKFT 220

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL----NLPYMVADLYLDDQVDRD 335
           +N+ +   +        + F D     R   + +APK+     L Y+  D++LD  +D+ 
Sbjct: 221 ANEVAMNRLIFALNTNHIHFIDS----RTTAKTMAPKVLKNFGLKYVSRDVFLDHHMDKP 276

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
            I +++K    +A++ G AI +      +++ +  +  ++  +DV +V
Sbjct: 277 YILKQIKKAIAVAKSHGSAIAIGHPHKNTLQAL--YESKDLFKDVELV 322


>gi|85858725|ref|YP_460927.1| polysaccharide deacetylase [Syntrophus aciditrophicus SB]
 gi|85721816|gb|ABC76759.1| polysaccharide deacetylase [Syntrophus aciditrophicus SB]
          Length = 334

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 77/171 (45%), Gaps = 7/171 (4%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA---KKKGQEAIL 225
           SG RIAI++  +G   +  +   NLL     ++FA   + + R    A    K G++ +L
Sbjct: 113 SGLRIAILIDDIGADLSPVK---NLLKIEAPISFAVLPH-MPRGAAAADMIHKAGRDVLL 168

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+       +     L  T    +L   L  +L       GV N+ G++   ++E  
Sbjct: 169 HLPMEPRSYPKEKPGPGALLTTMDDSELRKVLTGNLDAVPHISGVNNHMGSLFTEDEEKL 228

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            ++  E  KRGL F D  ++P +    ++  + +P+    +++D+  D  K
Sbjct: 229 AIVMAELEKRGLFFIDSRTTPYSKAAKVSQDIGIPFASRRIFIDNGQDYTK 279


>gi|284008837|emb|CBA75621.1| exported polysaccharide deacetylase [Arsenophonus nasoniae]
          Length = 319

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/220 (20%), Positives = 105/220 (47%), Gaps = 4/220 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           + +++AIV+  +G  +    + I  LP  I++A   +        ++A ++G+E ++ +P
Sbjct: 21  NASKLAIVIDDIGYRKKEDNQ-ILALPVAISIAILPDSPYGREMAEKANQQGREILIHMP 79

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+   +   E ++ T +++ +  ++  ++  ++++     G+ N+ G+ + +N  + + +
Sbjct: 80  MKPISQQPLEKNTLTPQMSAS--EIEQKIIAAIKQVPHAKGMNNHMGSAMTANLVAMKNV 137

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
               +   L F D  +         A    LP +  +++LDD     +IR++       A
Sbjct: 138 MHVLSHYDLYFLDSVTIANTKVNEAAKFFALPTLRRNVFLDDVKTEAQIRKQFAHAISFA 197

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           R  G +I +   +  +I+V+ Q L  E   D+ +V +S L
Sbjct: 198 RKQGSSIVIGHPYPATIQVLHQTL-FELPSDIELVAVSKL 236


>gi|120600823|ref|YP_965397.1| hypothetical protein Sputw3181_4041 [Shewanella sp. W3-18-1]
 gi|120560916|gb|ABM26843.1| protein of unknown function DUF610, YibQ [Shewanella sp. W3-18-1]
          Length = 247

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 100/230 (43%), Gaps = 14/230 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + + +  A+IA+++  +G  QT    A+  LP  +TL+   +    +   K    KG E 
Sbjct: 13  YVAPSYAAKIALIIDDIGYRQT--DEAVLSLPHTVTLSVLPHTPLGENLAKVGHSKGHEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF----GVMNYRGAMLL 279
           +L +PMQA +         T  + +        +R ++           G  N+ G+ LL
Sbjct: 71  MLHLPMQAINGKALGPGGLTKGMDEA------EIRANVSSAIANIPFAKGANNHMGS-LL 123

Query: 280 SNKESAEVIFKEFAKRGLLFF-DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
           +  +S  +   E  K+  L+F D  ++P +     A +L +P +   L+LD+ V +  + 
Sbjct: 124 TQLDSHMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLGIPSLKRQLFLDNNVSKKALE 183

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           ++   +   A   G  + +A  + E+I  +   L       + +VP+S L
Sbjct: 184 KQFNLMISNAHMQGSLVVIAHPYPETIRFLQANLPLLEAEGIDLVPVSDL 233


>gi|47566220|ref|ZP_00237248.1| hypothetical protein exported protein [Bacillus cereus G9241]
 gi|47556773|gb|EAL15104.1| hypothetical protein exported protein [Bacillus cereus G9241]
          Length = 209

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 62/137 (45%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  +T+A      S       A KKG E I+ +PM+             +    + +++
Sbjct: 4   LPIPLTVAVMPFLPSTKEDAIAAHKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEI 63

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            NRL  +++      G+ N+ G+ + +++    +I     K GL + D  ++P+++   +
Sbjct: 64  NNRLEQAIQEVPHAIGMNNHMGSKVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKI 123

Query: 314 APKLNLPYMVADLYLDD 330
             +L +P +   L+ DD
Sbjct: 124 GKELGVPIIENQLFFDD 140


>gi|312958445|ref|ZP_07772965.1| protein of unknown function DUF610 [Pseudomonas fluorescens WH6]
 gi|311286988|gb|EFQ65549.1| protein of unknown function DUF610 [Pseudomonas fluorescens WH6]
          Length = 257

 Score = 53.1 bits (126), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/184 (21%), Positives = 78/184 (42%), Gaps = 6/184 (3%)

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
           R +  LP  +T A   +      + +EA K G+  IL +PM            +      
Sbjct: 45  RRVLALPGPVTTAIMPDTPHAAEFAREAHKAGKIVILHMPMD------PATGPFAWHPEL 98

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
           +V+ L  RL  +        G+ N+ G+ + +   +   +  E  +R   F D  +S + 
Sbjct: 99  SVEDLGKRLDAAFTAVPYTAGINNHMGSRMTAQPAAMAWLMAELQRRHKFFVDSRTSAQT 158

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
           +    A K+ L  +  D++LDD+     I  +L+   ++A   G A+ +   + +++ V+
Sbjct: 159 VAAAEAQKIGLASVSRDVFLDDERTEAAITTQLQTAIKLAHKQGSAVMIGHPYPQTLAVL 218

Query: 369 SQWL 372
            + L
Sbjct: 219 EREL 222


>gi|325474776|gb|EGC77962.1| hypothetical protein HMPREF9353_00809 [Treponema denticola F0402]
          Length = 390

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 78/143 (54%), Gaps = 3/143 (2%)

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           G+E IL  PMQA + + N  D   +K     +++   +  ++       G+ N+ G+++ 
Sbjct: 219 GKELILHQPMQALNPNINPGDG-AVKPGMDREEIKKIVASNVEEIGPIAGMNNHEGSLIT 277

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           S++++ E + +   ++ + F D  +S +++   +A KLN+      ++LD++ D+  +++
Sbjct: 278 SDEKAMEAVLELCKEKNIYFLDSRTSSKSVVPQVAKKLNMNIWERAVFLDNKKDKAYMKK 337

Query: 340 K-LKGLEEIARTTGQAIGVAVAF 361
           + ++GL EIA   G+AI +   F
Sbjct: 338 QIIEGL-EIASQRGEAIMIGHVF 359


>gi|317051484|ref|YP_004112600.1| hypothetical protein Selin_1309 [Desulfurispirillum indicum S5]
 gi|316946568|gb|ADU66044.1| protein of unknown function DUF610 YibQ [Desulfurispirillum indicum
           S5]
          Length = 426

 Score = 52.8 bits (125), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 101/225 (44%), Gaps = 2/225 (0%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           ARIAI++   G +    ++A+ + PA +TL+            +   + G E +L  PM+
Sbjct: 187 ARIAIILDDAGDNFQLAKQAVQIHPA-VTLSILPKRPFSREISQLLDRMGLEYMLHQPME 245

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A +   N   +  L  T   +++ +    +L    G  G+ N+ G+    + +   ++ +
Sbjct: 246 AQNPLINPGWA-ALLTTMDEEEIRSTFTAALESLPGVAGINNHMGSRFTQDPDRLRIVME 304

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
             A+R L F D  ++  +    +A +  +     D+++D++ D + I  +L  L   A+ 
Sbjct: 305 MIAERDLYFIDSYTTSDSQAYAVATEFQVSSGFRDVFIDNESDVEAILRQLDILVRDAQR 364

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            G AIG+      +IE + ++  +    +V +V  S +     P+
Sbjct: 365 YGSAIGIGHVRSRTIEALEEFTGRLEEMNVELVTPSVIVSHRKPA 409


>gi|254447505|ref|ZP_05060971.1| polysaccharide deacetylase family protein [gamma proteobacterium
           HTCC5015]
 gi|198262848|gb|EDY87127.1| polysaccharide deacetylase family protein [gamma proteobacterium
           HTCC5015]
          Length = 270

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 93/218 (42%), Gaps = 4/218 (1%)

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           AI++  +G + T + R I  +P  +T A      + +R  +      +E +L +PMQ   
Sbjct: 29  AIIIDDIGYN-TVSARRIAAMPWPLTCAVLPEAVASERAAQILADADKELMLHLPMQGRL 87

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
               E   + L +          +   L R     G+ N++G++L + ++    +  E +
Sbjct: 88  GEARE--PHVLNINMDRHHFRQEVLRQLDRFPRVVGINNHQGSVLTTRQQPMNWLMDELS 145

Query: 294 K-RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
                   D  ++  +L +  A    LP    D++LD Q +   I  ++     +A+ +G
Sbjct: 146 TIENFYVVDSRTASDSLLQASAQHYQLPNSTRDVFLDHQRNEAYIARQVLEFVRVAKASG 205

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AI +   + E++ V+ + L       V ++P+S L +
Sbjct: 206 SAIAIGHPYPETLNVLEKALPYFESEGVRLLPVSQLIR 243


>gi|251797981|ref|YP_003012712.1| hypothetical protein Pjdr2_3996 [Paenibacillus sp. JDR-2]
 gi|247545607|gb|ACT02626.1| protein of unknown function DUF610 YibQ [Paenibacillus sp. JDR-2]
          Length = 275

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/162 (20%), Positives = 75/162 (46%), Gaps = 1/162 (0%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           S  + AIV+   G    GT+  + L PA  T+A      +  +  +EA + G + I+ +P
Sbjct: 39  SARQFAIVIDDFGNGMNGTEEMLQL-PAKFTVAIMPFMPTTKKDAEEAHRLGHDVIVHMP 97

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+      N      +    + +++  R+  ++       G+ N+ G+ + +++    ++
Sbjct: 98  MEPNKGQKNWLGPGAITADLSDEEIKKRVEDAIDDVPYAVGMNNHMGSKITADERIMRIV 157

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
                +RGL F D  ++ + +   +  +L +P +  +++LDD
Sbjct: 158 LSVCKERGLFFLDSRTTFKTVVPKVTEELGVPALANNVFLDD 199


>gi|229065441|ref|ZP_04200691.1| hypothetical protein bcere0026_54560 [Bacillus cereus AH603]
 gi|229132227|ref|ZP_04261084.1| hypothetical protein bcere0014_11660 [Bacillus cereus BDRD-ST196]
 gi|228651275|gb|EEL07253.1| hypothetical protein bcere0014_11660 [Bacillus cereus BDRD-ST196]
 gi|228715835|gb|EEL67605.1| hypothetical protein bcere0026_54560 [Bacillus cereus AH603]
          Length = 215

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 67/145 (46%), Gaps = 1/145 (0%)

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
           GT + ++L P  +T+A      S  +    A KKG E I+ +PM+             + 
Sbjct: 3   GTDKMLSL-PIPLTVAVMPFLPSTKQDAIAAHKKGHEVIIHMPMEPIRGKKEWLGPKAIT 61

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
              + +++ NRL  +++      G+ N+ G+ + +++    +I     K GL + D  ++
Sbjct: 62  TDLSDEEINNRLEQAIQEIPHAIGMNNHMGSKVTADERIVRLILSACKKHGLFYLDSKTN 121

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDD 330
           P ++   +  +L +P +   L+ DD
Sbjct: 122 PNSVVPKIGKELGVPIIENQLFFDD 146


>gi|42528003|ref|NP_973101.1| hypothetical protein TDE2503 [Treponema denticola ATCC 35405]
 gi|41819048|gb|AAS13020.1| conserved domain protein [Treponema denticola ATCC 35405]
          Length = 390

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 78/143 (54%), Gaps = 3/143 (2%)

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           G+E IL  PMQA + + N  D   +K     +++   +  ++       G+ N+ G+++ 
Sbjct: 219 GKELILHQPMQALNPNINPGDG-AVKPGMDREEIKKIVASNVEEIGPIAGMNNHEGSLIT 277

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           S++++ E + +   ++ + F D  +S +++   +A KLN+      ++LD++ D+  +++
Sbjct: 278 SDEKAMEAVLELCREKNIYFLDSRTSSKSVVPQVAKKLNMNIWERAVFLDNKKDKAYMKK 337

Query: 340 K-LKGLEEIARTTGQAIGVAVAF 361
           + ++GL EIA   G+AI +   F
Sbjct: 338 QIIEGL-EIASQRGEAIMIGHVF 359


>gi|329296461|ref|ZP_08253797.1| hypothetical protein Pstas_07378 [Plautia stali symbiont]
          Length = 301

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 88/214 (41%), Gaps = 13/214 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++AIV+   G       + + + PA I++A   N         +A + G E 
Sbjct: 16  FTFAAHAGKLAIVIDDFGYHPAEENKVLQM-PAAISVAVLPNAPHARDMATKAHQGGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLK-----VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           ++ +PM    +   E D+ T K     + + V+   N++ Y++       G+ N+ G+ +
Sbjct: 75  LIHLPMAPLSKQPLEKDTLTPKMSSEEIARIVRDASNKVPYAV-------GLNNHMGSKM 127

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            S+    + + +        F D  +   + +   A    +  +   ++LDD  +   IR
Sbjct: 128 TSSLPGMQKVMQVLNHYNYYFLDSMTIGNSQSVPAAQGTQVKVLKRRVFLDDSQNESAIR 187

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
            +     ++A+  G AI +      ++ V+ Q L
Sbjct: 188 TQFTRAVKLAQRDGYAISIGHPHPTTVRVLQQML 221


>gi|146291148|ref|YP_001181572.1| hypothetical protein Sputcn32_0037 [Shewanella putrefaciens CN-32]
 gi|145562838|gb|ABP73773.1| protein of unknown function DUF610, YibQ [Shewanella putrefaciens
           CN-32]
 gi|319428503|gb|ADV56577.1| protein of unknown function DUF610 YibQ [Shewanella putrefaciens
           200]
          Length = 247

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 100/230 (43%), Gaps = 14/230 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + + +   +IA+++  +G  QT    A+  LP  +TL+   +    +   K   +KG E 
Sbjct: 13  YVAPSYATKIALIIDDIGYRQT--DEAVLSLPHTVTLSVLPHTPLGENLAKVGHRKGHEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF----GVMNYRGAMLL 279
           +L +PMQA +         T  + +        +R ++           G  N+ G+ LL
Sbjct: 71  MLHLPMQAINGKALGPGGLTKGMDEA------EIRANVSSAIANIPFAKGANNHMGS-LL 123

Query: 280 SNKESAEVIFKEFAKRGLLFF-DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
           +  +S  +   E  K+  L+F D  ++P +     A +L +P +   L+LD+ V +  + 
Sbjct: 124 TQLDSHMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLGIPSLKRQLFLDNNVSKKALE 183

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           ++   +   A   G  + +A  + E+I  +   L       + +VP+S L
Sbjct: 184 KQFNLMISNAHMQGSLVVIAHPYPETIRFLQANLPLLEAEGIDLVPVSDL 233


>gi|190150156|ref|YP_001968681.1| hypothetical protein APP7_0887 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251312|ref|ZP_07337490.1| hypothetical protein APP6_0513 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252454|ref|ZP_07534350.1| hypothetical protein appser6_9710 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307263494|ref|ZP_07545109.1| hypothetical protein appser13_9100 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189915287|gb|ACE61539.1| hypothetical protein APP7_0887 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302649854|gb|EFL80032.1| hypothetical protein APP6_0513 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860046|gb|EFM92063.1| hypothetical protein appser6_9710 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306871137|gb|EFN02866.1| hypothetical protein appser13_9100 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 282

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 97/206 (47%), Gaps = 5/206 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +     AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 26  AQAGKLAIVIDDIGY-RAKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 84

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY-FGVMNYRGAMLLSNKESAE 286
           PMQ     +   +S  L V  + ++ + RL  + R    Y  G+ N+ G+   +++++ E
Sbjct: 85  PMQP-KNRHQPIESGALMVGAS-KENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P    +V A +L +  +  +L+LDD     +++ +      
Sbjct: 143 HLMTELSKQQLFFLDSKTGPSVAAKV-ARELGVNALERNLFLDDNDALHEVQNQFHLALH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWL 372
            AR  G AI +      SIEV+ + L
Sbjct: 202 YARKHGSAILIGHPRKNSIEVLEKGL 227


>gi|229022892|ref|ZP_04179412.1| hypothetical protein bcere0029_12380 [Bacillus cereus AH1272]
 gi|228738427|gb|EEL88903.1| hypothetical protein bcere0029_12380 [Bacillus cereus AH1272]
          Length = 209

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/137 (21%), Positives = 62/137 (45%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  +T+A      S  +    A KKG E I+ +PM+             +    + +++
Sbjct: 4   LPIPLTIAVMPFLPSTKQDAIAAHKKGHEVIIHMPMEPIRGKKEWLGPKAITTDLSDEEI 63

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            NRL  +++      G+ N+ G+ + +++    +I     K GL + D  ++P ++   +
Sbjct: 64  NNRLEQAIQEIPHAIGMNNHMGSKVTADERIVRLILSACKKHGLFYLDSKTNPNSVVPKI 123

Query: 314 APKLNLPYMVADLYLDD 330
             +L +P +   L+ DD
Sbjct: 124 GKELGVPVIENQLFFDD 140


>gi|307245693|ref|ZP_07527779.1| hypothetical protein appser1_8960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254662|ref|ZP_07536490.1| hypothetical protein appser9_9020 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259107|ref|ZP_07540837.1| hypothetical protein appser11_9050 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306853395|gb|EFM85614.1| hypothetical protein appser1_8960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862335|gb|EFM94301.1| hypothetical protein appser9_9020 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866774|gb|EFM98632.1| hypothetical protein appser11_9050 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 282

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/206 (23%), Positives = 97/206 (47%), Gaps = 5/206 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +     AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 26  AQAGKLAIVIDDIGY-RAKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 84

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY-FGVMNYRGAMLLSNKESAE 286
           PMQ     +   +S  L V  + ++ + RL  + R    Y  G+ N+ G+   +++++ E
Sbjct: 85  PMQP-KNRHQPIESGALMVGAS-KENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P    +V A +L +  +  +L+LDD     +++ +      
Sbjct: 143 HLMTELSKQQLFFLDSKTGPSVAAKV-ARELGVNALERNLFLDDNDALHEVQNQFHLALH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWL 372
            AR  G AI +      SIEV+ + L
Sbjct: 202 YARKHGSAILIGHPRKNSIEVLEKGL 227


>gi|149922796|ref|ZP_01911220.1| hypothetical protein PPSIR1_33531 [Plesiocystis pacifica SIR-1]
 gi|149816339|gb|EDM75841.1| hypothetical protein PPSIR1_33531 [Plesiocystis pacifica SIR-1]
          Length = 312

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/240 (21%), Positives = 100/240 (41%), Gaps = 15/240 (6%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSL------DRWMK 214
           D     + +   +AIV+  +G       +   LL     L+F+   NS+      DR ++
Sbjct: 75  DHRIPWDQANGHLAIVIDDVGRELDAFDK---LLALRYPLSFSVLPNSVYTAGVQDR-LR 130

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTG----YFGV 270
              ++ +E +L +PM+  D  +  +     +           LR  +    G      GV
Sbjct: 131 ADHRRPREILLHLPMEPLDARHMSEGEELGEEFLRAGDSPASLRVKVLAALGNVPHAVGV 190

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            N+ G+ L ++  +   +     +R L F D  ++P  +  + A +  +P +   ++LD 
Sbjct: 191 NNHMGSKLTADNRAMAALMPVLRERELYFLDSRTNPETVAAIEARRAGVPTISRKVFLDH 250

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           +  +  IR  L    E AR     + +A    + +EV+ + L Q H + V + P+S L +
Sbjct: 251 EPGKAAIRRSLFEAAEFARDQ-PTVAIAHPSMDVVEVLREELPQLHTQGVGIYPVSQLLR 309


>gi|330900944|gb|EGH32363.1| hypothetical protein PSYJA_26750 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 199

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/175 (21%), Positives = 79/175 (45%), Gaps = 6/175 (3%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           ++A + G+  +L +PM      Y       L       +L +RL  +L +     G+ N+
Sbjct: 12  RQAHRAGKTVMLHMPMDPATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNH 65

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+ + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+  
Sbjct: 66  MGSRMTAEPVAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERT 125

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            + I  +L+   +IAR  G A+ +   +  +++V+ + L     + V  + L  +
Sbjct: 126 AEAITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSM 180


>gi|226310991|ref|YP_002770885.1| hypothetical protein BBR47_14040 [Brevibacillus brevis NBRC 100599]
 gi|226093939|dbj|BAH42381.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 260

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/158 (19%), Positives = 77/158 (48%), Gaps = 1/158 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A V+   G +  GT+  I  +P  +T+A      S  +  + A +KG + ++ +PM+  
Sbjct: 38  MAFVIDDFGNNMQGTEE-ILAMPVPLTVAVMPFMPSTKQDAELAHQKGHDVLVHMPMEPM 96

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
               +      +    +  ++ +R+  ++       G+ N+ G+ + +++    +I K  
Sbjct: 97  KGKRSWLGPGAITADLSDDEIRSRVEKAIDDVPHAIGMNNHMGSKITADERIMRIIMKVV 156

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +RGL + D  ++ +++   +A ++ +P+ V  ++LDD
Sbjct: 157 KERGLFYLDSKTTDKSVAAKVAAEMGVPHAVNQIFLDD 194


>gi|226326856|ref|ZP_03802374.1| hypothetical protein PROPEN_00716 [Proteus penneri ATCC 35198]
 gi|225204693|gb|EEG87047.1| hypothetical protein PROPEN_00716 [Proteus penneri ATCC 35198]
          Length = 300

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 87/208 (41%), Gaps = 13/208 (6%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            A++AIV+   G  +    + + L P  +++A   +          A  +G+E ++ +PM
Sbjct: 13  AAKLAIVIDDFGYRKKEDNQILQL-PTAVSIAILPDSPHGKEIATRAHAQGREILIHMPM 71

Query: 230 QAFDESYNEDDSYTLKVTQT-----VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
               +   E D+    + Q      +Q  +N + Y++       G+ N+ G+ + S++++
Sbjct: 72  APISKQPLERDTLKPSMDQAEINRIIQHAINNVPYAV-------GMNNHMGSAMTSDRQA 124

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + K      L F D  +         A    +P +   ++LD+     + R++L   
Sbjct: 125 MDRVIKALNHSNLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLNRA 184

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWL 372
             +AR  G AI +      ++  + Q L
Sbjct: 185 IALARKNGSAIAIGHPHPSTVRALQQQL 212


>gi|123440475|ref|YP_001004469.1| hypothetical protein YE0075 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087436|emb|CAL10217.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 341

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 87/205 (42%), Gaps = 3/205 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+   + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLERD--TLQPLMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+AR
Sbjct: 140 QVLEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQ 374
             G AI +      +I+V+ Q L Q
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQ 224


>gi|330807031|ref|YP_004351493.1| hypothetical protein PSEBR_a348 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375139|gb|AEA66489.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 260

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/205 (19%), Positives = 87/205 (42%), Gaps = 6/205 (2%)

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
           R +  LP  +T A   +      + +EA + G+  +L +PM            +      
Sbjct: 48  RRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKLVMLHMPMDP------ATGPFAWHPEL 101

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
            +++L  RL  +        G+ N+ G+ + +  ++   +     +R   F D  +S + 
Sbjct: 102 PIEELGKRLDAAFAAVPYTSGINNHMGSRMTAQPQAMAWLMANLQQRHKFFVDSRTSAQT 161

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
           +    A K+ L  +  D++LDD+     I  +L+   ++AR  G A+ +   + +++ V+
Sbjct: 162 VAAAEAQKIGLASVSRDVFLDDERTEAAIARQLQTAIDLARQQGSAVMIGHPYPQTLAVL 221

Query: 369 SQWLQQEHVRDVSVVPLSCLAKLSS 393
            + L +   + V  + +  +  L S
Sbjct: 222 ERELPKLKAQGVEWIDIKSMISLRS 246


>gi|318603800|emb|CBY25298.1| putative divergent polysaccharide deacetylase [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 334

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/205 (19%), Positives = 87/205 (42%), Gaps = 3/205 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G       + + + P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQNENKVLQM-PLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   I ++     E+AR
Sbjct: 140 QTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIHQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQ 374
             G AI +      +I+V+ Q L Q
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQ 224


>gi|260914710|ref|ZP_05921175.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631214|gb|EEX49400.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 280

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 103/221 (46%), Gaps = 4/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G  Q    + I  +P  I++A   +     +  ++AK++G++ ++ +
Sbjct: 25  AQSAKLAIVIDDIGYHQKEDAQ-IYAMPTEISVAIIPSAPHARQRNEQAKQQGRDVLIHM 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ   +   E     L ++Q   ++ +R++ + R  +   G+ N+ G+   S+      
Sbjct: 84  PMQPLGQQKIETGGLKLGLSQ--DEVNDRVQTAKRIVSHAIGMNNHMGSAATSDSALMTK 141

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +   ++ L F D  +  R++   +A +  +  +   ++LDD      ++ + +     
Sbjct: 142 LMRSLKEQHLFFLDSRTIGRSVAGKIAKEYGVKSLDRHIFLDDSDLYADVQRQFQNAVRY 201

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A+  G AI +      ++ V+   L+    +DV +V +  L
Sbjct: 202 AQKNGTAIVIGHPRKNTVAVLQAGLKNL-PKDVQLVGIGSL 241


>gi|85060169|ref|YP_455871.1| hypothetical protein SG2191 [Sodalis glossinidius str. 'morsitans']
 gi|84780689|dbj|BAE75466.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 317

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/213 (18%), Positives = 90/213 (42%), Gaps = 13/213 (6%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
           C  A   ++AIV+   G  +  T+  +  +P N+++A   +         +A ++ +E +
Sbjct: 18  CPVAQAGKLAIVIDDFGY-RPATENQVLAMPVNVSIAVLPDAPYAREMALKAHRQRREIL 76

Query: 225 LQIPMQAFDESYNEDDSYTL-----KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           + +PM    +   E ++ T      +V+  +QQ   ++ Y++       G+ N+ G+ + 
Sbjct: 77  IHLPMAPLSKQPLERNTLTPAMSRDQVSDIIQQATQKVPYAV-------GLNNHMGSAMT 129

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           S+    + + +  +     F D  +   +     +    +  +   ++LDD  +   IR 
Sbjct: 130 SSLSGMQHVMQALSHYSYYFLDSVTIGNSQAVPASAGTGVRVLKRQVFLDDTANEADIRH 189

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           +      +AR  G AI +      ++ V+ Q L
Sbjct: 190 QFNRAVALARRNGFAIAIGHPHPATVRVLQQML 222


>gi|157163961|ref|YP_001467158.1| ferric-uptake regulator [Campylobacter concisus 13826]
 gi|112801347|gb|EAT98691.1| divergent polysaccharide deacetylase family [Campylobacter concisus
           13826]
          Length = 483

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 77/162 (47%), Gaps = 3/162 (1%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQA  + ++  +  TL + ++ + +  +++   R         N+ G+   S+ +
Sbjct: 321 MIHLPMQA--KHFDSPEIGTLTINESFESMHEKIKKIRRDFPRAKYTNNHTGSRFTSDYD 378

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + +  ++   ++G +F D  +  +      A K N PY+  D++LDD      +R +L  
Sbjct: 379 AMDKAYRALIEQGFIFVDSKTIAQTAVARAAKKYNQPYISRDIFLDDDPSASAVRRELVA 438

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
              +A+  G AI +      +I VI +  +   ++DV VV L
Sbjct: 439 AVNLAKKRGYAIAIGHPKKNTIAVI-KASKNNILKDVEVVYL 479


>gi|120556079|ref|YP_960430.1| protein of unknown function DUF610, YibQ [Marinobacter aquaeolei
           VT8]
 gi|120325928|gb|ABM20243.1| protein of unknown function DUF610, YibQ [Marinobacter aquaeolei
           VT8]
          Length = 272

 Score = 52.0 bits (123), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 96/221 (43%), Gaps = 13/221 (5%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ-- 230
           IAI++  +G ++   +R +  L   +TLAF           K A  + +E +L  PM   
Sbjct: 33  IAIIIDDMGHNRHEGER-LARLDQPLTLAFLPYRRHTVPLAKLAHAQSKEIMLHAPMANT 91

Query: 231 ---AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
                       D   L +  T+++ L  + +         GV N+ G++L    E  + 
Sbjct: 92  RNFGLGPGGLTPDMDELAIATTLRRALQSIPF-------VSGVNNHMGSLLTQQLEPMDW 144

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + KE  +  + F D  +   ++   +A   N+P +  D++LD +   + + ++ K L + 
Sbjct: 145 VMKELDRYPVYFVDSRTIANSIAGSVADAYNIPSLTRDVFLDHEQTEEFVDKQFKLLIQT 204

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           AR  G AIG+      +++ + + L     + +++  +S L
Sbjct: 205 AREKGTAIGIGHPHKVTVDYLEKHLPMLDEQGIAIATVSGL 245


>gi|320354673|ref|YP_004196012.1| hypothetical protein Despr_2585 [Desulfobulbus propionicus DSM
           2032]
 gi|320123175|gb|ADW18721.1| protein of unknown function DUF610 YibQ [Desulfobulbus propionicus
           DSM 2032]
          Length = 294

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 82/198 (41%), Gaps = 2/198 (1%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           D N  + A    IAI++  +G +     R    L  N+T +F           ++A + G
Sbjct: 68  DGNASTTAGRPEIAIIIDDMG-NDLKMGRKFLELDDNLTFSFLPGAPHTQELAEQAFQAG 126

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           +  ++ +PM+  D  ++   +  L +  T + +  +    L       G  N+ G+    
Sbjct: 127 RTVLVHLPMEPKDTRWSPG-TEALHIADTEEGIRTKTETMLAAVPHAVGTNNHMGSRFTE 185

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +      +     +R L F D  ++  +     A +L +P     ++LD++    KI ++
Sbjct: 186 HGLGMHRVLTVLKERALFFVDSYTTAGSQGLATARRLAVPATRRHVFLDNEKTPSKICDQ 245

Query: 341 LKGLEEIARTTGQAIGVA 358
           L  L  +AR  G A+G+ 
Sbjct: 246 LDQLALLARQQGHAVGIG 263


>gi|317485790|ref|ZP_07944655.1| divergent polysaccharide deacetylase [Bilophila wadsworthia 3_1_6]
 gi|316922964|gb|EFV44185.1| divergent polysaccharide deacetylase [Bilophila wadsworthia 3_1_6]
          Length = 516

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 93/217 (42%), Gaps = 7/217 (3%)

Query: 172 RIAIVVSGLGISQTGTQRAINL-LPANIT-LAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           R+ IV++ LG  +  T   + L LP   + L FA +  +      EA   GQE ++ +PM
Sbjct: 275 RLTIVMNELGGDKAVTASLLALKLPITFSVLPFAKDAAATATAAHEA---GQEVLVDMPM 331

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +     + +     +    + + +   +  +L       G  N+ G+ L ++  +     
Sbjct: 332 ETMQSPFVKAGPGEITTKMSEEDMRILMDDALGHVPYATGASNFMGSRLTTDTAATRRFC 391

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD-KIREKLKGLEEIA 348
           +  A+ GL   DD +   ++    A +  LP     L L+D    +  +   LK  EE A
Sbjct: 392 EILARSGLYVLDDVTHQESILYAEARRRGLPAWRRALTLNDGPKTEGAVLADLKKAEETA 451

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
           R  G A+ +A      +  + +W  QE  +D+ +VPL
Sbjct: 452 RAKGHAVVIATPAPHVLAALKRW-SQERDKDIRLVPL 487


>gi|152972465|ref|YP_001337611.1| hypothetical protein KPN_03959 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150957314|gb|ABR79344.1| hypothetical protein KPN_03959 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 315

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 85/207 (41%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G  +  T+  +  LP+ I++A   N         +A   G E 
Sbjct: 17  LAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMATKAHNLGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAVGLNNHMGSAMTSNLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +         A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRNQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
              +AR  G AI +      ++ V+ Q
Sbjct: 194 AIALARRNGSAIAIGHPHPTTVRVLQQ 220


>gi|51594416|ref|YP_068607.1| hypothetical protein YPTB0058 [Yersinia pseudotuberculosis IP
           32953]
 gi|153950008|ref|YP_001399074.1| divergent polysaccharide deacetylase [Yersinia pseudotuberculosis
           IP 31758]
 gi|170026350|ref|YP_001722855.1| hypothetical protein YPK_4143 [Yersinia pseudotuberculosis YPIII]
 gi|186893404|ref|YP_001870516.1| hypothetical protein YPTS_0060 [Yersinia pseudotuberculosis PB1/+]
 gi|51587698|emb|CAH19298.1| HYPOTHETICAL 30.7 KD PROTEIN IN SECB-TDH INTERGENIC REGION
           [Yersinia pseudotuberculosis IP 32953]
 gi|152961503|gb|ABS48964.1| Divergent polysaccharide deacetylase [Yersinia pseudotuberculosis
           IP 31758]
 gi|169752884|gb|ACA70402.1| protein of unknown function DUF610 YibQ [Yersinia
           pseudotuberculosis YPIII]
 gi|186696430|gb|ACC87059.1| protein of unknown function DUF610 YibQ [Yersinia
           pseudotuberculosis PB1/+]
          Length = 336

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/225 (20%), Positives = 93/225 (41%), Gaps = 3/225 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G       + + + P  I++A   N         +A  +G+E 
Sbjct: 17  IASTAQAGKLSIVIDDFGYRPQNENKILQM-PLPISVAILPNAPYAREMATKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R +        G+ N+ G+ + ++  
Sbjct: 76  LIHLPMAPQSKQPLERD--TLQPSMSSEEIQRIIRQAANNVPYAKGMNNHMGSAMTASLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQALGSYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKIFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              +AR  G AI +      +I+V+ Q L Q     V V P + L
Sbjct: 194 AVALARRNGSAIAIGHPHPATIKVLQQMLPQLPADIVLVRPSALL 238


>gi|289523286|ref|ZP_06440140.1| polysaccharide deacetylase family protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289502978|gb|EFD24142.1| polysaccharide deacetylase family protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 315

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 99/223 (44%), Gaps = 17/223 (7%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWM 213
           TE P+  K+      GA +AIVV  LG S    +    L +P  +T A      S     
Sbjct: 80  TEEPSKAKSL----KGAYLAIVVDDLGFSYARAEELAGLKIP--LTWAIIPFQRSSKATA 133

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           + A+ KG   ++ +PM+AF +  NE   + + ++   + +   +R +L    G  GV N+
Sbjct: 134 ELARNKGIPFLVHVPMEAFGD--NESQMHLVALSMDDETIRRNVREALESLPGAIGVNNH 191

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
           RG+   S+  +   + +E  +  ++F D  ++  ++  + A K  +  +    ++D   D
Sbjct: 192 RGSAATSDMRAMRALMEELRQDNMIFLDSRTAASSVAAIEARKAGIFALENGAFIDHLED 251

Query: 334 RDKIREKLKGLEEIARTTGQAI--GVAVAFDESIEVISQWLQQ 374
              +  +L+      R  GQA   G AVA   +  V   +L Q
Sbjct: 252 IKFMWSQLE------RAAGQAQRRGYAVAICHARPVTLTFLNQ 288


>gi|291619436|ref|YP_003522178.1| YibQ [Pantoea ananatis LMG 20103]
 gi|291154466|gb|ADD79050.1| YibQ [Pantoea ananatis LMG 20103]
          Length = 303

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/215 (19%), Positives = 98/215 (45%), Gaps = 15/215 (6%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +F S A  A++AIV+   G   T   + + + P  I++A   +     +   +A + G+E
Sbjct: 18  SFASQA--AKLAIVIDDFGYRPTEENKVLQM-PQAISVAVLPDAPYARQMAIKAHQGGRE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQT-----VQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
            ++ +PM    +   E ++ T ++++      ++  +N + Y++       G+ N+ G+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKNTLTPEMSRAEIDRIIRSAVNNVPYAV-------GLNNHMGSK 127

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + S+    + + +   +  L F D  +   + +   A   ++  +   ++LDD  D + I
Sbjct: 128 MTSSLPGMQKVMQALNQYNLYFLDSMTIGNSQSLQAAQGTHVRVLKRRVFLDDSQDINAI 187

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           R++      +A+  G AI +      ++ V+ Q L
Sbjct: 188 RQQFNRAVTLAQRDGYAIAIGHPHPNTVRVLQQML 222


>gi|288933028|ref|YP_003437087.1| hypothetical protein Kvar_0143 [Klebsiella variicola At-22]
 gi|288887757|gb|ADC56075.1| protein of unknown function DUF610 YibQ [Klebsiella variicola
           At-22]
          Length = 318

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 85/207 (41%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G  +  T+  +  LP+ I++A   N         +A   G E 
Sbjct: 17  LAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMATKAHNLGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAIGLNNHMGSAMTSNLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +         A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRNQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
              +AR  G AI +      ++ V+ Q
Sbjct: 194 AIALARRNGSAIAIGHPHPTTVRVLQQ 220


>gi|271498745|ref|YP_003331770.1| hypothetical protein Dd586_0167 [Dickeya dadantii Ech586]
 gi|270342300|gb|ACZ75065.1| protein of unknown function DUF610 YibQ [Dickeya dadantii Ech586]
          Length = 309

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++A+V+   G  +   +  +  +P  I++A   N         +A  +G+E ++ +PM
Sbjct: 22  AGKLALVIDDFGY-RPHNENQVLAMPTAISVAVLPNAPYAREMATKAHAQGREVLIHLPM 80

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+   + +++   LR ++ +     G+ N+ G+ + ++    + + 
Sbjct: 81  APMSKQPLERD--TLRPDMSSEEIARILRDAVNKVPYAVGLNNHMGSAMTASLPGMQKVM 138

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  +   L F D  +   +     A    +  +   ++LDD  +   IR +     EIA+
Sbjct: 139 QAMSAYHLYFLDSMTIGSSQASQAAAGTGIKVLKRKVFLDDTQNVADIRRQFSRAVEIAQ 198

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
            +G AI +      +I+V+ Q L
Sbjct: 199 RSGYAIAIGHPHPTTIQVLQQML 221


>gi|206900827|ref|YP_002250509.1| divergent polysaccharide deacetylase family [Dictyoglomus
           thermophilum H-6-12]
 gi|206739930|gb|ACI18988.1| divergent polysaccharide deacetylase family [Dictyoglomus
           thermophilum H-6-12]
          Length = 389

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 107/235 (45%), Gaps = 18/235 (7%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +IA VV  +      T   +N  P  + ++      + D   ++  K+G E ++ +PM++
Sbjct: 156 KIAFVVDDVVEDNFWTHELLNF-PYTLNISIIPTRKTKDI-AEKVSKRGWEVLMHLPMES 213

Query: 232 FDESYNEDDSY----TLKVTQTVQQLLNRLRYSLRRGTGYFG------VMNYRGAMLLSN 281
              SY  D  Y     + V     ++ N ++  L R    FG      V N+ G+ +  +
Sbjct: 214 I--SYPRDAKYLVSEAIMVGMDEVEIENIIKTHLER----FGNVKISWVNNHMGSKVTQD 267

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
            E+ E + K F K  L F D  +   ++   +A +  +P +   L++D + D ++I+ + 
Sbjct: 268 SETMERVIKVFKKYNLAFLDSRTILNSVGYKMANRSGIPALENMLFIDHENDEERIKARF 327

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
                IA+  G  + +     ++I+V+++  ++    D+ +V +S L ++ S  S
Sbjct: 328 IQAVNIAKKRGWGVFILHLRPKTIKVLNELDKEGFFNDLDLVRISDLYEVISEHS 382


>gi|270265206|ref|ZP_06193468.1| hypothetical protein SOD_l00560 [Serratia odorifera 4Rx13]
 gi|270040840|gb|EFA13942.1| hypothetical protein SOD_l00560 [Serratia odorifera 4Rx13]
          Length = 321

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 97/225 (43%), Gaps = 4/225 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            C+  +G +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E 
Sbjct: 18  VCAAQAG-KLSIVIDDVGY-RPHEEGAVLQMPTAISVAVLPNAPHARLMATRAHSQGREV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHMPMAPLSKQPLERD--TLQPSMSSEEIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALESYRLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDDTANEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             ++AR  G AI +      +++V+ Q L       V V P S L
Sbjct: 194 AVDLARRNGSAIAIGHPRPATVKVLQQMLPTLPADIVLVKPSSLL 238


>gi|283954085|ref|ZP_06371610.1| hypothetical protein C414_000080075 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794364|gb|EFC33108.1| hypothetical protein C414_000080075 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 361

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 65/117 (55%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 242 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSIPYIQRDVFLD 301

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++LK   E+A+  G AI +      + + + Q   ++ ++ V +V LS
Sbjct: 302 NEDDVNYVKKQLKSAVELAQKKGFAIAIGHPRKNTFKALEQ--SKDLLKSVELVYLS 356


>gi|322514546|ref|ZP_08067579.1| divergent polysaccharide deacetylase [Actinobacillus ureae ATCC
           25976]
 gi|322119485|gb|EFX91572.1| divergent polysaccharide deacetylase [Actinobacillus ureae ATCC
           25976]
          Length = 282

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/209 (21%), Positives = 93/209 (44%), Gaps = 15/209 (7%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +     AI  LP  +++A            K+A ++ ++ ++ +
Sbjct: 26  AHAGKLAIVIDDIGY-RMKKDNAIYALPKEVSVAIIPVAPYATARAKKAYEQKRDVLIHL 84

Query: 228 PMQAFDESYNEDDSYTL------KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           PMQ  ++    +    +      KV Q +Q   N++ Y++       G+ N+ G+   ++
Sbjct: 85  PMQPKNKQQPIESGALMIGASEVKVAQLIQAARNQVPYAI-------GLNNHMGSGATAD 137

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           + +   + K  A++ L F D  + P    +V A +  +  +  +L+LDD      ++ + 
Sbjct: 138 RTTMSHLMKVMAQQQLFFLDSKTGPSVAAKV-AREYGVKALERNLFLDDSDALSDVQRQF 196

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQ 370
               E AR  G AI +      S+ V+ Q
Sbjct: 197 NAAIEYARKHGSAILIGHPRKNSVAVLEQ 225


>gi|242309714|ref|ZP_04808869.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239523715|gb|EEQ63581.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 338

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 97/222 (43%), Gaps = 19/222 (8%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
           T++P+  K  C      ++AI++    IS     + I  +P  IT +      +  +   
Sbjct: 99  TQIPSKPKTQCQ-KPKPQLAIIIDD--ISNFYQYQKIQEIPYKITPSLFPRSIA-SQNTP 154

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKV--TQTVQQLLNRLRYSLRRGTGYFGVMN 272
           E  KK    ++ +P++A + S  E   Y L     QT+Q+ +  L+      T Y    N
Sbjct: 155 EIAKKADFYMVHLPLEALNFSQKEH-KYLLSTDSKQTIQETIQNLKKDFPNLT-YLN--N 210

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP---------RNLTRVLAPKLNLPYMV 323
           + G+      ++   + +   +  + F D  ++P         +N T  L    N P++ 
Sbjct: 211 HTGSKFTQTPQAMYFLLEILNENNISFVDSRTTPHTKTRNYYQQNPTTPLNQCQNQPFLE 270

Query: 324 ADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESI 365
            D++LD+++D  KI + L    +IA+T G AI +     ++I
Sbjct: 271 RDIFLDNELDITKITQNLIQAVKIAKTKGYAIAIGHPHQQTI 312


>gi|224373177|ref|YP_002607549.1| putative periplasmic protein [Nautilia profundicola AmH]
 gi|223588750|gb|ACM92486.1| putative periplasmic protein [Nautilia profundicola AmH]
          Length = 330

 Score = 51.2 bits (121), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 82/173 (47%), Gaps = 4/173 (2%)

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           K+    ++ +PMQA    + + +  TL +  +   +L+R+    +       + N+ G+ 
Sbjct: 160 KEFSHYMVHLPMQAIH--FKKPEPKTLNINDSYLTILSRIDEIKKMFPKAKFINNHTGST 217

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
             SNKE+   +F+      + F D  ++P +  +    +  +P    +++LD++ +   I
Sbjct: 218 FTSNKEAMIKLFRALKTENMGFVDSKTTPNSKAKEAQKEFYIPLYSRNIFLDNEENPTYI 277

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           R +LK   +IA+  G AI +      ++E +      + ++++ VV +  L+K
Sbjct: 278 RNQLKKAVKIAQKRGYAIAIGHPHSITLETLKN--STDILKNIDVVYIDELSK 328


>gi|205373558|ref|ZP_03226361.1| hypothetical protein Bcoam_09870 [Bacillus coahuilensis m4-4]
          Length = 258

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 112/221 (50%), Gaps = 11/221 (4%)

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF- 232
           AIV+  LG +  GT+  + L P  +T+A   +  +     ++A K G E I+ +P++   
Sbjct: 30  AIVIDDLGNNMKGTEEILQL-PTILTVAVMPHLETSKEDAEKAHKLGHEVIIHLPLEPVR 88

Query: 233 -DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +S+    S T  ++   +++  R+R +++      G+ ++ G+   +++    +I + 
Sbjct: 89  GKKSWLGPGSITTDLSD--EEIRKRVRLAIKSVPHAVGMNHHLGSKASADERVMRIILEV 146

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE-IART 350
             +  L + D  +S +++   LA +L + Y+  +++LD     + +  K K LE+ +AR 
Sbjct: 147 CKENNLYYLDSKTSTQSVIPKLANELGVSYLENEIFLDHVGTIEHMVGKAKLLEKRLARE 206

Query: 351 TGQ-AIG-VAVAFDESIEVISQWLQQ-EHVRDVSVVPLSCL 388
               AIG V +  D+  +V+ +++ + E + D   VPLS L
Sbjct: 207 NELIAIGHVGITGDKMADVLREFIPEFEEIGD--AVPLSKL 245


>gi|332531758|ref|ZP_08407643.1| hypothetical protein PH505_aa00630 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038734|gb|EGI75176.1| hypothetical protein PH505_aa00630 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 208

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 85/175 (48%), Gaps = 2/175 (1%)

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A +  +E +L +PMQA +       + TL + +  +QL   L  +L       GV N+ G
Sbjct: 19  ASQSNKELLLHVPMQALNGKELGPGALTLNMNK--EQLQQTLGTALASLPQVKGVNNHMG 76

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           + L    ++ +   +   KR L F D  ++  +  +  A  L +  +   ++LD+    +
Sbjct: 77  SALTQKSQAMKWTMEVLKKRHLYFLDSRTTDLSQAQNAANFLGVANISRQVFLDNITTPE 136

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           +++ +L+ L+++A +   AI +A  + E+IE +   L +   +   +VP+S L +
Sbjct: 137 QLQLRLEELKQLAISHSFAIAIAHPYPETIEFLRHALPELTKQGFELVPVSQLVE 191


>gi|206578516|ref|YP_002236021.1| polysaccharide deacetylase family protein [Klebsiella pneumoniae
           342]
 gi|290511821|ref|ZP_06551189.1| yibQ [Klebsiella sp. 1_1_55]
 gi|206567574|gb|ACI09350.1| polysaccharide deacetylase family protein [Klebsiella pneumoniae
           342]
 gi|289775611|gb|EFD83611.1| yibQ [Klebsiella sp. 1_1_55]
          Length = 318

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/207 (19%), Positives = 85/207 (41%), Gaps = 3/207 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G  +  T+  +  LP+ I++A   N         +A   G E 
Sbjct: 17  LAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMATKAHNLGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAVGLNNHMGSAMTSNLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +         A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRTQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
              +AR  G AI +      ++ V+ Q
Sbjct: 194 AIALARRNGSAIAIGHPHPTTVRVLQQ 220


>gi|294638294|ref|ZP_06716547.1| YibQ protein [Edwardsiella tarda ATCC 23685]
 gi|291088547|gb|EFE21108.1| YibQ protein [Edwardsiella tarda ATCC 23685]
          Length = 294

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 89/210 (42%), Gaps = 4/210 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   ++AIV+   G  +   ++ +  LP  IT+A   N          A  +G+E 
Sbjct: 1   MAAPAQAGKLAIVIDDFGY-RPHEEKQVLALPLPITIAVLPNAPHAREMALRAHAQGREI 59

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E +  TL+ T +  ++   +  ++       G+ N+ G+ + SN  
Sbjct: 60  LIHLPMAPLSKQPLERN--TLQPTMSEAEIQRIIHQAVDNVPYAVGMNNHMGSAMTSNLA 117

Query: 284 SAEVIFKEFAKRGLLFFDDGSS-PRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             + + +   +   L+F D  +   +     A    +  +   ++LDD  +   IR +L 
Sbjct: 118 GMQKVMRALEQYHFLYFLDSVTIAHSQVSNAAQGTGVKVIKRKVFLDDAQNESAIRAQLN 177

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWL 372
              ++AR  G AI +      ++ V+ Q L
Sbjct: 178 RAIQLARRNGSAIAIGHPHPTTVRVLQQML 207


>gi|77456558|ref|YP_346063.1| hypothetical protein Pfl01_0330 [Pseudomonas fluorescens Pf0-1]
 gi|77380561|gb|ABA72074.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 258

 Score = 50.8 bits (120), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 88/202 (43%), Gaps = 7/202 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A + +++  LG +    +R + L P  +T A   +      + +EA + G+  IL +PM 
Sbjct: 29  AYLTLIIDDLGQNLPRDRRVLAL-PGPVTTAIMPDTPHATEFAREAHRAGKVVILHMPMD 87

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                      +       +++L  RL  + +      G+ N+ G+ + +   +   +  
Sbjct: 88  P------ATGPFAWHPELPIEELEKRLNAAFKMVPYTAGINNHMGSRMTAQPVAMAWLMG 141

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +R   F D  +S + +    A K++L  +  D++LDD+     I  +L+    +A  
Sbjct: 142 ELQRRHKFFVDSRTSAQTVAAQQAQKIDLASVSRDVFLDDERTEAAILTQLQTAISLAHK 201

Query: 351 TGQAIGVAVAFDESIEVISQWL 372
            G A+ +   + +++ V+ + L
Sbjct: 202 QGSAVMIGHPYPQTLAVLEREL 223


>gi|293393596|ref|ZP_06637906.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423931|gb|EFE97150.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 316

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 87/202 (43%), Gaps = 3/202 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E ++ +PM 
Sbjct: 24  GKLSIVIDDVGY-RPHEENAVLQMPLAISVAVLPNAPHAHLMATRAHSQGREVLIHMPMA 82

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
              +   E D  TL+ + +  ++   +R ++       G+ N+ G+ + S+  + + + +
Sbjct: 83  PLSKQPLERD--TLQPSMSSDEVQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPAMQKVMQ 140

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
                 L F D  +   +     A    +  +   ++LDD      IR +     E+AR 
Sbjct: 141 ALESYNLYFLDSMTIGNSQATRAAAGTGVKVIKRRVFLDDTASEADIRHQFNRAVELARR 200

Query: 351 TGQAIGVAVAFDESIEVISQWL 372
            G AI +      +++V+ Q L
Sbjct: 201 NGSAIAIGHPRPATVKVLRQML 222


>gi|312879555|ref|ZP_07739355.1| protein of unknown function DUF610 YibQ [Aminomonas paucivorans DSM
           12260]
 gi|310782846|gb|EFQ23244.1| protein of unknown function DUF610 YibQ [Aminomonas paucivorans DSM
           12260]
          Length = 338

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 84/188 (44%), Gaps = 7/188 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            R+A+VV  +G      +R + L LP  +T A   +        K A+  G   ++ +PM
Sbjct: 108 GRVALVVDDMGYDLAVARRLVGLGLP--LTWAILPDAPHAAATAKIARDAGIPYLVHLPM 165

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           QA  +   +D  Y +    + + +  R   +     G FGV N+RG+   +++ + E   
Sbjct: 166 QA--QGDGDDGPYAVASGWSAEVIRERSLRAFEALPGAFGVNNHRGSRATADRVAMERFL 223

Query: 290 K--EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
              + A+ G +F D  ++  +    +A +  +     D +LD + + + IR   +    +
Sbjct: 224 SVLQEARPGWIFLDSRTNGASCGFSVAQEKGIRTSRNDRFLDHRDEDEAIRAAFEAGASL 283

Query: 348 ARTTGQAI 355
           AR  GQAI
Sbjct: 284 ARRKGQAI 291


>gi|251791501|ref|YP_003006222.1| hypothetical protein Dd1591_3943 [Dickeya zeae Ech1591]
 gi|247540122|gb|ACT08743.1| protein of unknown function DUF610 YibQ [Dickeya zeae Ech1591]
          Length = 309

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 92/206 (44%), Gaps = 9/206 (4%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++A+V+   G  +   +  +  +PA I++A   N         +A  +G+E ++ +PM
Sbjct: 22  AGKLALVIDDFGY-RPHNENQVLAMPAAISVAVLPNAPYAREMAMKAHAQGREVLIHLPM 80

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+   + +++   LR ++ +     G+ N+ G+ + ++    + + 
Sbjct: 81  APMSKQPLERD--TLRPDMSSEEIARILRDAVNKVPYAVGLNNHMGSAMTASLPGMQKVM 138

Query: 290 KEFAKRGLLFFDD---GSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +      L F D    GSS    +R  A    +  +   ++LDD  +   IR +     +
Sbjct: 139 QAMTTYRLYFLDSMTIGSS--QASRAAA-GTGIKVLKRKVFLDDTQNVADIRRQFSRAVD 195

Query: 347 IARTTGQAIGVAVAFDESIEVISQWL 372
           IA+ +G AI +      +I+V+ Q L
Sbjct: 196 IAQRSGYAIAIGHPHPATIQVLQQML 221


>gi|153952202|ref|YP_001398408.1| putative periplasmic protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152939648|gb|ABS44389.1| putative periplasmic protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 207

 Score = 50.4 bits (119), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/163 (20%), Positives = 86/163 (52%), Gaps = 4/163 (2%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +P+ A D  YN+ +  TL    + +++  +++   +       + N+ G++  SN+E
Sbjct: 44  LVHLPLAAID--YNKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEE 101

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   +++    + + F D  +   +    +A +LN+PY+  D++LD++ D + ++++L+ 
Sbjct: 102 AMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLDNEDDVNYVKKQLEN 161

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
             ++A+  G AI +      + + + Q   ++ ++ V +V LS
Sbjct: 162 AVKLAQKKGFAIAIGYPRKNTFKALEQ--SKDLLKGVELVYLS 202


>gi|238921665|ref|YP_002935180.1| hypothetical protein NT01EI_3821 [Edwardsiella ictaluri 93-146]
 gi|238871234|gb|ACR70945.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 312

 Score = 50.1 bits (118), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 87/211 (41%), Gaps = 4/211 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   ++AIV+   G       + + + P  +T+A   N        + A  +G+E 
Sbjct: 17  LTAPAQAGKLAIVIDDFGYRPREENKVLEM-PLPVTIAVLPNAPHAREMAQRAHAQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ T +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPTMSEAEIQRIIRQAVGNVPYAVGMNNHMGSAMTSSLT 133

Query: 284 SAEVIFKEFAKRGLLFF-DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             + + +   +   L+F D  +   +     A    +  +   ++LDD      IR +L 
Sbjct: 134 GMQKVMRALEQYHFLYFLDSMTISHSQVSNAAQGTGIRVIKRKVFLDDTQSESAIRTQLN 193

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
               +AR  G AI +      ++ V+ Q L 
Sbjct: 194 RAITLARRNGSAIAIGHPHPATVRVLQQMLH 224


>gi|119773199|ref|YP_925939.1| hypothetical protein Sama_0057 [Shewanella amazonensis SB2B]
 gi|119765699|gb|ABL98269.1| protein of unknown function DUF610, YibQ [Shewanella amazonensis
           SB2B]
          Length = 250

 Score = 50.1 bits (118), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/221 (19%), Positives = 98/221 (44%), Gaps = 4/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A GA++AI++  +G   T     +  LP +ITL+   +     +   +  ++G E +L +
Sbjct: 16  AHGAQLAIIIDDIGYRHT--DEDVLSLPKDITLSVIPSSPLGVKLASKGHQRGHEIMLHL 73

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ+ +         T  + +  Q++  ++  ++ R     G  N+ G+ML         
Sbjct: 74  PMQSLNARPLGQGGLTSDMDE--QEIKRKVDDAMVRIPFAKGANNHMGSMLTQLDSHMLW 131

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  ++  +     A ++ +P +   ++LD+   +  + ++ K + E 
Sbjct: 132 VMERLKHNNLYFVDSLTTRYSKAGAKAEQVGVPLLKRHVFLDNDTSKRGLEKQFKLMMEQ 191

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A   G  + +A     +++ ++  L +     +++VP S L
Sbjct: 192 AHQQGFVVAIAHPHPATVKFLNANLHRLRDEGINLVPTSEL 232


>gi|239906405|ref|YP_002953146.1| hypothetical protein DMR_17690 [Desulfovibrio magneticus RS-1]
 gi|239796271|dbj|BAH75260.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 390

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 90/218 (41%), Gaps = 2/218 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+ +V+  +G       + +  LP ++TLA   N          A  +  E IL  PMQ 
Sbjct: 172 RMVVVIDDIG-DHPVMAKNLTELPFSVTLAILPNRPRTRSVEAMAASQHVEIILHQPMQP 230

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                       L      +++   L  +L +     G+ N+ G+   S+    + +   
Sbjct: 231 GTYPRVNPGPGALFTDMEPERVKEILADNLSQVPHVKGINNHMGSAFTSDPAGMDAVMAV 290

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++GL F D  +S  +     A K  +P+    ++LD+  +   I  +LK  E  A   
Sbjct: 291 LKQKGLFFLDSVTSAVSAAPEAARKHGVPFYRRAVFLDNVRNVRTILGQLKTAERNALKN 350

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           G+AI +   + E++E +  W ++   R V VV L+ L 
Sbjct: 351 GRAIAIGHPYGETLEALKIWAKERDGR-VDVVTLTELG 387


>gi|24371646|ref|NP_715688.1| hypothetical protein SO_0046 [Shewanella oneidensis MR-1]
 gi|24345408|gb|AAN53133.1|AE015456_3 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 251

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/221 (19%), Positives = 94/221 (42%), Gaps = 4/221 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           ++ A+IA+++  +G   T    A+  LP+++TL+   +     +  K A   G E +L +
Sbjct: 17  SNAAQIALIIDDIGYRHT--DEAVLSLPSSVTLSVLPHTPLSSKLAKAAHANGHEIMLHL 74

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQA +         T  + +   Q+ + +  ++       G  N+ G++L    +    
Sbjct: 75  PMQALNGKALGVGGLTNNMNEA--QIRSSVLAAMASVPFAKGANNHMGSLLTQLDDPMLW 132

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +   ++   F D  ++        A +L +P +   L+LD+ V    +  +   +   
Sbjct: 133 VMETLKQKQFYFVDSMTTKFTKAGDRADQLGVPLLRRQLFLDNDVSTQALERQFNLMISQ 192

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A   G  + +A  + E+I  +   L +     + +VP S L
Sbjct: 193 AHAQGSLVAIAHPYPETIHFLKANLARLKAEGIELVPTSRL 233


>gi|310765988|gb|ADP10938.1| conserved uncharacterized protein YigQ [Erwinia sp. Ejp617]
          Length = 304

 Score = 50.1 bits (118), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 86/209 (41%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G      Q+ + + PA I++A   N         +A + G E 
Sbjct: 16  IASPAWAGKLSIVIDDFGYRPALEQQVLQM-PAAISVAVLPNAPHAREMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R +        G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLEKD--TLRPDMSTEEIGRIIREAAAAVPYAVGLNNHMGSAMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +        F D  +   +     A   N+  +   ++LDD  +   IR +   
Sbjct: 133 AMQKVMQILNHYHFYFLDSMTIGNSQATRAAEGTNVKVVKRRVFLDDSQNEADIRVQFTR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
              +A+  G AI +      ++ V+ Q L
Sbjct: 193 AVRLAQRDGSAIAIGHPHPSTVRVLQQML 221


>gi|223041917|ref|ZP_03612102.1| hypothetical protein AM202_0513 [Actinobacillus minor 202]
 gi|223017271|gb|EEF15698.1| hypothetical protein AM202_0513 [Actinobacillus minor 202]
          Length = 282

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 92/206 (44%), Gaps = 3/206 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G S    QR   L P  I++A   +        + A  + ++ ++ +
Sbjct: 25  AQAAKLAIVIDDIGYSVREDQRVYQL-PKEISVAIIPSAPYAKVRAENAFAQKRDILIHL 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ    +    +   L V    ++  + L  + +R     G+ N+ G+   ++K +   
Sbjct: 84  PMQP-QNAQQAIEKPALLVGDDFEKARSLLENARQRVPYAIGLNNHMGSGATADKATMRH 142

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
             +  A++ L F D  + P   T+V A +  +  +   ++LDD  +   +  + +  +  
Sbjct: 143 FMQALAEQKLFFLDSKTGPSVATKV-AVEFGISALERHVFLDDSNEYHDVLHQFQQAKAY 201

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQ 373
           AR  G AI +      SI+V+ + L+
Sbjct: 202 ARKHGVAILIGHPRKNSIDVLEKELK 227


>gi|78777856|ref|YP_394171.1| hypothetical protein Suden_1659 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498396|gb|ABB44936.1| Protein of unknown function DUF610, YibQ [Sulfurimonas
           denitrificans DSM 1251]
          Length = 364

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/147 (19%), Positives = 76/147 (51%), Gaps = 2/147 (1%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+A  +S+  ++  TL+V  + ++++ R+    +       + N+ G+   +++ 
Sbjct: 204 MVHLPMEA--QSFKSEEPLTLRVDDSNEKIVQRVVEIKKLFPKVKYINNHTGSKFTADEA 261

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + +     K  ++F D  ++  +  + ++ K  L Y+  D++LD ++D+  I  ++K 
Sbjct: 262 AMDRLISALKKSDIIFVDSRTTGESKAQKISKKYALEYIGRDVFLDHKMDKAYILSQIKK 321

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
             E+A+  G AI +      +I  I++
Sbjct: 322 AIEVAKKHGSAIAIGHPHANTIAAINE 348


>gi|260599915|ref|YP_003212486.1| hypothetical protein CTU_41230 [Cronobacter turicensis z3032]
 gi|260219092|emb|CBA34447.1| Uncharacterized protein yibQ [Cronobacter turicensis z3032]
          Length = 286

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/198 (19%), Positives = 82/198 (41%), Gaps = 3/198 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +V+   G  +  T+  +  +PA +++A   N         +A  +G + ++ +PM    +
Sbjct: 1   MVIDDFGY-RPSTENQVLAMPAEVSVAVLPNAPHAREMATKAHNQGHDVLIHLPMAPLSK 59

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              E D  TL+   + +++   +R ++       G+ N+ G+ + S+    + +    A 
Sbjct: 60  QPLEKD--TLRPDMSSEEIARIIREAVNDVPYAIGMNNHMGSAMTSSLPGMQKVMAALAH 117

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
             L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G A
Sbjct: 118 YNLFFLDSMTIGNSQAMRAAAGTGVKVIKRKVFLDDIQNEADIRYQFNRAVALARRNGSA 177

Query: 355 IGVAVAFDESIEVISQWL 372
           I +      ++ V+ Q L
Sbjct: 178 IAIGHPHPSTVRVLQQML 195


>gi|257457722|ref|ZP_05622885.1| divergent polysaccharide deacetylase family protein [Treponema
           vincentii ATCC 35580]
 gi|257444890|gb|EEV19970.1| divergent polysaccharide deacetylase family protein [Treponema
           vincentii ATCC 35580]
          Length = 470

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/189 (20%), Positives = 83/189 (43%), Gaps = 25/189 (13%)

Query: 197 NITLAFASNGNSLD--------------------RWMKEA----KKKGQEAILQIPMQAF 232
           N+T  F   G++LD                    R+  E+    +K G++ IL  PMQ+ 
Sbjct: 248 NLTFVFDDAGHNLDQLEYFLRLPFPCTIAVLPGLRYSSESARRIRKAGKQVILHQPMQSV 307

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N      +    + +Q+ N +R +L       G+ N+ G+++ +++ +   +    
Sbjct: 308 DLHINPGPG-AVTPGLSAEQIKNIVRKNLEEIWPVAGMNNHEGSLMTADEAAMRAVLDVV 366

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           A++ + F D  ++ +++   +A + N+      +++D+   R  +  ++K    IAR  G
Sbjct: 367 AEKHIFFLDSRTTAKSVVSKVAKEKNMVVWERAIFIDNDKSRAAMETQIKKGLSIARQKG 426

Query: 353 QAIGVAVAF 361
            AI +   F
Sbjct: 427 SAIMIGHVF 435


>gi|197117641|ref|YP_002138068.1| divergent polysaccharide deacetylase domain-containing protein
           [Geobacter bemidjiensis Bem]
 gi|197087001|gb|ACH38272.1| divergent polysaccharide deacetylase domain protein [Geobacter
           bemidjiensis Bem]
          Length = 317

 Score = 49.7 bits (117), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 85/205 (41%), Gaps = 5/205 (2%)

Query: 172 RIAIVVSGLGIS--QTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           R+AI++  +G S  +  T ++I L    IT +   +     +    A   G E ++ +PM
Sbjct: 100 RVAIIIDDMGSSMQELQTLQSIGL---PITYSIIPSLPRARQVADSAHAAGAEVMVHMPM 156

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +       + +S  L VT    ++  R+     R     G  N+ G+    + +  E   
Sbjct: 157 EPEGYPKQKMESIGLLVTMDDAEIAKRVSDYFSRVPHAVGANNHMGSRFTQHADKMEAAL 216

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
               ++G+ F D  +SP ++    A  L +      ++LD+  D   I ++L     +AR
Sbjct: 217 GVLKEKGVFFIDSRTSPASVGYQTARALGIKAGTRQVFLDNVQDEGAIGKQLLEAAAVAR 276

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQ 374
             G AI +      ++  +  +L +
Sbjct: 277 KRGGAIAICHPHPATLRALKAYLPE 301


>gi|315185549|gb|EFU19318.1| protein of unknown function DUF610 YibQ [Spirochaeta thermophila
           DSM 6578]
          Length = 311

 Score = 49.7 bits (117), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 66/149 (44%), Gaps = 6/149 (4%)

Query: 214 KEAKKKGQEA----ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
           KE   K QEA     L +PM+   E   +     L V+ +  ++   +   L    G  G
Sbjct: 130 KEVALKVQEAGKTLFLHLPMEP--EGDEDPGPGALYVSMSWNEIEKVIAEDLASVPGVQG 187

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           V N+ G+    +    E I    A  GLLF D  ++  ++ R  A +L +P M  D++LD
Sbjct: 188 VNNHMGSRFTKDPLRMEWILSILAAGGLLFVDSRTTAESVVRETALRLGVPVMERDVFLD 247

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           ++     + +      +IAR  G+A+ + 
Sbjct: 248 NEQTEAYVEQAFMHAVQIARRRGRAVAIG 276


>gi|317050088|ref|YP_004117736.1| hypothetical protein Pat9b_3890 [Pantoea sp. At-9b]
 gi|316951705|gb|ADU71180.1| protein of unknown function DUF610 YibQ [Pantoea sp. At-9b]
          Length = 301

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/211 (17%), Positives = 89/211 (42%), Gaps = 13/211 (6%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           +A   +++IV+   G       + + + PA I++A   N         +A + G E ++ 
Sbjct: 19  SAHAGKLSIVIDDFGYRPVEENKVLQM-PAAISVAVLPNATYAREMATKAHQSGHEVLIH 77

Query: 227 IPMQAFDESYNEDDSYT-----LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           +PM    +   E D+ T      ++ + +   + ++ Y++       G+ N+ G+ + S+
Sbjct: 78  LPMAPLSKQPLEKDTLTPEMSSAEIERIIHDAVGKVPYAV-------GLNNHMGSKMTSS 130

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
               + + +        F D  +   + +   A   ++  +   ++LDD  +   IR++ 
Sbjct: 131 LPGMQKVMQVLNHYNFYFLDSMTIGNSQSVPAAQGTHVKVLKRRVFLDDSQNDAAIRQQF 190

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
               ++A+  G AI +      ++ V+ Q L
Sbjct: 191 TRAVKLAQRDGYAIAIGHPHPNTVRVLQQML 221


>gi|319956136|ref|YP_004167399.1| hypothetical protein Nitsa_0380 [Nitratifractor salsuginis DSM
           16511]
 gi|319418540|gb|ADV45650.1| protein of unknown function DUF610 YibQ [Nitratifractor salsuginis
           DSM 16511]
          Length = 340

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/267 (19%), Positives = 115/267 (43%), Gaps = 26/267 (9%)

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKN-KVGREDTEVPAMDKNFCSNASGAR 172
           TV   P + + +      E+R+  GL  ++L+ K  K  +   E P+  K     +S   
Sbjct: 67  TVTVAPKQPSLVGEEYPKEDRVGFGL--EDLIEKTRKRAKGKNESPST-KATPKKSSSPE 123

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + +++    +SQ     AI  LP  +T +     + +++   +  K  +  ++  P+++ 
Sbjct: 124 LVLIIDD--VSQPRQLAAIRKLPFPVTPSIFPP-SQMNKHTPKLAKGLRHYMIHFPLESG 180

Query: 233 DESYN---------EDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
            +  N         +D +   K  + ++ L    R+          + N+ G++  SN  
Sbjct: 181 SKKMNRFEKTLFVRDDPAKVRKRVEEIRHLFPSARF----------LNNHTGSVFTSNYR 230

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   ++    K G +F D  +S  +  R +A + ++PY+  D++LD+      +R +LK 
Sbjct: 231 AMYRLYGFLKKEGFIFLDSRTSGHSKVRKIAAEYHMPYLGRDVFLDNVQIPQAVRTQLKR 290

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQ 370
              +A+  G AI +      ++ V+ Q
Sbjct: 291 AVRLAKKRGYAIAIGHPHPVTLRVLKQ 317


>gi|282858015|ref|ZP_06267216.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
 gi|282584169|gb|EFB89536.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
          Length = 323

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/247 (20%), Positives = 107/247 (43%), Gaps = 12/247 (4%)

Query: 127 SLPTIEERLILGLSKKELLAKNKVGR-EDTEVPAMDKNFCSNASGARIAIVVSGLGISQT 185
           + P++E+ L     K  L+A + V R +   +P   K   ++  G  +A+V+   G +  
Sbjct: 55  AFPSLEKTLS-STKKTILVAASWVARLQSAALPKKGKPAAASRPG--LALVIDDFGYNYG 111

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
             +R I  L    T A         +  + A K+GQ  +L +PMQA  +  N   +Y + 
Sbjct: 112 MAER-IARLKLRATWAIIPGTPHSLKIAEYAAKQGQPFLLHVPMQALGDP-NGGRNYVIG 169

Query: 246 V---TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD 302
           +    + + + L  L+    R     G+ N+RG+   S+  +     K  +     F D 
Sbjct: 170 IDVPEKKMAEYLASLQKDFPRA---IGINNHRGSKATSDAPTMRRFMKALSATRWGFLDS 226

Query: 303 GSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD 362
            +S + + + +A +  +P +   +++D   D   ++ +      +AR  G A+ +  A +
Sbjct: 227 HTSGKTVAQKVALEYRIPVVQNKVFIDGTTDLSAMKAQFNAALRLARKYGNAVAICHARE 286

Query: 363 ESIEVIS 369
            ++  ++
Sbjct: 287 GTLPFLA 293


>gi|238754759|ref|ZP_04616111.1| hypothetical protein yruck0001_30950 [Yersinia ruckeri ATCC 29473]
 gi|238707067|gb|EEP99432.1| hypothetical protein yruck0001_30950 [Yersinia ruckeri ATCC 29473]
          Length = 328

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/208 (19%), Positives = 87/208 (41%), Gaps = 3/208 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G  +   +  I  +P  I++A             +A  +G+E ++ 
Sbjct: 20  TAQAGKLSIVIDDFGY-RPQNENQILQMPLPISVAILPYAPHAKEMAIKAHSQGREVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM        E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSRQPLERD--TLQPSMSSEEIQRIIRQAVSNVPYAVGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +         A    +  +   ++LDD  +   IR++     +
Sbjct: 137 KVMQALEHYSLYFLDSVTIGNTQASKAAEGTGVKVIKRKVFLDDVQNDVAIRQQFNRAIQ 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQ 374
           +AR  G AI +      +I V+ Q L+Q
Sbjct: 197 LARKNGSAIAIGHPHPSTIRVLQQMLRQ 224


>gi|118580822|ref|YP_902072.1| hypothetical protein Ppro_2408 [Pelobacter propionicus DSM 2379]
 gi|118503532|gb|ABL00015.1| protein of unknown function DUF610, YibQ [Pelobacter propionicus
           DSM 2379]
          Length = 342

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 92/222 (41%), Gaps = 5/222 (2%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFA--SNGNSLDRWMKEAKKKGQEAILQIP 228
            R+AI++  +G    G + A +L    + L FA      S       A   G E ++ +P
Sbjct: 124 GRLAIIIDDMG---AGMREARSLAAIGVPLTFAIIPGLRSCREVAAFAAGNGIETMIHLP 180

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           MQ+        +S  L V      +  R+    R      G  N+ G+    ++     +
Sbjct: 181 MQSKGWPQQRLESNGLLVAMEEADIRERMEGFARDVPHAVGANNHMGSEFTEHEPQMSTV 240

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
                 RGL F D  ++PR++ + LA ++ +      ++LD++ +   IR +L      A
Sbjct: 241 LGVLKGRGLFFIDSVTTPRSVGQRLAREMGVRSGRRSVFLDNEQNGAYIRGQLNQAVRQA 300

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           R  G AI +      +I  ++  L     + V++VP S L +
Sbjct: 301 RKNGGAIAICHPHPATIATLAAALPTLQQQGVTLVPASRLVR 342


>gi|259906778|ref|YP_002647134.1| hypothetical protein YigQ [Erwinia pyrifoliae Ep1/96]
 gi|224962400|emb|CAX53855.1| conserved uncharacterized protein YigQ [Erwinia pyrifoliae Ep1/96]
 gi|283476564|emb|CAY72392.1| Uncharacterized protein yibQ precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 304

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 85/209 (40%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G      Q+ + + PA I++A   N         +A + G E 
Sbjct: 16  IASPAWAGKLSIVIDDFGYRPALEQQVLQM-PAAISVAVLPNAPHAREMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+     +++   +R +        G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLEKD--TLRPDMPTEEIGRIIREAAAAVPYAVGLNNHMGSAMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +        F D  +   +     A   N+  +   ++LDD  +   IR +   
Sbjct: 133 AMQKVMQILNHYHFYFLDSMTIGNSQATRAAEGTNVKVVKRWVFLDDSQNEADIRVQFTR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
              +A+  G AI +      ++ V+ Q L
Sbjct: 193 AVRLAQRDGSAIAIGHPHPSTVRVLQQML 221


>gi|152990904|ref|YP_001356626.1| hypothetical protein NIS_1160 [Nitratiruptor sp. SB155-2]
 gi|151422765|dbj|BAF70269.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 334

 Score = 48.9 bits (115), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/138 (21%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVT---QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           ++ +PM+A    + E D  TL++T   QT+++++ ++R    +      + N+ G+   +
Sbjct: 172 MIHLPMEANHYLHEEPD--TLRITSSLQTIERVIAKIRKEFPKAKV---INNHTGSRFTA 226

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           + E+ + ++K   K   +F D  ++ + +   L  +L  PY+  +++LD++ +   I+ +
Sbjct: 227 DYEAMKRLYKVLDKYHFVFLDSRTTAQTVVPKLDKELGRPYLARNVFLDNEQNVAYIKNQ 286

Query: 341 LKGLEEIARTTGQAIGVA 358
           L+    +A+  G AI + 
Sbjct: 287 LRQAVALAKKRGVAIAIG 304


>gi|304407156|ref|ZP_07388810.1| protein of unknown function DUF610 YibQ [Paenibacillus
           curdlanolyticus YK9]
 gi|304344143|gb|EFM09983.1| protein of unknown function DUF610 YibQ [Paenibacillus
           curdlanolyticus YK9]
          Length = 284

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 70/159 (44%), Gaps = 1/159 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+AIV+   G   TGT   + L P   T+A      +     + A K G + I+ +PM+ 
Sbjct: 56  RVAIVIDDFGNGMTGTTEMMKL-PFPFTVAVMPFMPTTRADAETAHKLGHDVIVHMPMEP 114

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                       L    +  ++  R+  ++       G+ N+ G+ + +++    ++   
Sbjct: 115 NKGKREWLGPGALTTDLSDSEIRKRVEAAIDNVPYAVGMNNHMGSKVTADERVMRIVLTV 174

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
             +RGL F D  ++ + +   +A +L +P +   ++LDD
Sbjct: 175 CKERGLFFLDSRTTYKTVVPKIANELGVPLLSNHVFLDD 213


>gi|253991822|ref|YP_003043178.1| hypothetical protein PAU_04350 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783272|emb|CAQ86437.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 301

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 91/209 (43%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F    S +R+AIV+   G       + + + P  I++A   +        ++A K+ +E 
Sbjct: 17  FSLQTSASRLAIVIDDFGYRPHNESKILQM-PVAISIAILPDSPYGREMAEKAYKQRREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ T + +++   ++ ++++     G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQRLEPD--TLQPTMSSEEIDRIIQQAIQKVPYAVGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + +    ++  L F D  +   +     A    +  +  +++LDD     + R +L  
Sbjct: 134 GMQKVMHSLSRYRLYFLDSVTIGNSQATKAAKGTPVRVIRRNVFLDDVQSEAETRYQLNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
              IAR  G AI +      +I  + + L
Sbjct: 194 AISIARKNGSAIAIGHPHPTTIRALQKML 222


>gi|307133063|ref|YP_003885079.1| putative periplasmic protein [Dickeya dadantii 3937]
 gi|306530592|gb|ADN00523.1| Putative periplasmic protein [Dickeya dadantii 3937]
          Length = 268

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 81/182 (44%), Gaps = 8/182 (4%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A   N         +A  +G+E ++ +PM    +   E D  TL+   + +++
Sbjct: 4   MPTAISVAVLPNAPYARDMATKAHAQGREVLIHLPMAPMSKQPLERD--TLRPDMSSEEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD---GSSPRNLT 310
              LR ++ +     G+ N+ G+ + ++    + + +      L F D    GSS    +
Sbjct: 62  ARILRDAVNKVPYAVGLNNHMGSAMTASLPGMQKVMQAMTAYRLYFLDSMTIGSS--QAS 119

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           R  A    +  +   ++LDD  +   IR +     EIA+ +G AI +      +I+V+ Q
Sbjct: 120 RAAA-GTGIKVLKRKVFLDDTQNVADIRRQFSRAVEIAQRSGYAIAIGHPHPTTIQVLQQ 178

Query: 371 WL 372
            L
Sbjct: 179 ML 180


>gi|88858432|ref|ZP_01133074.1| hypothetical protein PTD2_13619 [Pseudoalteromonas tunicata D2]
 gi|88820049|gb|EAR29862.1| hypothetical protein PTD2_13619 [Pseudoalteromonas tunicata D2]
          Length = 251

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 10/222 (4%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANIT---LAFASNGNSLDRWMKEAKKKGQEAILQ 226
             ++AIV+  +G  +     AINL P  ++   L F     S  +  + AKK   E +L 
Sbjct: 15  AGQVAIVIDDIGYHERDLD-AINL-PGEVSFSILPFTPFAKSFAQQAQLAKK---EMLLH 69

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQA   S  E     +      +QL + L  +L       G+ N+ G++L    +   
Sbjct: 70  VPMQAI--SGKELGPGAITYDMNKEQLQHMLARALDDLPQVKGINNHMGSLLTQKIKPMS 127

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
              +   +R L F D  ++  +  + +A    +  +   +++D+     ++  ++  L  
Sbjct: 128 WTMEVLKERNLYFLDSKTTQHSQAQHMANLFGVDNISRHVFIDNIPSEKQMTFRMNQLIR 187

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +A+    AI +A  + E++  + Q L +   + + +VPLS L
Sbjct: 188 LAKKNDYAIAIAHPYPETLAFLEQALPKLAEQGIKLVPLSDL 229


>gi|315127791|ref|YP_004069794.1| hypothetical protein PSM_A2729 [Pseudoalteromonas sp. SM9913]
 gi|315016305|gb|ADT69643.1| hypothetical protein PSM_A2729 [Pseudoalteromonas sp. SM9913]
          Length = 250

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 102/229 (44%), Gaps = 10/229 (4%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLL--PANITLAFASNGNSLDRWMKEAKKKGQE 222
            S     +IAIV+  +G  Q    R +  L  P  ++ +   +      +   A +  +E
Sbjct: 14  SSAVKAKQIAIVIDDIGYHQ----RDLEFLSLPGQLSYSILPHTPYSQIFATLASQSNKE 69

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQT-VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
            +L +PMQA +       + TL + +  +QQ L     SL +  G   V N+ G+ L   
Sbjct: 70  LLLHVPMQALNGKKLGPGALTLNMDKAQLQQTLGNALASLPQVKG---VNNHMGSALTQQ 126

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
            ++ +   +   KR L F D  ++  +  +  A  L +  +   ++LD+    ++++ +L
Sbjct: 127 SQAMKWTMEVLKKRQLYFLDSRTTELSQAQNAANFLGVENISRHVFLDNITTTEQLQLRL 186

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           + L+  A     AI +A  + E+I+ +   L Q   +   +VP+S L +
Sbjct: 187 EELKSKATKYQFAIAIAHPYPETIDFLRHALPQLSEQGFELVPVSQLVE 235


>gi|15603373|ref|NP_246447.1| hypothetical protein PM1508 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721894|gb|AAK03592.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 280

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 94/211 (44%), Gaps = 11/211 (5%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G  Q    + I  LP  I++A   +     +  ++A ++G++ ++ +
Sbjct: 25  AQPAKLAIVIDDIGYHQKEDAQ-IYALPKEISVAIIPSAPHARQRNEQAYQQGRDILIHM 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ    S+   ++  L V    + +  R++ +    +   G+ N+ G+   ++ E    
Sbjct: 84  PMQPL--SHQRIEAGGLHVGMRQEDVQQRVQTAKAIVSHAIGMNNHMGSAATADAELMHK 141

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADL----YLDDQVDRDKIREKLKG 343
           + +E   + L F D     R + R +A K+   Y V  L    +LDD+     +  + + 
Sbjct: 142 LMQELKVQDLFFLDS----RTIGRSVAGKIAKEYGVQSLDRHIFLDDKDTYADVERQFQR 197

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
               A+  G AI +      ++ V+   L+ 
Sbjct: 198 AVHYAQKHGTAIAIGHPRKNTVAVLQAGLKH 228


>gi|52426374|ref|YP_089511.1| hypothetical protein MS2319 [Mannheimia succiniciproducens MBEL55E]
 gi|52308426|gb|AAU38926.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 281

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 93/210 (44%), Gaps = 13/210 (6%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  LG        AI  +P  I++A   +     +  + A ++G++ ++ +
Sbjct: 26  AFSAKLAIVIDDLGY-HPREDAAILAMPKEISVAIIPSAPYARQRNQLAYEQGRDILIHM 84

Query: 228 PMQAFDESYNEDDSYTL-----KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
           PMQ   +   E    ++     +V   VQQ  N + +++       G+ N+ G+   +++
Sbjct: 85  PMQPISQMNIEAGGLSIGMDAQQVAHNVQQAKNIVSHAI-------GMNNHMGSAATADR 137

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
                +  E  K+ L F D  +  R++   +A +  +  +   ++LDD      ++ + +
Sbjct: 138 PLMTELMAELRKQHLFFLDSRTIGRSVAEKIAKESGVRALQRHIFLDDSDVYGDVQRQFQ 197

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWL 372
                AR  G AI +      ++ V+ Q L
Sbjct: 198 QAIHYARKHGTAIVIGHPRKNTVAVLRQGL 227


>gi|121997999|ref|YP_001002786.1| hypothetical protein Hhal_1209 [Halorhodospira halophila SL1]
 gi|121589404|gb|ABM61984.1| protein of unknown function DUF610, YibQ [Halorhodospira halophila
           SL1]
          Length = 272

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 121/257 (47%), Gaps = 13/257 (5%)

Query: 136 ILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLP 195
           +L L     LA++  G E    P  +       +G   A+++  +G       R+I+L  
Sbjct: 12  LLLLWSAPALAQDPGGAEWMPFPTPE---VDPPAGRPAALIIDDIGDDWAAGVRSIDLA- 67

Query: 196 ANIT---LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
             +T   L    +G SL    + A ++G E +L +PM+A + +     +  L + +  +Q
Sbjct: 68  EGVTISVLPHTPHGRSL---AERAHERGHEVMLHLPMEAKNGADPGPGALFLDMDE--EQ 122

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF-DDGSSPRNLTR 311
           +   +  +L+      GV N+ G+++  +      + +E A R  L+F D  +S R++ +
Sbjct: 123 VRKTIARALKSVPHAAGVNNHMGSLITRHPGHMTWLMEELAAREDLYFIDSRTSARSVAQ 182

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
            +A +  +   V  ++LD + D + I E+ +    +A+    AI +   + E+++++ + 
Sbjct: 183 QMAEEHGVDNAVRHVFLDPRRDTEVIAEQFERFVTLAQQGDGAIAIGHPYPETLDLLEEE 242

Query: 372 LQQEHVRDVSVVPLSCL 388
           L +   R V++VP S L
Sbjct: 243 LPRLRERGVALVPASEL 259


>gi|312898727|ref|ZP_07758116.1| divergent polysaccharide deacetylase [Megasphaera micronuciformis
           F0359]
 gi|310620158|gb|EFQ03729.1| divergent polysaccharide deacetylase [Megasphaera micronuciformis
           F0359]
          Length = 425

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/193 (19%), Positives = 85/193 (44%), Gaps = 13/193 (6%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           AR+A+V+   G S        N LP ++T A     +      +     G + I+ +PM+
Sbjct: 210 ARLAVVIDDCG-SNMEVLEGYNALPIHLTYAVMPFKSHTIDSAESGHNAGNKIIVHLPME 268

Query: 231 AFDESYNED-----DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
             +   +E+     D    KV  T  +L++++ Y++       G+ N++G+   ++    
Sbjct: 269 PLNTVSSEEIFISSDMGDKKVIATTNELIDQVPYAV-------GINNHQGSKSTADTRLM 321

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + +      RGL+F D  ++  ++    A  + +     +L++D+      I+E+++   
Sbjct: 322 KDVMSVLKSRGLVFLDSRTTAASVAEQTAASMGVGTTRNNLFIDNDPSVSAIKERIRQAG 381

Query: 346 EIARTTGQAIGVA 358
            +A   G A+ + 
Sbjct: 382 RLALKNGTAVTIG 394


>gi|51892007|ref|YP_074698.1| hypothetical protein STH869 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855696|dbj|BAD39854.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 252

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/222 (21%), Positives = 93/222 (41%), Gaps = 10/222 (4%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+  L     G +  + L P  +T A   +        +     G E IL +PM A 
Sbjct: 28  LAIVIDDLTTGAPGLEEMLRL-PYPLTFAILPDRPDAGALARRIAALGHEVILHLPMDAG 86

Query: 233 D---ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +   + Y      + +  + +QQL++    ++    G   + N+ G +   ++     + 
Sbjct: 87  EVDPQWYVGRPISSRQSDEEIQQLVSEWLAAVPEARG---MNNHMGTVATQDERVVRAVL 143

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   + G    D  ++   +    A ++ +P M   L+LD +   + +  +L  L E A 
Sbjct: 144 EVARRHGKYILDSMTTENTVVPRTAVEMGVPCMQRSLFLDHENGEEVVAAQLYKLAEWAE 203

Query: 350 TTGQAIG---VAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           T G AIG   V V  + +   +++ L +   R + +V LS L
Sbjct: 204 THGAAIGIGHVGVGREGTAAALAEVLPELEARGIRLVTLSQL 245


>gi|224417738|ref|ZP_03655744.1| putative periplasmic protein [Helicobacter canadensis MIT 98-5491]
 gi|253827082|ref|ZP_04869967.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313141280|ref|ZP_07803473.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|253510488|gb|EES89147.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130311|gb|EFR47928.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 367

 Score = 48.1 bits (113), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 80/177 (45%), Gaps = 26/177 (14%)

Query: 224 ILQIPMQAFDESYNE------DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           ++ +P++A +    E      DDS      QT+Q  +  ++      T    + N+ G+ 
Sbjct: 193 MVHLPLEALNFYQKEHLWLFSDDS-----KQTIQDRIQAIKKDFPNLTY---INNHTGSK 244

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPR---------NLTRVLAPKLNLPYMVADLYL 328
              N ++ + +     +  + F D  ++P+         N T+ L P  N P++  +++L
Sbjct: 245 FTQNLQAMQNLLTILNENNITFVDSRTTPKTKTALYYKNNPTKSLNPCQNTPFLERNVFL 304

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI---SQWLQQEHVRDVSV 382
           D+++D  KI + L    E A+  G AI +     E+I  +   S++LQ+  +  V +
Sbjct: 305 DNELDISKITQNLIKAIETAKIKGYAIAIGHPHKETILALKNASEYLQKSGIEAVYI 361


>gi|257460562|ref|ZP_05625663.1| divergent polysaccharide deacetylase family protein [Campylobacter
           gracilis RM3268]
 gi|257441893|gb|EEV17035.1| divergent polysaccharide deacetylase family protein [Campylobacter
           gracilis RM3268]
          Length = 401

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 90/198 (45%), Gaps = 24/198 (12%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAF------ASNGNSLDRWMKEAKKKGQE 222
           S A++AI++  +G  +   +  I  LP  +T +         +  SL R         + 
Sbjct: 185 SRAKLAIIIDDVGTDEQAQK--IAALPVRVTPSIFPPEYQRKDTRSLARGF-------EH 235

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQL---LNRLRYSLRRGTGYFGVMNYRGAMLL 279
             + +PM+A   S  +++S TL+ +   ++L   + +LR         F + N+ G+   
Sbjct: 236 YAIHLPMEA---SSAKNNSATLRASDNYEKLRGVIAKLRADF--PNAKF-INNHTGSKFT 289

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           +++ + + + +   + G LF D  +SP    +       + Y+  D++LD+Q     +R+
Sbjct: 290 ADERAMQNLLRAMNEHGFLFIDSRTSPATKAKAAMNGFGMRYVHRDVFLDNQNSVAAVRK 349

Query: 340 KLKGLEEIARTTGQAIGV 357
           KL+    +A+  G AI +
Sbjct: 350 KLREAVALAKKQGYAIAI 367


>gi|283787753|ref|YP_003367618.1| polysaccharide deacetylase [Citrobacter rodentium ICC168]
 gi|282951207|emb|CBG90900.1| putative polysaccharide deacetylase [Citrobacter rodentium ICC168]
          Length = 270

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 74/177 (41%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A   N         +A   G E ++ +PM    +   E D  TL+   +  ++
Sbjct: 1   MPDAISVAVLPNAPHAREMAAKAHSSGHEVLIHLPMAPLSKQPLEKD--TLRPEMSSDEI 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++ +     G+ N+ G+ + S+    + + +   +  L F D  +   +     
Sbjct: 59  ERIIREAVSKVPYAVGLNNHMGSAMTSSLFGMQKVMQALERYELYFLDSMTIGNSQAMRA 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     E+AR+ G AI +      ++ V+ Q
Sbjct: 119 ASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIELARSNGSAIAIGHPHPSTVRVLQQ 175


>gi|145630498|ref|ZP_01786278.1| hypothetical protein CGSHi22421_04483 [Haemophilus influenzae
           R3021]
 gi|144983888|gb|EDJ91330.1| hypothetical protein CGSHi22421_04483 [Haemophilus influenzae
           R3021]
          Length = 280

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPHARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  L  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGLRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRPNTIAVLQAGLR 227


>gi|300714671|ref|YP_003739474.1| conserved uncharacterized protein YigQ [Erwinia billingiae Eb661]
 gi|299060507|emb|CAX57614.1| conserved uncharacterized protein YigQ [Erwinia billingiae Eb661]
          Length = 302

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/208 (18%), Positives = 88/208 (42%), Gaps = 4/208 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
           C+  +G +++IV+   G       + + + P NI++A   N         +A + G E +
Sbjct: 12  CTAHAG-KLSIVIDDFGYRPKEENQVLQM-PKNISVAVLPNATHAREMATKAHQLGHEVL 69

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+   
Sbjct: 70  IHLPMAPLSKQPLEKD--TLRPDMSSSEIARIIREAVADVPFAVGLNNHMGSAMTSSLPG 127

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +        F D  +   + +   A   ++  +   ++LDD  +   IR++    
Sbjct: 128 MQKVMQVLDHYNFYFLDSMTIGNSQSTRAAAGTSVKVLKRRVFLDDTQNEADIRKQFTRA 187

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWL 372
             +A+  G AI +      ++ V+ + L
Sbjct: 188 VRLAQRDGSAIAIGHPHPTTVRVLQEML 215


>gi|319775305|ref|YP_004137793.1| hypothetical protein HICON_06450 [Haemophilus influenzae F3047]
 gi|317449896|emb|CBY86108.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 280

 Score = 47.8 bits (112), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PISAIKIEDGG--LHLGMSAAQVNDRVNTAKSIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFSDVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRQNTIAVLQAGLR 227


>gi|219870484|ref|YP_002474859.1| hypothetical protein HAPS_0219 [Haemophilus parasuis SH0165]
 gi|219690688|gb|ACL31911.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 281

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/232 (20%), Positives = 103/232 (44%), Gaps = 14/232 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++ IV+  +G  +     AI  LP  + +A   +         +AK++G+E 
Sbjct: 21  FAPLAYANKLVIVIDDIGY-RIKEDNAIYTLPKEVNVAIIPSAPYATARANKAKEQGREI 79

Query: 224 ILQIPMQAFDESYNEDDSYTL-----KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           ++ +PMQ   +   E  +  +     +V++ + Q   ++ Y++        + N+ G+  
Sbjct: 80  LIHLPMQPKVKQPIEAGALLVGMGESEVSELIHQAQQQVPYAI-------ALNNHMGSKA 132

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            ++K + + + K  +++GL F D  ++  ++    A    L  +   ++LD+      ++
Sbjct: 133 TADKTTMQHLMKALSQQGLGFLDSKTAGDSVAYQTAKAYGLNALERHIFLDNSDVFADVQ 192

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            + +   + AR  G AI +      SI V+ Q +      D+ +V LS L K
Sbjct: 193 RQFQHAVQYARKHGIAIMIGHPRKHSIAVLEQGIANLPA-DIQLVSLSSLWK 243


>gi|217967182|ref|YP_002352688.1| protein of unknown function DUF610 YibQ [Dictyoglomus turgidum DSM
           6724]
 gi|217336281|gb|ACK42074.1| protein of unknown function DUF610 YibQ [Dictyoglomus turgidum DSM
           6724]
          Length = 391

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/181 (22%), Positives = 86/181 (47%), Gaps = 16/181 (8%)

Query: 218 KKGQEAILQIPMQAFDESYNEDDSY----TLKVTQTVQQLLNRLRYSLRRGTGYFG---- 269
           ++G E ++ +PM++   +Y +D  Y     + V     ++ N +R  L+R    FG    
Sbjct: 202 ERGWEIMMHLPMESI--TYPKDAKYLVAEAIMVGMNEDEIDNIVRTHLKR----FGNIKV 255

Query: 270 --VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
             V N+ G+ +  + E+ E +   F K  L F D  +   ++   +A    +P +   L+
Sbjct: 256 SWVNNHMGSKVTKDPETMEKVINVFKKYNLAFLDSKTILGSVAYKMANSSGIPSLENMLF 315

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           +D + D +KIR +      +A++ G  + +     ++I+V+ +  ++    DV +V +S 
Sbjct: 316 IDHENDENKIRLRFLKAINMAKSKGWGVFILHLRPKTIKVLKELEKEGFFADVDLVKISD 375

Query: 388 L 388
           L
Sbjct: 376 L 376


>gi|194431299|ref|ZP_03063592.1| polysaccharide deacetylase family protein [Shigella dysenteriae
           1012]
 gi|194420754|gb|EDX36830.1| polysaccharide deacetylase family protein [Shigella dysenteriae
           1012]
 gi|320179953|gb|EFW54895.1| putative divergent polysaccharide deacetylase [Shigella boydii ATCC
           9905]
 gi|332084497|gb|EGI89692.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 155-74]
 gi|332084797|gb|EGI89980.1| divergent polysaccharide deacetylase family protein [Shigella
           boydii 5216-82]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/203 (18%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  A+  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|253701628|ref|YP_003022817.1| hypothetical protein GM21_3030 [Geobacter sp. M21]
 gi|251776478|gb|ACT19059.1| protein of unknown function DUF610 YibQ [Geobacter sp. M21]
          Length = 316

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 91/225 (40%), Gaps = 8/225 (3%)

Query: 155 TEVPAMDKNFCS--NASG-ARIAIVVSGLGIS--QTGTQRAINLLPANITLAFASNGNSL 209
            +VPA   +  +   A G  R+AI++  +G S  +  T ++I L    IT +   +    
Sbjct: 79  AQVPAPKPHAAALPKAHGPGRVAIIIDDMGSSMQELQTLQSIGL---PITYSIIPSLPRA 135

Query: 210 DRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
            +    A   G E ++ +PM+       + +S  L V     ++  R+     R     G
Sbjct: 136 RQVADSAHAAGAEVMVHMPMEPEGYPKQKMESIGLLVAMDDAEIAKRVSGYFSRVPHAVG 195

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
             N+ G+    + +  E       ++G+ F D  +SP ++    A  L +      ++LD
Sbjct: 196 ANNHMGSRFTQHGDKMEAALGVLKEKGVFFIDSRTSPASVGYRTARALGMKAGTRQVFLD 255

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
           +  D   I  +L     +AR  G AI +      ++  +  +L +
Sbjct: 256 NVQDEGAIGRQLFEAAAVARKRGGAIAICHPHPATLRALKAYLPE 300


>gi|146309788|ref|YP_001174862.1| protein of unknown function DUF610, YibQ [Enterobacter sp. 638]
 gi|145316664|gb|ABP58811.1| protein of unknown function DUF610, YibQ [Enterobacter sp. 638]
          Length = 314

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/209 (18%), Positives = 84/209 (40%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S     ++AIV+   G  +   +  +  +P  I++A   N         +A   G E 
Sbjct: 17  LASPVYAGKLAIVIDDFGY-RPHNENQVLAMPTAISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R +  +     G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIRDAYGKVPFAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +   +     +    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALERYNLYFLDSMTIGNSQALRASQGTGVKVIKRKVFLDDTQNDADIRAQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
             ++AR  G AI +      ++ V+ Q L
Sbjct: 194 AVQLARRNGSAIAIGHPHPSTVRVLQQML 222


>gi|323975163|gb|EGB70268.1| divergent polysaccharide deacetylase [Escherichia coli TW10509]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/203 (18%), Positives = 83/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  A+  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|313681712|ref|YP_004059450.1| hypothetical protein Sulku_0584 [Sulfuricurvum kujiense DSM 16994]
 gi|313154572|gb|ADR33250.1| protein of unknown function DUF610 YibQ [Sulfuricurvum kujiense DSM
           16994]
          Length = 344

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/155 (20%), Positives = 78/155 (50%), Gaps = 3/155 (1%)

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           AK++G   ++ +P++A   ++++++  TL++  T +++  RL    +       + N+ G
Sbjct: 177 AKQQGT-YMVHLPLEAV--AFHDEEPNTLRIGSTEEEIEKRLDALKQLYPNVHYINNHTG 233

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           +   S+  + + + +   K GL F D  +   +  R    K  + Y+  D++LDDQ    
Sbjct: 234 SKFTSDSAAMDKLIRIMKKEGLQFVDSRTIGTSKGREATEKHGMRYLTRDVFLDDQDGVG 293

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
            ++++++   E A+  G AI +     ++I+ + +
Sbjct: 294 NVKKQIRDAVEKAKRYGTAIAIGHPRKDTIQALKE 328


>gi|242237635|ref|YP_002985816.1| hypothetical protein Dd703_0176 [Dickeya dadantii Ech703]
 gi|242129692|gb|ACS83994.1| protein of unknown function DUF610 YibQ [Dickeya dadantii Ech703]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/179 (20%), Positives = 77/179 (43%), Gaps = 2/179 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A   N         +A  +G+E ++ +PM    +   E D  TL+   + +++
Sbjct: 46  MPVAISVAVLPNAPYARDMATKAHAQGREVLIHLPMAPMSKQPLERD--TLRPDMSSEEI 103

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              LR ++ +     G+ N+ G+ + ++    + + +      L F D  +   +     
Sbjct: 104 ARILRDAVGKVPYAVGLNNHMGSAMTASLPGMQKVMQAMTTYRLYFLDSMTIGSSQASRA 163

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           A    +  +   ++LDD  +   IR +     E+AR  G AI +      +I+V+ Q L
Sbjct: 164 AAGTGIRVLKRKVFLDDTQNTADIRRQFNRAVELARRDGVAIAIGHPHPTTIQVLQQML 222


>gi|170767013|ref|ZP_02901466.1| polysaccharide deacetylase family protein [Escherichia albertii
           TW07627]
 gi|170124451|gb|EDS93382.1| polysaccharide deacetylase family protein [Escherichia albertii
           TW07627]
          Length = 319

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 82/201 (40%), Gaps = 3/201 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  A+  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQ 370
             G  I +      ++ V+ Q
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQ 220


>gi|145628360|ref|ZP_01784161.1| hypothetical protein CGSHi22121_04945 [Haemophilus influenzae
           22.1-21]
 gi|144980135|gb|EDJ89794.1| hypothetical protein CGSHi22121_04945 [Haemophilus influenzae
           22.1-21]
          Length = 280

 Score = 47.4 bits (111), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 89/202 (44%), Gaps = 3/202 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +++   Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGGLHLGMSEA--QVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWL 372
            G AI +      +I V+   L
Sbjct: 205 HGSAIAIGHPRANTIAVLQAGL 226


>gi|68249351|ref|YP_248463.1| hypothetical protein NTHI0914 [Haemophilus influenzae 86-028NP]
 gi|145632108|ref|ZP_01787843.1| hypothetical protein CGSHi3655_06634 [Haemophilus influenzae 3655]
 gi|68057550|gb|AAX87803.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|144987015|gb|EDJ93545.1| hypothetical protein CGSHi3655_06634 [Haemophilus influenzae 3655]
          Length = 280

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRQNTIAVLQAGLR 227


>gi|149180684|ref|ZP_01859187.1| hypothetical protein BSG1_12141 [Bacillus sp. SG-1]
 gi|148851474|gb|EDL65621.1| hypothetical protein BSG1_12141 [Bacillus sp. SG-1]
          Length = 262

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/158 (18%), Positives = 75/158 (47%), Gaps = 1/158 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           ++IV+   G +  GT+  + L P ++T+A     ++       A + G E I+ +PM+  
Sbjct: 34  LSIVIDDFGNNMEGTKEMLEL-PISLTVAVMPLMDTTKEDADLAHRLGHEVIVHMPMEPL 92

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
               +      +    + +++  R+  ++       G+ ++ G+   +++    V+    
Sbjct: 93  KGKRSWLGPGAITTDLSNEEIRKRVEAAIDSVPFAVGMNHHMGSRASADERVMRVVLTVC 152

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            +RGL + D  ++P+++   LA ++ +P +  +++ DD
Sbjct: 153 KERGLYYLDSRTTPKSVIPELAEEIGVPLLENEMFFDD 190


>gi|260581569|ref|ZP_05849366.1| conserved hypothetical protein [Haemophilus influenzae NT127]
 gi|260095162|gb|EEW79053.1| conserved hypothetical protein [Haemophilus influenzae NT127]
          Length = 281

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 29  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 87

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 88  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 145

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 146 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 205

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 206 HGSAIAIGHPRQNTIAVLQAGLR 228


>gi|240949054|ref|ZP_04753405.1| hypothetical protein AM305_09111 [Actinobacillus minor NM305]
 gi|240296527|gb|EER47152.1| hypothetical protein AM305_09111 [Actinobacillus minor NM305]
          Length = 264

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 91/206 (44%), Gaps = 3/206 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G S    QR +  LP  I++A   +        + A  + ++ ++ +
Sbjct: 7   AQAAKLAIVIDDIGYSVREDQR-VYQLPKEISVAIIPSAPYAKVRAENAFAQKRDILIHL 65

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ    +    +   L V     +  + L  + +      G+ N+ G+   ++K +   
Sbjct: 66  PMQP-QNAQQAIEKPALLVGDDFAKAQSLLENARQHVPYAIGLNNHMGSGATADKATMRH 124

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
             +  A + L F D  + P   T+V A +  +  +   ++LDD  + + +  + +  +  
Sbjct: 125 FMQALAAQKLFFLDSKTGPSVATKVAA-EFGINALERHVFLDDSNEYNDVMHQFQQAKAY 183

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQ 373
           AR  G AI +      SI+V+ + L+
Sbjct: 184 ARKHGVAILIGHPRKNSIDVLEKELK 209


>gi|329122701|ref|ZP_08251279.1| divergent polysaccharide deacetylase superfamily protein
           [Haemophilus aegyptius ATCC 11116]
 gi|327472575|gb|EGF18005.1| divergent polysaccharide deacetylase superfamily protein
           [Haemophilus aegyptius ATCC 11116]
          Length = 280

 Score = 47.0 bits (110), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PISAIKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRPNTIAVLQAGLR 227


>gi|296100521|ref|YP_003610667.1| hypothetical protein ECL_00150 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295054980|gb|ADF59718.1| hypothetical protein ECL_00150 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 310

 Score = 46.6 bits (109), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 83/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +PA I++A   N         +A   G + ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHYENQVLAMPAAISVAVLPNAPHAREMATKAHNSGHQVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+   +  ++   +R +  +     G+ N+ G+ + S+      + 
Sbjct: 82  APISKQPLEKD--TLRPEMSSDEIDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYGMLKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +   +     A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSMTIGNSQAMRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G AI +      ++ V+ Q L
Sbjct: 200 RNGSAIAIGHPHPSTVRVLQQML 222


>gi|229844623|ref|ZP_04464762.1| hypothetical protein CGSHi6P18H1_03404 [Haemophilus influenzae
           6P18H1]
 gi|229812337|gb|EEP48027.1| hypothetical protein CGSHi6P18H1_03404 [Haemophilus influenzae
           6P18H1]
          Length = 280

 Score = 46.6 bits (109), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARVRNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PISAIKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   I+ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTVGKSVAGKVAKEQGVRSLDRHIFLDDSNEFADIQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGTAIAIGHPRPNTIAVLQAGLR 227


>gi|291287716|ref|YP_003504532.1| hypothetical protein Dacet_1812 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884876|gb|ADD68576.1| protein of unknown function DUF610 YibQ [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 399

 Score = 46.6 bits (109), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 93/223 (41%), Gaps = 10/223 (4%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IA V+   G S+   ++ +   P  +T+A   +     +  + A K G+   L  PMQ  
Sbjct: 181 IAFVIDDCGYSEELAEK-LAAFPYPMTMAIIPHTEYAKKTAEIAYKAGKVVFLHQPMQPL 239

Query: 233 DESYNEDDSYTLKV-----TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
             SY + D     V      + +Q  LN    SL  G    G  N+ G+ +  ++E  + 
Sbjct: 240 --SYPKTDPGKGAVLLNMPEKIIQTSLNSNVASL--GGKIDGFNNHMGSAITQDREKMKQ 295

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +FK   K    F D  +S   +         +   +   ++D++ D   IR K+    EI
Sbjct: 296 VFKVMKKYTDTFLDSYTSRDTVAFDQCKAEGMKCAINRKFIDNESDYSYIRSKIIEGAEI 355

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           ART G  I +    + ++  + + L +      ++VP++ L +
Sbjct: 356 ARTDGSVIMIGHLRESTVHALEKILPELEKAGYNIVPVTELTQ 398


>gi|157414912|ref|YP_001482168.1| hypothetical protein C8J_0592 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|157385876|gb|ABV52191.1| hypothetical protein C8J_0592 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|307747550|gb|ADN90820.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           M1]
          Length = 360

 Score = 46.6 bits (109), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +LN+PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++++   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQIQNAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKSVDLVYLS 355


>gi|320539186|ref|ZP_08038857.1| putative polysaccharide deacetylase [Serratia symbiotica str.
           Tucson]
 gi|320030824|gb|EFW12832.1| putative polysaccharide deacetylase [Serratia symbiotica str.
           Tucson]
          Length = 278

 Score = 46.6 bits (109), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 84/203 (41%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+  +G      + A+  +P  +++A   N          A  + +E ++ +PM
Sbjct: 23  AGKLSIVIDDVGY-HPHEENAVLQMPEAVSVAVLPNAPYARLMATRAHSQNREVLIHMPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
             F +   E D  TL+   + + +   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APFSKQPLEQD--TLQPDMSSENIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR +      +AR
Sbjct: 140 QALTSYRLYFLDSLTISNSQATRAAIGTGVKVIKRKVFLDDTANEADIRHQFNRAVALAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G AI +      +++V+ Q L
Sbjct: 200 RNGSAIAIGHPRPATVKVLQQML 222


>gi|145634834|ref|ZP_01790542.1| hypothetical protein CGSHiAA_04498 [Haemophilus influenzae PittAA]
 gi|145640840|ref|ZP_01796422.1| hypothetical protein CGSHiR3021_07222 [Haemophilus influenzae
           R3021]
 gi|148826600|ref|YP_001291353.1| hypothetical protein CGSHiEE_08325 [Haemophilus influenzae PittEE]
 gi|145268000|gb|EDK07996.1| hypothetical protein CGSHiAA_04498 [Haemophilus influenzae PittAA]
 gi|145274354|gb|EDK14218.1| hypothetical protein CGSHiR3021_07222 [Haemophilus influenzae
           22.4-21]
 gi|148716760|gb|ABQ98970.1| hypothetical protein CGSHiEE_08325 [Haemophilus influenzae PittEE]
 gi|309973749|gb|ADO96950.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 280

 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 88/202 (43%), Gaps = 3/202 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWL 372
            G AI +      +I V+   L
Sbjct: 205 HGSAIAIGHPRANTIAVLQAGL 226


>gi|223039675|ref|ZP_03609961.1| divergent polysaccharide deacetylase family [Campylobacter rectus
           RM3267]
 gi|222879058|gb|EEF14153.1| divergent polysaccharide deacetylase family [Campylobacter rectus
           RM3267]
          Length = 549

 Score = 46.2 bits (108), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/165 (20%), Positives = 77/165 (46%), Gaps = 3/165 (1%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQA    +   +  TL +    +++  +L+   R       + N+ G+   S+  
Sbjct: 387 MIHLPMQALG-GFKGAEIGTLTINDDYEKIAKKLQSIKRDFPDLKYINNHTGSRFTSDAA 445

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +      L+F D  ++        A K ++PY+  D++LD    +  +R++LK 
Sbjct: 446 AMDRLMRAVRDENLIFVDSKTTSPTKVYGAAKKYSMPYIARDVFLDHDGSKAAVRKQLKY 505

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             E+A+    AI +      ++EV+ +  +   +++V +V L  L
Sbjct: 506 AVELAKKRSYAIAIGHPHKNTLEVLRESAKL--LQEVEIVYLKDL 548


>gi|291288857|ref|YP_003505673.1| hypothetical protein Dacet_2967 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290886017|gb|ADD69717.1| protein of unknown function DUF610 YibQ [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 431

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 98/251 (39%), Gaps = 35/251 (13%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQT-GTQRAINLLPANIT-LAFASNGNSLDRWMK 214
           +P   K F      A++A+V+   G S +   Q A    PA    + F   G        
Sbjct: 195 IPPAKKTF-----KAKLAVVIDDCGYSMSLAKQLAALQYPATFAVIPFTPYGKETALL-- 247

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDD----SYTLKVTQTVQQLLNRLRYSLRRGTGYF-- 268
            A+K G+   L  PMQ    SY + D    +  L + +TV   + +  +       YF  
Sbjct: 248 -ARKAGKPVFLHFPMQP--RSYPKFDPGKGALFLNMPETVIAAVTKANFD------YFPI 298

Query: 269 ---GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
              G  N+ G+    ++E  E   KE +K    F D  +S   +   +  +  L     D
Sbjct: 299 KLDGANNHTGSAFTESREKMEQALKEISKYTPGFLDSHTSRATVAYDVCKETTLKCGRND 358

Query: 326 LYLDDQ--------VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
           ++LD++          R+ + + L    + A   G AI +     ++I V+    +Q   
Sbjct: 359 IFLDNEEPGLVTKSAKRNHVHDVLMQAAKKALANGSAIAIGHLRKDTISVLENSFRQIEE 418

Query: 378 RDVSVVPLSCL 388
             V +VP++ L
Sbjct: 419 MGVEIVPVTSL 429


>gi|297519266|ref|ZP_06937652.1| putative polysaccharide deacetylase [Escherichia coli OP50]
          Length = 319

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/208 (18%), Positives = 84/208 (40%), Gaps = 3/208 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A   ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPALAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWL 372
            ++AR  G  I +      ++ V+ Q +
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMV 222


>gi|188532247|ref|YP_001906044.1| Putative periplasmic protein of unknown function [Erwinia
           tasmaniensis Et1/99]
 gi|188027289|emb|CAO95132.1| Putative periplasmic protein of unknown function [Erwinia
           tasmaniensis Et1/99]
          Length = 310

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 85/209 (40%), Gaps = 3/209 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A    ++IV+   G   T  Q+ + + PA I++A   N         +A + G E 
Sbjct: 18  ITSPAWAGNLSIVIDDFGYRPTQEQQVLQM-PAAISVAVLPNAPHAREMATKAHQSGHEV 76

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R +        G+ N+ G+ + S+  
Sbjct: 77  LIHLPMAPLSKQPLEKD--TLRPDMSAEEIARIIREAAAAVPYAVGLNNHMGSAMTSSLP 134

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +  +     F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 135 GMQKVMQVLSHYNFYFLDSMTIGNSQASRAAAGTGVKVVKRRVFLDDSQNEADIRVQFAR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWL 372
              +A+  G AI +      ++ V+ Q L
Sbjct: 195 AVHLAQRDGSAIAIGHPHPSTVRVLQQML 223


>gi|261341775|ref|ZP_05969633.1| hypothetical protein ENTCAN_08255 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316144|gb|EFC55082.1| YibQ protein product [Enterobacter cancerogenus ATCC 35316]
          Length = 304

 Score = 46.2 bits (108), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/203 (18%), Positives = 83/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   N         +A   G + ++ +PM
Sbjct: 17  AGKLAIVIDDFGY-RPHYENQVLAMPSAISVAVLPNAPHAREMATKAHNSGHQVLIHLPM 75

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+   +  ++   +R +  +     G+ N+ G+ + S+      + 
Sbjct: 76  APLSKQPLEKD--TLRPEMSSDEIDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYGMLKVM 133

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +   +     A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 134 QSLERYNLYFLDSMTIGNSQAMRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQLAR 193

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G AI +      ++ V+ Q L
Sbjct: 194 RNGSAIAIGHPHPSTVRVLQQML 216


>gi|218562283|ref|YP_002344062.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|112359989|emb|CAL34778.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
          Length = 360

 Score = 46.2 bits (108), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 65/117 (55%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+ + +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMKKLYEALKNQNIFFVDSKTIGNSKANKIAKELSIPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLENAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|255321385|ref|ZP_05362545.1| ferric-uptake regulator [Campylobacter showae RM3277]
 gi|255301538|gb|EET80795.1| ferric-uptake regulator [Campylobacter showae RM3277]
          Length = 545

 Score = 45.8 bits (107), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 77/165 (46%), Gaps = 3/165 (1%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQA    +   +  TL V    +++  +L+   R       + N+ G+   S+  
Sbjct: 383 MIHLPMQALG-GFKGAEIGTLTVDDDYEKIAKKLQSIKRDFPNLKYINNHTGSRFTSDAA 441

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +      L+F D  ++        A K ++PY+  D++LD    +  +R++LK 
Sbjct: 442 AMDRMMRAVRDENLIFVDSKTTSPTKVYGAAKKYSMPYIARDVFLDHDGSKAAVRKQLKY 501

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             ++A+    AI +      ++EV+ +  +   +++V VV L  L
Sbjct: 502 AVKLAKNRSYAIAIGHPHKNTLEVLQESAKL--LQEVEVVYLKDL 544


>gi|319897746|ref|YP_004135943.1| hypothetical protein HIBPF15550 [Haemophilus influenzae F3031]
 gi|317433252|emb|CBY81627.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 89/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARVRNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PISAIKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGTAIAIGHPRPNTIAVLQAGLR 227


>gi|323166902|gb|EFZ52641.1| divergent polysaccharide deacetylase family protein [Shigella
           sonnei 53G]
          Length = 319

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPNNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|260579846|ref|ZP_05847676.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260093130|gb|EEW77063.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
          Length = 281

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 29  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 87

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 88  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 145

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 146 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 205

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 206 HGSAIAIGHPRPNTIAVLQAGLR 228


>gi|118475284|ref|YP_892284.1| putative periplasmic protein [Campylobacter fetus subsp. fetus
           82-40]
 gi|118414510|gb|ABK82930.1| putative periplasmic protein [Campylobacter fetus subsp. fetus
           82-40]
          Length = 387

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 79/162 (48%), Gaps = 3/162 (1%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +P++A     NE +  TL V  T  ++ NR+    ++      + N+ G+   S+  
Sbjct: 221 MVHLPLEAIFFKKNEQN--TLNVGDTKDKIENRISTIKKQFGNVSYINNHTGSKFTSDYS 278

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           S +++ K      +LF D  +S  +  + +  ++ L Y+  D+++D+      I ++L+ 
Sbjct: 279 SMKMLLKSMKNHNILFVDSLTSKGSKAKQVTKEMGLKYVFRDVFIDNDQSSVAIFKQLEI 338

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
             + A+  G AI +   +  + E I +  ++  ++DV VV L
Sbjct: 339 AIKKAKKNGFAIAIGHPYKVTFETI-KVAKKTILKDVEVVYL 379


>gi|322418639|ref|YP_004197862.1| hypothetical protein GM18_1111 [Geobacter sp. M18]
 gi|320125026|gb|ADW12586.1| protein of unknown function DUF610 YibQ [Geobacter sp. M18]
          Length = 318

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/151 (19%), Positives = 65/151 (43%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+       + +S  + V     ++ +R++   R      G  N+ G+    + +
Sbjct: 152 MIHMPMEPEGYPKQKLESIGVLVAMNDGEIADRIKSYFRTVPYAVGANNHMGSRFTQHAD 211

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             +V+ +   ++GL F D  +SP ++    A  + L      ++LD+  D   I  +L  
Sbjct: 212 KMQVVLQVLKEKGLFFVDSKTSPASVGYSEARGMGLKCASRQVFLDNVQDEAAIGRQLAQ 271

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
              IAR  G AI +      ++  +  ++ +
Sbjct: 272 AAAIARKKGAAIAICHPHPATLRALKLYMPE 302


>gi|145638449|ref|ZP_01794059.1| hypothetical protein CGSHiII_06744 [Haemophilus influenzae PittII]
 gi|145272778|gb|EDK12685.1| hypothetical protein CGSHiII_06744 [Haemophilus influenzae PittII]
 gi|309751584|gb|ADO81568.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRQNTIAVLQAGLR 227


>gi|48243737|gb|AAT40842.1| hypothetical protein [Haemophilus influenzae]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRQNTIAVLQAGLR 227


>gi|327482780|gb|AEA86090.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 263

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/210 (17%), Positives = 81/210 (38%), Gaps = 10/210 (4%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           D+   +  S   + +++  LG +    +R + L P  + LA   +        ++A + G
Sbjct: 27  DRRVAARPS---LTLIIDDLGQNPARDRRVLQL-PGPVALAILPDTRHAAELAEQAHRAG 82

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           +  +L +PM      +                        +R      G+ N+ G+ +  
Sbjct: 83  KTVMLHMPMAPAGGRFAWHPQLPHDELARRLDAALAAVPHVR------GLNNHMGSAMTE 136

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
             ++   +  E  +R L F D  +SPR +    A +  L  +  D++LDD      + E+
Sbjct: 137 QPQAMTWLMGELQRRHLFFLDSRTSPRTVAAASAQRTALASLSRDIFLDDDPSPAAVAER 196

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
            +    +AR  G  + +    + ++ ++ +
Sbjct: 197 FQAAIALARKQGSVVIIGHPHESTLALLER 226


>gi|283956047|ref|ZP_06373534.1| LOW QUALITY PROTEIN: hypothetical protein C1336_000100100
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792367|gb|EFC31149.1| LOW QUALITY PROTEIN: hypothetical protein C1336_000100100
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 360

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLQSAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|30995399|ref|NP_438914.2| hypothetical protein HI0755 [Haemophilus influenzae Rd KW20]
 gi|1176306|sp|P44863|Y755_HAEIN RecName: Full=Uncharacterized protein HI_0755; Flags: Precursor
          Length = 280

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRPNTIAVLQAGLR 227


>gi|88597070|ref|ZP_01100306.1| conserved domain protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88190759|gb|EAQ94732.1| conserved domain protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|284925893|gb|ADC28245.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           IA3902]
          Length = 360

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|301169472|emb|CBW29073.1| predicted polysaccharide deacetylase [Haemophilus influenzae 10810]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRPNTIAVLQAGLR 227


>gi|145636690|ref|ZP_01792357.1| hypothetical protein CGSHiHH_03778 [Haemophilus influenzae PittHH]
 gi|229845802|ref|ZP_04465914.1| hypothetical protein CGSHi7P49H1_03098 [Haemophilus influenzae
           7P49H1]
 gi|145270216|gb|EDK10152.1| hypothetical protein CGSHiHH_03778 [Haemophilus influenzae PittHH]
 gi|229810806|gb|EEP46523.1| hypothetical protein CGSHi7P49H1_03098 [Haemophilus influenzae
           7P49H1]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 28  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 87  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 145 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 205 HGSAIAIGHPRPNTIAVLQAGLR 227


>gi|148827945|ref|YP_001292698.1| hypothetical protein CGSHiGG_07270 [Haemophilus influenzae PittGG]
 gi|148719187|gb|ABR00315.1| hypothetical protein CGSHiGG_07270 [Haemophilus influenzae PittGG]
          Length = 280

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/202 (19%), Positives = 88/202 (43%), Gaps = 3/202 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    A+  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAVFAMPREISVAIIPAAPYARVRNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  ISAIKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQ 373
           G AI +      +I V+   L+
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLR 227


>gi|312170645|emb|CBX78908.1| Uncharacterized protein yibQ precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 308

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 83/201 (41%), Gaps = 3/201 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G      Q+ + + PA I++A   +         +A + G E ++ +PM  
Sbjct: 24  KLSIVIDDFGYRPAQEQQVLQM-PAAISVAVLPHAPHAREMATKAHQSGHEVLIHLPMAP 82

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E D  TL+   + +++   +R +        G+ N+ G+ + S+    + + + 
Sbjct: 83  LSKQPLEKD--TLRPDMSTEEIGRIIREAAATVPYAVGLNNHMGSAMTSSLPGMQKVMRV 140

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
                  F D  +   +     A   ++  +   ++LDD  +   IR +      +A+  
Sbjct: 141 LNHYQFYFLDSMTIGNSQATRAAAGTSVKVVKRRVFLDDSQNEADIRVQFTRAVRLAQRD 200

Query: 352 GQAIGVAVAFDESIEVISQWL 372
           G AI +      ++ V+ Q L
Sbjct: 201 GSAIAIGHPHPSTVRVLQQML 221


>gi|26250262|ref|NP_756302.1| hypothetical protein c4440 [Escherichia coli CFT073]
 gi|91213132|ref|YP_543118.1| hypothetical protein UTI89_C4159 [Escherichia coli UTI89]
 gi|218560689|ref|YP_002393602.1| polysaccharide deacetylase [Escherichia coli S88]
 gi|227883784|ref|ZP_04001589.1| divergent polysaccharide deacetylase [Escherichia coli 83972]
 gi|237703387|ref|ZP_04533868.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300984983|ref|ZP_07177235.1| divergent polysaccharide deacetylase [Escherichia coli MS 45-1]
 gi|301047406|ref|ZP_07194486.1| divergent polysaccharide deacetylase [Escherichia coli MS 185-1]
 gi|26110691|gb|AAN82876.1|AE016768_294 Hypothetical protein yibQ precursor [Escherichia coli CFT073]
 gi|91074706|gb|ABE09587.1| hypothetical protein YibQ precursor [Escherichia coli UTI89]
 gi|218367458|emb|CAR05240.1| putative polysaccharide deacetylase [Escherichia coli S88]
 gi|226902651|gb|EEH88910.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227839062|gb|EEJ49528.1| divergent polysaccharide deacetylase [Escherichia coli 83972]
 gi|294494032|gb|ADE92788.1| polysaccharide deacetylase family protein [Escherichia coli
           IHE3034]
 gi|300300680|gb|EFJ57065.1| divergent polysaccharide deacetylase [Escherichia coli MS 185-1]
 gi|300408263|gb|EFJ91801.1| divergent polysaccharide deacetylase [Escherichia coli MS 45-1]
 gi|307555716|gb|ADN48491.1| hypothetical protein YibQ precursor [Escherichia coli ABU 83972]
 gi|307628691|gb|ADN72995.1| putative polysaccharide deacetylase [Escherichia coli UM146]
 gi|315285352|gb|EFU44797.1| divergent polysaccharide deacetylase [Escherichia coli MS 110-3]
 gi|315292992|gb|EFU52344.1| divergent polysaccharide deacetylase [Escherichia coli MS 153-1]
 gi|323949856|gb|EGB45740.1| divergent polysaccharide deacetylase [Escherichia coli H252]
 gi|323954843|gb|EGB50623.1| divergent polysaccharide deacetylase [Escherichia coli H263]
          Length = 319

 Score = 45.8 bits (107), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRMQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|320193877|gb|EFW68510.1| putative divergent polysaccharide deacetylase [Escherichia coli
           WV_060327]
          Length = 319

 Score = 45.8 bits (107), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRMQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|315930930|gb|EFV09909.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 360

 Score = 45.8 bits (107), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|121613073|ref|YP_001000334.1| hypothetical protein CJJ81176_0661 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005280|ref|ZP_02271038.1| hypothetical protein Cjejjejuni_03335 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87250269|gb|EAQ73227.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           81-176]
          Length = 360

 Score = 45.8 bits (107), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|1074506|pir||C64158 hypothetical protein HI0755 - Haemophilus influenzae (strain Rd
           KW20)
          Length = 284

 Score = 45.8 bits (107), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 88/203 (43%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           +++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ
Sbjct: 32  SKLAIVIDDVGY-HLKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQ 90

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +  
Sbjct: 91  PVSAVKIEDGG--LHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMT 148

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR 
Sbjct: 149 ALQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARK 208

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      +I V+   L+
Sbjct: 209 HGSAIAIGHPRPNTIAVLQAGLR 231


>gi|86153389|ref|ZP_01071593.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85843115|gb|EAQ60326.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 360

 Score = 45.8 bits (107), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|293413051|ref|ZP_06655719.1| yibQ protein [Escherichia coli B354]
 gi|331675098|ref|ZP_08375855.1| YibQ protein product [Escherichia coli TA280]
 gi|291468698|gb|EFF11191.1| yibQ protein [Escherichia coli B354]
 gi|331068007|gb|EGI39405.1| YibQ protein product [Escherichia coli TA280]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|218707251|ref|YP_002414770.1| putative polysaccharide deacetylase [Escherichia coli UMN026]
 gi|293407240|ref|ZP_06651164.1| yibQ protein [Escherichia coli FVEC1412]
 gi|298382986|ref|ZP_06992581.1| yibQ protein [Escherichia coli FVEC1302]
 gi|300898550|ref|ZP_07116882.1| divergent polysaccharide deacetylase [Escherichia coli MS 198-1]
 gi|218434348|emb|CAR15272.1| putative polysaccharide deacetylase [Escherichia coli UMN026]
 gi|284923650|emb|CBG36747.1| putative polysaccharide deacetylase [Escherichia coli 042]
 gi|291426051|gb|EFE99085.1| yibQ protein [Escherichia coli FVEC1412]
 gi|298276822|gb|EFI18340.1| yibQ protein [Escherichia coli FVEC1302]
 gi|300357770|gb|EFJ73640.1| divergent polysaccharide deacetylase [Escherichia coli MS 198-1]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|331685279|ref|ZP_08385865.1| YibQ protein product [Escherichia coli H299]
 gi|331077650|gb|EGI48862.1| YibQ protein product [Escherichia coli H299]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|57236946|ref|YP_178747.1| hypothetical protein CJE0736 [Campylobacter jejuni RM1221]
 gi|205355483|ref|ZP_03222254.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|57165750|gb|AAW34529.1| conserved domain protein [Campylobacter jejuni RM1221]
 gi|205346717|gb|EDZ33349.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315058047|gb|ADT72376.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           S3]
 gi|315926751|gb|EFV06125.1| divergent polysaccharide deacetylase family protein [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 360

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +LN+PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++ +  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLTQKKGFVIAIGHPRKNTFKALEQ--SKDLLKSVDLVYLS 355


>gi|292486586|ref|YP_003529454.1| hypothetical protein EAMY_0096 [Erwinia amylovora CFBP1430]
 gi|292897823|ref|YP_003537192.1| exported polysaccharide deacetylase [Erwinia amylovora ATCC 49946]
 gi|291197671|emb|CBJ44766.1| putative exported polysaccharide deacetylase [Erwinia amylovora
           ATCC 49946]
 gi|291552001|emb|CBA19038.1| Uncharacterized protein yibQ precursor [Erwinia amylovora CFBP1430]
          Length = 308

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 83/201 (41%), Gaps = 3/201 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G      Q+ + + PA I++A   +         +A + G E ++ +PM  
Sbjct: 24  KLSIVIDDFGYRPAQEQQVLQM-PAAISVAVLPHAPHAREMATKAHQSGHEVLIHLPMAP 82

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E D  TL+   + +++   +R +        G+ N+ G+ + S+    + + + 
Sbjct: 83  LSKQPLEKD--TLRPDMSTEEIGRIIREAAAAVPYAVGLNNHMGSAMTSSLPGMQKVMRV 140

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
                  F D  +   +     A   ++  +   ++LDD  +   IR +      +A+  
Sbjct: 141 LNHYQFYFLDSMTIGNSQATRAAAGTSVKVVKRRVFLDDSQNEADIRVQFTRAVRLAQRD 200

Query: 352 GQAIGVAVAFDESIEVISQWL 372
           G AI +      ++ V+ Q L
Sbjct: 201 GSAIAIGHPHPSTVRVLQQML 221


>gi|260857988|ref|YP_003231879.1| putative polysaccharide deacetylase [Escherichia coli O26:H11 str.
           11368]
 gi|257756637|dbj|BAI28139.1| predicted polysaccharide deacetylase [Escherichia coli O26:H11 str.
           11368]
 gi|323155268|gb|EFZ41451.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli EPECa14]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 RALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|324111944|gb|EGC05924.1| divergent polysaccharide deacetylase [Escherichia fergusonii B253]
          Length = 318

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|281180660|dbj|BAI56990.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/201 (17%), Positives = 81/201 (40%), Gaps = 3/201 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQ 370
             G  I +      ++ V+ Q
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQ 220


>gi|148926620|ref|ZP_01810301.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|145845139|gb|EDK22234.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
          Length = 366

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 63/117 (53%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +LN+PY+  D++LD
Sbjct: 247 INNHTGSLFTSNEEAMRKLYEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLD 306

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++ +  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 307 NEDDVNYVKKQLESAVKLTQKKGFVIAIGHPRKNTFKALEQ--SKDLLKSVDLVYLS 361


>gi|86151591|ref|ZP_01069805.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315124148|ref|YP_004066152.1| hypothetical protein ICDCCJ07001_579 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85841220|gb|EAQ58468.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315017870|gb|ADT65963.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 360

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELSIPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|320535663|ref|ZP_08035755.1| divergent polysaccharide deacetylase [Treponema phagedenis F0421]
 gi|320147491|gb|EFW39015.1| divergent polysaccharide deacetylase [Treponema phagedenis F0421]
          Length = 455

 Score = 45.4 bits (106), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/142 (20%), Positives = 67/142 (47%), Gaps = 1/142 (0%)

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           G+E IL  PMQA + + N      +K   T  Q+   L  ++       G+ N+ G+++ 
Sbjct: 280 GKECILHQPMQAINPNVNPGQG-AIKPGMTAAQIREILNKNIEELWPIAGMNNHEGSLIT 338

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           +++ + + +    A++ + F D  ++   +   +A + N+      +++D+  +R  +  
Sbjct: 339 ADENAMQAVLDTVAEKHIYFLDSRTNVHTVVPRIAKERNMVIWERSVFIDNDKNRKAMEN 398

Query: 340 KLKGLEEIARTTGQAIGVAVAF 361
           ++K   +IA   G +I +   F
Sbjct: 399 EIKKGLKIAEQRGCSIMIGHVF 420


>gi|165976247|ref|YP_001651840.1| hypothetical protein APJL_0838 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165876348|gb|ABY69396.1| hypothetical protein APJL_0838 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 226

 Score = 45.4 bits (106), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 79/160 (49%), Gaps = 4/160 (2%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY-FGVMN 272
           ++A ++ ++ ++ +PMQ  +  +   +S  L V  + + +  RL  + R    Y  G+ N
Sbjct: 15  QKAYEQKRDVLIHLPMQPKNR-HQPIESGALMVGASKENVA-RLIQAARNQVPYAIGLNN 72

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+   +++++ E +  E +K+ L F D  + P    +V A +L +  +  +L+LDD  
Sbjct: 73  HMGSGATADRQTMEHLMTELSKQQLFFLDSKTGPSVAAKV-ARELGVNALERNLFLDDND 131

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
              +++ +       AR  G AI +      SIEV+ + L
Sbjct: 132 ALHEVQNQFHLALHYARKHGSAILIGHPRKNSIEVLEKGL 171


>gi|218550892|ref|YP_002384683.1| polysaccharide deacetylase [Escherichia fergusonii ATCC 35469]
 gi|218358433|emb|CAQ91080.1| putative polysaccharide deacetylase [Escherichia fergusonii ATCC
           35469]
 gi|325499163|gb|EGC97022.1| polysaccharide deacetylase [Escherichia fergusonii ECD227]
          Length = 318

 Score = 45.4 bits (106), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|170683133|ref|YP_001745916.1| polysaccharide deacetylase family protein [Escherichia coli
           SMS-3-5]
 gi|170520851|gb|ACB19029.1| polysaccharide deacetylase family protein [Escherichia coli
           SMS-3-5]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|332997808|gb|EGK17419.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-272]
 gi|333013340|gb|EGK32712.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-227]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 HNGSTIAIGHPHPSTVRVLQQMV 222


>gi|110643858|ref|YP_671588.1| hypothetical protein ECP_3715 [Escherichia coli 536]
 gi|191170375|ref|ZP_03031928.1| polysaccharide deacetylase family protein [Escherichia coli F11]
 gi|215488894|ref|YP_002331325.1| predicted polysaccharide deacetylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218691901|ref|YP_002400113.1| putative polysaccharide deacetylase [Escherichia coli ED1a]
 gi|218702383|ref|YP_002410012.1| putative polysaccharide deacetylase [Escherichia coli IAI39]
 gi|301018946|ref|ZP_07183169.1| divergent polysaccharide deacetylase [Escherichia coli MS 69-1]
 gi|306816035|ref|ZP_07450173.1| putative polysaccharide deacetylase [Escherichia coli NC101]
 gi|312968044|ref|ZP_07782255.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 2362-75]
 gi|331649432|ref|ZP_08350518.1| YibQ protein product [Escherichia coli M605]
 gi|331665242|ref|ZP_08366143.1| YibQ protein product [Escherichia coli TA143]
 gi|110345450|gb|ABG71687.1| hypothetical protein YibQ precursor [Escherichia coli 536]
 gi|190909183|gb|EDV68769.1| polysaccharide deacetylase family protein [Escherichia coli F11]
 gi|215266966|emb|CAS11411.1| predicted polysaccharide deacetylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218372369|emb|CAR20243.1| putative polysaccharide deacetylase [Escherichia coli IAI39]
 gi|218429465|emb|CAR10430.2| putative polysaccharide deacetylase [Escherichia coli ED1a]
 gi|222035325|emb|CAP78070.1| Uncharacterized protein yibQ [Escherichia coli LF82]
 gi|300399440|gb|EFJ82978.1| divergent polysaccharide deacetylase [Escherichia coli MS 69-1]
 gi|305850431|gb|EFM50888.1| putative polysaccharide deacetylase [Escherichia coli NC101]
 gi|312287303|gb|EFR15212.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 2362-75]
 gi|312948178|gb|ADR29005.1| putative polysaccharide deacetylase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315297051|gb|EFU56331.1| divergent polysaccharide deacetylase [Escherichia coli MS 16-3]
 gi|323189343|gb|EFZ74625.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli RN587/1]
 gi|324008122|gb|EGB77341.1| divergent polysaccharide deacetylase [Escherichia coli MS 57-2]
 gi|324012623|gb|EGB81842.1| divergent polysaccharide deacetylase [Escherichia coli MS 60-1]
 gi|330909679|gb|EGH38193.1| putative divergent polysaccharide deacetylase [Escherichia coli
           AA86]
 gi|331041930|gb|EGI14074.1| YibQ protein product [Escherichia coli M605]
 gi|331057752|gb|EGI29738.1| YibQ protein product [Escherichia coli TA143]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|188493391|ref|ZP_03000661.1| divergent polysaccharide deacetylase [Escherichia coli 53638]
 gi|218697338|ref|YP_002405005.1| putative polysaccharide deacetylase [Escherichia coli 55989]
 gi|293417079|ref|ZP_06659706.1| hypothetical protein ECDG_04229 [Escherichia coli B185]
 gi|293463941|ref|ZP_06664355.1| hypothetical protein ECCG_04022 [Escherichia coli B088]
 gi|309784406|ref|ZP_07679045.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 1617]
 gi|188488590|gb|EDU63693.1| divergent polysaccharide deacetylase [Escherichia coli 53638]
 gi|218354070|emb|CAV00606.1| putative polysaccharide deacetylase [Escherichia coli 55989]
 gi|291321573|gb|EFE61009.1| hypothetical protein ECCG_04022 [Escherichia coli B088]
 gi|291431110|gb|EFF04103.1| hypothetical protein ECDG_04229 [Escherichia coli B185]
 gi|308927913|gb|EFP73381.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 1617]
 gi|320201358|gb|EFW75939.1| putative divergent polysaccharide deacetylase [Escherichia coli
           EC4100B]
 gi|323934840|gb|EGB31222.1| divergent polysaccharide deacetylase [Escherichia coli E1520]
 gi|324116044|gb|EGC09970.1| divergent polysaccharide deacetylase [Escherichia coli E1167]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|256021379|ref|ZP_05435244.1| putative polysaccharide deacetylase [Shigella sp. D9]
 gi|332282613|ref|ZP_08395026.1| polysaccharide deacetylase [Shigella sp. D9]
 gi|332104965|gb|EGJ08311.1| polysaccharide deacetylase [Shigella sp. D9]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|300939215|ref|ZP_07153896.1| divergent polysaccharide deacetylase [Escherichia coli MS 21-1]
 gi|300455896|gb|EFK19389.1| divergent polysaccharide deacetylase [Escherichia coli MS 21-1]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|323173207|gb|EFZ58836.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli LT-68]
          Length = 319

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + + + P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVLEM-PSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|291086413|ref|ZP_06571498.1| YibQ protein [Citrobacter youngae ATCC 29220]
 gi|291068178|gb|EFE06287.1| YibQ protein [Citrobacter youngae ATCC 29220]
          Length = 247

 Score = 45.4 bits (106), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/158 (20%), Positives = 68/158 (43%), Gaps = 2/158 (1%)

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E D  TL+   + +++   +R ++ +     G+ N+ 
Sbjct: 4   KAHNSGHEVLIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIRDAVSKVPNAVGLNNHM 61

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + S+    + + +   +  L F D  +   +     A    +  +   ++LDD  + 
Sbjct: 62  GSAMTSSLFGMQKVMQALERYDLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNE 121

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
             IR +     E+AR  G AI +      ++ V+ Q L
Sbjct: 122 ADIRRQFNRAVELARRNGSAIAIGHPHPSTVRVLQQML 159


>gi|149376054|ref|ZP_01893820.1| hypothetical protein MDG893_03710 [Marinobacter algicola DG893]
 gi|149359691|gb|EDM48149.1| hypothetical protein MDG893_03710 [Marinobacter algicola DG893]
          Length = 269

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 96/223 (43%), Gaps = 17/223 (7%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAI++  +G +    +R I L    ITLAF        R  + A +K +E +L  PM   
Sbjct: 30  IAIIIDDMGHNLVEGERLIAL-EQPITLAFLPYRRYTTRLAELAHRKHKEIMLHAPMANT 88

Query: 233 DE------SYNED-DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
                     N D D  ++  T         LR +L+      GV N+ G++L    +  
Sbjct: 89  RNIGLGPGGLNPDMDQNSIATT---------LRRALQSIPHVQGVNNHMGSLLTQQLQPM 139

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + +  E     + F D  +   ++   +A    +P +  D++LD +   + + ++ + L 
Sbjct: 140 DWVMSELDHYPVYFVDSRTIASSIAGEVAAAYRIPTLTRDVFLDHEQTEEFVDQQFELLI 199

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           + A+  G AIG+      +++ + + L +   + +++  +S +
Sbjct: 200 KRAKENGSAIGIGHPHKVTVDYLEKRLPELDEQGIAIATVSGV 242


>gi|269140804|ref|YP_003297505.1| hypothetical protein ETAE_3463 [Edwardsiella tarda EIB202]
 gi|267986465|gb|ACY86294.1| hypothetical protein ETAE_3463 [Edwardsiella tarda EIB202]
 gi|304560564|gb|ADM43228.1| Putative periplasmic protein [Edwardsiella tarda FL6-60]
          Length = 309

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 85/204 (41%), Gaps = 3/204 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  +T+A   N          A  +G+E ++ +PM    +   E D  TL+ T +  ++
Sbjct: 46  MPLPVTIAVLPNAPHAREMALRAHAQGREILIHLPMAPISKQPLERD--TLQPTMSEAEI 103

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF-DDGSSPRNLTRV 312
              +R ++       G+ N+ G+ + S+    + + +   +   L+F D  +   +    
Sbjct: 104 QRIIRQAVGNVPYAVGMNNHMGSAMTSSLSGMQKVMRALEQYHFLYFLDSMTIGHSQVSN 163

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
            A    +  +   ++LDD  +   IR +      +AR  G AI +      ++ V+ Q L
Sbjct: 164 AALGTGIKVIKRKVFLDDAQNESAIRTQFNRAITLARRNGSAIAIGHPHPATVRVLQQML 223

Query: 373 QQEHVRDVSVVPLSCLAKLSSPSS 396
           +      V V P + L + + P S
Sbjct: 224 RTLPPDIVLVRPSALLNEATRPDS 247


>gi|146284395|ref|YP_001174548.1| hypothetical protein PST_4083 [Pseudomonas stutzeri A1501]
 gi|145572600|gb|ABP81706.1| putative exported protein [Pseudomonas stutzeri A1501]
          Length = 263

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/216 (17%), Positives = 82/216 (37%), Gaps = 22/216 (10%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           D+   +  S   + +++  LG +    +R + L P  + LA            ++A + G
Sbjct: 27  DRRVAARPS---LTLIIDDLGQNPARDRRVLQL-PGPVALAILPGTRHAAELAEQAHRAG 82

Query: 221 QEAILQIPMQ------AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +  +L +PM       A+      D+               R            G+ N+ 
Sbjct: 83  KTVMLHMPMAPAGGRFAWHPQLPHDELARRLDAALAAVPHVR------------GLNNHM 130

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ +    ++   +  E  +R L F D  +SPR +    A +  L  +  D++LDD    
Sbjct: 131 GSAMTEQPQAMTWLMGELQRRHLFFLDSRTSPRTVAAASAQRTALASLSRDIFLDDDPSP 190

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
             + E+ +    +AR  G  + +    + ++ ++ +
Sbjct: 191 AAVAERFQAAIALARKQGSVVIIGHPHESTLALLER 226


>gi|331659937|ref|ZP_08360875.1| YibQ protein product [Escherichia coli TA206]
 gi|331053152|gb|EGI25185.1| YibQ protein product [Escherichia coli TA206]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|332996160|gb|EGK15787.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri VA-6]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|323965881|gb|EGB61329.1| divergent polysaccharide deacetylase [Escherichia coli M863]
 gi|327250739|gb|EGE62441.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli STEC_7v]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|305433166|ref|ZP_07402322.1| conserved hypothetical protein [Campylobacter coli JV20]
 gi|304443867|gb|EFM36524.1| conserved hypothetical protein [Campylobacter coli JV20]
          Length = 343

 Score = 45.1 bits (105), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 116/246 (47%), Gaps = 16/246 (6%)

Query: 144 LLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLG-ISQTGTQRAINL--LPANITL 200
           L+ +  + +E+     M+    S    AR+AI++  +  ISQ    +A+ L  +P+    
Sbjct: 106 LVVEQNLSKEENLTKDMN---LSKTKQARLAIIIDDMANISQVRALQALKLKLIPS---- 158

Query: 201 AFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYS 260
            F  + N +D    +   K    ++ +P+ A + +  E D  TL  + + +++  +++  
Sbjct: 159 FFPPDKNHID--TPKLALKFDFYMVHLPLAAMNYTKPELD--TLNPSDSEKRIFKKIQQV 214

Query: 261 LRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLP 320
            +       + N+ G++  S++++ + ++K F K  L+F D  +   +    +A  L   
Sbjct: 215 KKDFKDLKFINNHTGSLFTSDEKAMKKLYKAFEKEELIFVDSKTIASSKAPKVAKALGQI 274

Query: 321 YMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDV 380
           Y+  D++LD++ D   I+ +L     +A+  G AI +      + + + Q   ++ ++ V
Sbjct: 275 YIQRDVFLDNRDDVAYIKNQLIEAVRLAKQKGFAIAIGHPRKNTFKALEQ--SKDLLKSV 332

Query: 381 SVVPLS 386
            +V LS
Sbjct: 333 ELVYLS 338


>gi|260870347|ref|YP_003236749.1| putative polysaccharide deacetylase [Escherichia coli O111:H- str.
           11128]
 gi|257766703|dbj|BAI38198.1| predicted polysaccharide deacetylase [Escherichia coli O111:H- str.
           11128]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|86149913|ref|ZP_01068142.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85839731|gb|EAQ56991.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
          Length = 360

 Score = 45.1 bits (105), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 64/117 (54%), Gaps = 2/117 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +L++PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEVLKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           ++ D + ++++L+   ++A+  G  I +      + + + Q   ++ ++ V +V LS
Sbjct: 301 NEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALEQ--SKDLLKGVDLVYLS 355


>gi|168766036|ref|ZP_02791043.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|189364563|gb|EDU82982.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4486]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|38704183|ref|NP_312519.2| hypothetical protein ECs4492 [Escherichia coli O157:H7 str. Sakai]
 gi|157157521|ref|YP_001465097.1| polysaccharide deacetylase family protein [Escherichia coli
           E24377A]
 gi|157163098|ref|YP_001460416.1| polysaccharide deacetylase family protein [Escherichia coli HS]
 gi|168746834|ref|ZP_02771856.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|168753440|ref|ZP_02778447.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|168759714|ref|ZP_02784721.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|168772418|ref|ZP_02797425.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|168779772|ref|ZP_02804779.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|168785494|ref|ZP_02810501.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|168797460|ref|ZP_02822467.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|170018153|ref|YP_001723107.1| protein of unknown function DUF610 YibQ [Escherichia coli ATCC
           8739]
 gi|191168137|ref|ZP_03029934.1| polysaccharide deacetylase family protein [Escherichia coli B7A]
 gi|193068550|ref|ZP_03049512.1| polysaccharide deacetylase family protein [Escherichia coli
           E110019]
 gi|208807566|ref|ZP_03249903.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208814455|ref|ZP_03255784.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208820448|ref|ZP_03260768.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209399753|ref|YP_002273096.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209921088|ref|YP_002295172.1| hypothetical protein ECSE_3897 [Escherichia coli SE11]
 gi|217325442|ref|ZP_03441526.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|253771543|ref|YP_003034374.1| hypothetical protein ECBD_0111 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163544|ref|YP_003046652.1| putative polysaccharide deacetylase [Escherichia coli B str.
           REL606]
 gi|254795572|ref|YP_003080409.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224201|ref|ZP_05938482.1| predicted polysaccharide deacetylase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254812|ref|ZP_05947345.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284988|ref|YP_003501806.1| hypothetical protein G2583_4353 [Escherichia coli O55:H7 str.
           CB9615]
 gi|300815145|ref|ZP_07095370.1| divergent polysaccharide deacetylase [Escherichia coli MS 107-1]
 gi|300822387|ref|ZP_07102527.1| divergent polysaccharide deacetylase [Escherichia coli MS 119-7]
 gi|300907658|ref|ZP_07125286.1| divergent polysaccharide deacetylase [Escherichia coli MS 84-1]
 gi|300919816|ref|ZP_07136291.1| divergent polysaccharide deacetylase [Escherichia coli MS 115-1]
 gi|300923401|ref|ZP_07139442.1| divergent polysaccharide deacetylase [Escherichia coli MS 182-1]
 gi|300927953|ref|ZP_07143512.1| divergent polysaccharide deacetylase [Escherichia coli MS 187-1]
 gi|300948053|ref|ZP_07162192.1| divergent polysaccharide deacetylase [Escherichia coli MS 116-1]
 gi|300954492|ref|ZP_07166941.1| divergent polysaccharide deacetylase [Escherichia coli MS 175-1]
 gi|301303850|ref|ZP_07209969.1| divergent polysaccharide deacetylase [Escherichia coli MS 124-1]
 gi|301325299|ref|ZP_07218806.1| divergent polysaccharide deacetylase [Escherichia coli MS 78-1]
 gi|301644280|ref|ZP_07244283.1| divergent polysaccharide deacetylase [Escherichia coli MS 146-1]
 gi|307140313|ref|ZP_07499669.1| putative polysaccharide deacetylase [Escherichia coli H736]
 gi|307314298|ref|ZP_07593906.1| protein of unknown function DUF610 YibQ [Escherichia coli W]
 gi|309797485|ref|ZP_07691876.1| divergent polysaccharide deacetylase [Escherichia coli MS 145-7]
 gi|312972100|ref|ZP_07786274.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1827-70]
 gi|331644333|ref|ZP_08345462.1| YibQ protein product [Escherichia coli H736]
 gi|331655247|ref|ZP_08356246.1| YibQ protein product [Escherichia coli M718]
 gi|331670458|ref|ZP_08371297.1| YibQ protein product [Escherichia coli TA271]
 gi|331679708|ref|ZP_08380378.1| YibQ protein product [Escherichia coli H591]
 gi|157068778|gb|ABV08033.1| polysaccharide deacetylase family protein [Escherichia coli HS]
 gi|157079551|gb|ABV19259.1| polysaccharide deacetylase family protein [Escherichia coli
           E24377A]
 gi|169753081|gb|ACA75780.1| protein of unknown function DUF610 YibQ [Escherichia coli ATCC
           8739]
 gi|187771729|gb|EDU35573.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|188018304|gb|EDU56426.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|189002373|gb|EDU71359.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|189358842|gb|EDU77261.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|189369563|gb|EDU87979.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|189374594|gb|EDU93010.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|189380099|gb|EDU98515.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|190901806|gb|EDV61558.1| polysaccharide deacetylase family protein [Escherichia coli B7A]
 gi|192958201|gb|EDV88642.1| polysaccharide deacetylase family protein [Escherichia coli
           E110019]
 gi|208727367|gb|EDZ76968.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208735732|gb|EDZ84419.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208740571|gb|EDZ88253.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209161153|gb|ACI38586.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209914347|dbj|BAG79421.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|217321663|gb|EEC30087.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|242379138|emb|CAQ33940.1| putative nucleoside (IDP) diphosphatase [Escherichia coli
           BL21(DE3)]
 gi|253322587|gb|ACT27189.1| protein of unknown function DUF610 YibQ [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975445|gb|ACT41116.1| predicted polysaccharide deacetylase [Escherichia coli B str.
           REL606]
 gi|253979601|gb|ACT45271.1| predicted polysaccharide deacetylase [Escherichia coli BL21(DE3)]
 gi|254594972|gb|ACT74333.1| predicted polysaccharide deacetylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|281602976|gb|ADA75960.1| Polysaccharide deacetylase family protein [Shigella flexneri
           2002017]
 gi|290764861|gb|ADD58822.1| Uncharacterized protein conserved in bacteria [Escherichia coli
           O55:H7 str. CB9615]
 gi|300318525|gb|EFJ68309.1| divergent polysaccharide deacetylase [Escherichia coli MS 175-1]
 gi|300400594|gb|EFJ84132.1| divergent polysaccharide deacetylase [Escherichia coli MS 84-1]
 gi|300413169|gb|EFJ96479.1| divergent polysaccharide deacetylase [Escherichia coli MS 115-1]
 gi|300420311|gb|EFK03622.1| divergent polysaccharide deacetylase [Escherichia coli MS 182-1]
 gi|300452394|gb|EFK16014.1| divergent polysaccharide deacetylase [Escherichia coli MS 116-1]
 gi|300464045|gb|EFK27538.1| divergent polysaccharide deacetylase [Escherichia coli MS 187-1]
 gi|300525034|gb|EFK46103.1| divergent polysaccharide deacetylase [Escherichia coli MS 119-7]
 gi|300532037|gb|EFK53099.1| divergent polysaccharide deacetylase [Escherichia coli MS 107-1]
 gi|300840813|gb|EFK68573.1| divergent polysaccharide deacetylase [Escherichia coli MS 124-1]
 gi|300847826|gb|EFK75586.1| divergent polysaccharide deacetylase [Escherichia coli MS 78-1]
 gi|301077380|gb|EFK92186.1| divergent polysaccharide deacetylase [Escherichia coli MS 146-1]
 gi|306906121|gb|EFN36640.1| protein of unknown function DUF610 YibQ [Escherichia coli W]
 gi|308118921|gb|EFO56183.1| divergent polysaccharide deacetylase [Escherichia coli MS 145-7]
 gi|310334477|gb|EFQ00682.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1827-70]
 gi|315062905|gb|ADT77232.1| predicted polysaccharide deacetylase [Escherichia coli W]
 gi|315254003|gb|EFU33971.1| divergent polysaccharide deacetylase [Escherichia coli MS 85-1]
 gi|320191332|gb|EFW65982.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. EC1212]
 gi|320639523|gb|EFX09131.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           G5101]
 gi|320655581|gb|EFX23509.1| putative polysaccharide deacetylase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661315|gb|EFX28739.1| putative polysaccharide deacetylase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666329|gb|EFX33328.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323376502|gb|ADX48770.1| protein of unknown function DUF610 YibQ [Escherichia coli KO11]
 gi|323939624|gb|EGB35830.1| divergent polysaccharide deacetylase [Escherichia coli E482]
 gi|323944070|gb|EGB40150.1| divergent polysaccharide deacetylase [Escherichia coli H120]
 gi|323959865|gb|EGB55513.1| divergent polysaccharide deacetylase [Escherichia coli H489]
 gi|323971259|gb|EGB66504.1| divergent polysaccharide deacetylase [Escherichia coli TA007]
 gi|324019726|gb|EGB88945.1| divergent polysaccharide deacetylase [Escherichia coli MS 117-3]
 gi|326337384|gb|EGD61219.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. 1044]
 gi|326339909|gb|EGD63716.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. 1125]
 gi|331036627|gb|EGI08853.1| YibQ protein product [Escherichia coli H736]
 gi|331047262|gb|EGI19340.1| YibQ protein product [Escherichia coli M718]
 gi|331062520|gb|EGI34440.1| YibQ protein product [Escherichia coli TA271]
 gi|331072880|gb|EGI44205.1| YibQ protein product [Escherichia coli H591]
 gi|332749934|gb|EGJ80346.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-671]
 gi|332750094|gb|EGJ80505.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 4343-70]
 gi|332751254|gb|EGJ81657.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2747-71]
 gi|332764186|gb|EGJ94423.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2930-71]
 gi|332997354|gb|EGK16970.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-218]
 gi|333012897|gb|EGK32274.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-304]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|320644962|gb|EFX13992.1| putative polysaccharide deacetylase [Escherichia coli O157:H- str.
           493-89]
 gi|320650229|gb|EFX18718.1| putative polysaccharide deacetylase [Escherichia coli O157:H- str.
           H 2687]
          Length = 319

 Score = 45.1 bits (105), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|57167659|ref|ZP_00366799.1| probable periplasmic protein Cj0633 [Campylobacter coli RM2228]
 gi|57020781|gb|EAL57445.1| probable periplasmic protein Cj0633 [Campylobacter coli RM2228]
          Length = 350

 Score = 45.1 bits (105), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 64/273 (23%), Positives = 127/273 (46%), Gaps = 32/273 (11%)

Query: 122 STSID-SLPTIEERLIL----GLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIV 176
           S+ ID +L  I+E L L     LSK+E L K             D N  S    AR+AI+
Sbjct: 97  SSIIDGNLSKIDENLSLVVEQNLSKEENLTK-------------DMN-LSKTKQARLAII 142

Query: 177 VSGLG-ISQTGTQRAINL--LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           +  +  ISQ    +A+ L  +P+     F  + N +D    +   K    ++ +P+ A +
Sbjct: 143 IDDMANISQVRALQALKLKLIPS----FFPPDKNHID--TPKLALKFDFYMVHLPLAAMN 196

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
            +  E D  TL  + + +++  +++   +       + N+ G++  S++++ + ++K F 
Sbjct: 197 YTKPELD--TLNPSDSEKRIFKKIQQVKKDFKDLKFINNHTGSLFTSDEKAMKKLYKAFE 254

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
           K  L+F D  +   +    +A  L   Y+  D++LD++ D   I+ +L     +A+  G 
Sbjct: 255 KEELIFVDSKTIASSKAPKVAKALGQIYIQRDVFLDNRDDVAYIKNQLIEAVRLAKQKGF 314

Query: 354 AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           AI +      + + + Q   ++ ++ V +V LS
Sbjct: 315 AIAIGHPRKNTFKALEQ--SKDLLKSVELVYLS 345


>gi|89110397|ref|AP_004177.1| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. W3110]
 gi|90111621|ref|NP_418071.4| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|170083122|ref|YP_001732442.1| polysaccharide deacetylase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238902705|ref|YP_002928501.1| putative polysaccharide deacetylase [Escherichia coli BW2952]
 gi|254038815|ref|ZP_04872867.1| polysaccharide deacetylase [Escherichia sp. 1_1_43]
 gi|18545478|sp|P37691|YIBQ_ECOLI RecName: Full=Uncharacterized protein yibQ; Flags: Precursor
 gi|85676428|dbj|BAE77678.1| predicted polysaccharide deacetylase [Escherichia coli str. K12
           substr. W3110]
 gi|87082298|gb|AAC76638.2| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|169890957|gb|ACB04664.1| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|226838780|gb|EEH70807.1| polysaccharide deacetylase [Escherichia sp. 1_1_43]
 gi|238862835|gb|ACR64833.1| predicted polysaccharide deacetylase [Escherichia coli BW2952]
 gi|260447367|gb|ACX37789.1| protein of unknown function DUF610 YibQ [Escherichia coli DH1]
 gi|309704018|emb|CBJ03364.1| putative polysaccharide deacetylase [Escherichia coli ETEC H10407]
 gi|315138196|dbj|BAJ45355.1| putative polysaccharide deacetylase [Escherichia coli DH1]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPATVRVLQQMV 222


>gi|194427407|ref|ZP_03059956.1| polysaccharide deacetylase family protein [Escherichia coli B171]
 gi|194414447|gb|EDX30720.1| polysaccharide deacetylase family protein [Escherichia coli B171]
 gi|323160707|gb|EFZ46644.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli E128010]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|332345585|gb|AEE58919.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPATVRVLQQMV 222


>gi|327398190|ref|YP_004339059.1| hypothetical protein Hipma_0017 [Hippea maritima DSM 10411]
 gi|327180819|gb|AEA33000.1| protein of unknown function DUF610 YibQ [Hippea maritima DSM 10411]
          Length = 247

 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 39/212 (18%), Positives = 89/212 (41%), Gaps = 1/212 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+AIV+  +G       R    L   +  AF  +        K+  K G   ++ +P Q 
Sbjct: 33  RLAIVIDDMGYDVALANR-FESLKMPLAFAFLPDAPFSGELSKKLSKDGFIVMIHMPSQP 91

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            D   +    + + +  +  +    L ++ ++     G+ N+ G+ +L +K   + I + 
Sbjct: 92  IDYPKDNPGKHAIYLWTSKAETFRLLNWAYKKIPNAMGLNNHMGSAILRDKTHLDYIMEF 151

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             K  L F D  +   +L  + A K  +      ++LD++ +   I+ +++   ++ +  
Sbjct: 152 LKKHDLFFIDSATVKDSLGCIEAEKFGVMCAKRRVFLDNKKNVAYIKGQIRQALKMLKKR 211

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
              + +    +++ E ++Q  +Q     VSVV
Sbjct: 212 NNVVAIGHCNEKTYEALAQMKKQLKPYLVSVV 243


>gi|193066089|ref|ZP_03047145.1| polysaccharide deacetylase family protein [Escherichia coli E22]
 gi|260846618|ref|YP_003224396.1| putative polysaccharide deacetylase [Escherichia coli O103:H2 str.
           12009]
 gi|192926251|gb|EDV80889.1| polysaccharide deacetylase family protein [Escherichia coli E22]
 gi|257761765|dbj|BAI33262.1| predicted polysaccharide deacetylase [Escherichia coli O103:H2 str.
           12009]
 gi|323182645|gb|EFZ68048.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1357]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|256025655|ref|ZP_05439520.1| predicted polysaccharide deacetylase [Escherichia sp. 4_1_40B]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|218556179|ref|YP_002389092.1| putative polysaccharide deacetylase [Escherichia coli IAI1]
 gi|218362947|emb|CAR00584.1| putative polysaccharide deacetylase [Escherichia coli IAI1]
          Length = 319

 Score = 44.7 bits (104), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRRAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGYTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|46580740|ref|YP_011548.1| hypothetical protein DVU2335 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450160|gb|AAS96808.1| conserved domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234454|gb|ADP87308.1| protein of unknown function DUF610 YibQ [Desulfovibrio vulgaris
           RCH1]
          Length = 516

 Score = 44.7 bits (104), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 85/213 (39%), Gaps = 4/213 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           GA +AIV+  +G S  G  R +  L   +T A     +      + A + G+E ++  PM
Sbjct: 291 GALLAIVIDDIGESM-GAVRDLLKLDYPVTFAVWPRSSHAREAAEAAHRAGREVMIHQPM 349

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +       +     + V     ++   LR +L R     G+ N+ G+    +      + 
Sbjct: 350 EPLKYPSVKPGPGAIYVRMGSDEIEATLRDNLARVPHAVGLNNHMGSRFTQDTRGVRAVC 409

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
                +GL   D  +   ++    A K  LP    +++LD   D+  I  +L     +A 
Sbjct: 410 DALEGKGLFVLDSVTHSGSVFYREARKAGLPAGKRNVFLDVIHDKRNIMFQLDKAARVAH 469

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
             G A+ +     E++  + +W   +  RD SV
Sbjct: 470 EQGVAVAIGHPLAETVAALKEW---QRTRDKSV 499


>gi|301028373|ref|ZP_07191620.1| divergent polysaccharide deacetylase [Escherichia coli MS 196-1]
 gi|299878575|gb|EFI86786.1| divergent polysaccharide deacetylase [Escherichia coli MS 196-1]
          Length = 319

 Score = 44.3 bits (103), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKGIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMV 222


>gi|56963524|ref|YP_175255.1| hypothetical protein ABC1759 [Bacillus clausii KSM-K16]
 gi|56909767|dbj|BAD64294.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 266

 Score = 44.3 bits (103), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 77/173 (44%), Gaps = 9/173 (5%)

Query: 164 FCSN----ASGARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRWMKEAKK 218
           FC N    A+   +AI++   G +  G    +   +P  +T+A   N          A +
Sbjct: 19  FCPNTICDAANKDVAIIIDDFGGNVKGVDAFLQGDIP--VTVAIMPNMPYTTEQAIAAHE 76

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
            G E I+ +P++  +   +      + V  + +++  RLR +  +     G+ N+ G+  
Sbjct: 77  NGLEVIIHLPLEPKNGKASWLGPNGITVDLSNEEINKRLREAYEQIPYAVGLNNHMGSKA 136

Query: 279 LSNKESAEVIFKEFAK-RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
           + +K    +I  EFAK  GL   D  ++P ++   LA K  +P     L+LDD
Sbjct: 137 MEDKRIVGLIV-EFAKTNGLYLVDSKTTPHSVMPELALKAQIPCFENKLFLDD 188


>gi|261866855|ref|YP_003254777.1| divergent polysaccharide deacetylase superfamily protein
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391508|ref|ZP_06635842.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412187|gb|ACX81558.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290952042|gb|EFE02161.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 275

 Score = 44.3 bits (103), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 38/201 (18%), Positives = 91/201 (45%), Gaps = 3/201 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  LG       + I  LP  +++A         +  ++A ++G++ ++ +
Sbjct: 21  AYSAKLAIVIDDLGYHPKEDAQ-ILALPKAVSVAIIPAAPYAKQRNQQAHQQGRDILIHM 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+   +   E     L + Q  +++ +R++ + +  +   G+ N+ G+   ++      
Sbjct: 80  PMETVSKMKIEGGGLHLGMNQ--EEVNHRVQTAKKIVSHAIGMNNHMGSAATADVPLMTK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +     +R L F D  +  R++   +A    +  +   ++LDD  D   ++ + +   + 
Sbjct: 138 LMTALRERHLFFLDSRTIGRSVAGKIAKAQGVLALDRHIFLDDSNDLADVQRQFRAAVQY 197

Query: 348 ARTTGQAIGVAVAFDESIEVI 368
           A+  G AI +      +I V+
Sbjct: 198 AQKHGTAIAIGHPRKNTIAVL 218


>gi|89100427|ref|ZP_01173290.1| hypothetical protein B14911_20563 [Bacillus sp. NRRL B-14911]
 gi|89084856|gb|EAR63994.1| hypothetical protein B14911_20563 [Bacillus sp. NRRL B-14911]
          Length = 259

 Score = 44.3 bits (103), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/143 (20%), Positives = 65/143 (45%)

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A + G E ++ +PM+      +      +    + +++  R+  ++       G+ N+ G
Sbjct: 71  AHENGFEVMVHLPMEPKRGKKSWLGPKPITTNLSSEEVRKRVNEAIDSVPYAKGLNNHMG 130

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           +  + ++     I K   +R L   D G+SP +   ++A +L +P +  D++LDD     
Sbjct: 131 SRAVEDEGIVREIVKIAKERKLYIVDSGTSPESKFPIIAKELGVPLIKRDVFLDDISSVS 190

Query: 336 KIREKLKGLEEIARTTGQAIGVA 358
            +R ++K L  I    G+ I + 
Sbjct: 191 HVRRQMKKLALITEQQGRGIAIG 213


>gi|327395759|dbj|BAK13181.1| periplasmic protein YibQ [Pantoea ananatis AJ13355]
          Length = 258

 Score = 43.9 bits (102), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 33/184 (17%), Positives = 83/184 (45%), Gaps = 12/184 (6%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT---- 249
           +P  I++A   +     +   +A + G+E ++ +PM    +   E ++ T ++++     
Sbjct: 1   MPQAISVAVLPDAPYARQMAIKAHQGGREVLIHLPMAPLSKQPLEKNTLTPEMSRAEIDR 60

Query: 250 -VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
            ++  +N + Y++       G+ N+ G+ + S+    + + +   +  L F D  +   +
Sbjct: 61  IIRSAVNNVPYAV-------GLNNHMGSKMTSSLPGMQKVMQALNQYNLYFLDSMTIGNS 113

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
            +   A   ++  +   ++LDD  D + IR++      +A+  G AI +      ++ V+
Sbjct: 114 QSLQAAQGTHVRVLKRRVFLDDSQDINAIRQQFNRAVTLAQRDGYAIAIGHPHPNTVRVL 173

Query: 369 SQWL 372
            Q L
Sbjct: 174 QQML 177


>gi|194435962|ref|ZP_03068065.1| polysaccharide deacetylase family protein [Escherichia coli 101-1]
 gi|194425505|gb|EDX41489.1| polysaccharide deacetylase family protein [Escherichia coli 101-1]
          Length = 319

 Score = 43.9 bits (102), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 35/208 (16%), Positives = 85/208 (40%), Gaps = 13/208 (6%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVT-----QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
               +   E ++   +++     + ++  +N + Y++       G+ N+ G+ + SN   
Sbjct: 82  APLSKQPLEKNTLCPEMSSDEIERIIRSAVNNVPYAV-------GINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWL 372
            ++AR  G  I +      ++ V+ Q +
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMV 222


>gi|187731969|ref|YP_001882314.1| polysaccharide deacetylase family protein [Shigella boydii CDC
           3083-94]
 gi|187428961|gb|ACD08235.1| polysaccharide deacetylase family protein [Shigella boydii CDC
           3083-94]
          Length = 319

 Score = 43.9 bits (102), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 82/203 (40%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPLTVRVLQQMV 222


>gi|78044631|ref|YP_360224.1| putative N-acetylmuramoyl-L-alanine amidase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996746|gb|ABB15645.1| putative N-acetylmuramoyl-L-alanine amidase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 448

 Score = 43.9 bits (102), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 73/154 (47%), Gaps = 6/154 (3%)

Query: 209 LDRWMKEAK---KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGT 265
           L+   +EAK   + G + I+ +PM+      +      + V  T Q++ + L  +L+   
Sbjct: 256 LNNTHQEAKALYQSGNDIIIHLPMEPKSYKRSWLGPRPIMVNLTPQEITSLLIAALKENP 315

Query: 266 GYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
              G+ N+ G+    +++  + +     K  L F D  ++P +L  +L  +  +  +  D
Sbjct: 316 WAIGINNHTGSRACEDEKIVKTVLSFCQKNNLAFIDSQTTPNSLFPLLGSEFGVVVLKRD 375

Query: 326 LYLDDQVDRDK-IREKLKGLEEIA--RTTGQAIG 356
           ++L+     +K I E+LK L+ IA  +  G AIG
Sbjct: 376 IFLEVNGKEEKNIIEQLKKLQSIAQKKNLGIAIG 409


>gi|320176324|gb|EFW51384.1| putative divergent polysaccharide deacetylase [Shigella dysenteriae
           CDC 74-1112]
 gi|320186843|gb|EFW61563.1| putative divergent polysaccharide deacetylase [Shigella flexneri
           CDC 796-83]
 gi|332089546|gb|EGI94650.1| divergent polysaccharide deacetylase family protein [Shigella
           boydii 3594-74]
          Length = 319

 Score = 43.9 bits (102), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVL-AMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
             G  I +      ++ V+ Q +
Sbjct: 200 RNGSTIAIGHPHPLTVRVLQQMV 222


>gi|167463615|ref|ZP_02328704.1| hypothetical protein Plarl_13849 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381594|ref|ZP_08055567.1| hypothetical protein PL1_0781 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154430|gb|EFX46733.1| hypothetical protein PL1_0781 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 281

 Score = 43.9 bits (102), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 35/175 (20%), Positives = 78/175 (44%), Gaps = 1/175 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R AIV+   G    GT+  + L P  IT+A      +     + A   G+E I+ +PM+ 
Sbjct: 57  RAAIVIDDFGNKMGGTEDMLAL-PFPITVAVMPFLQTTKADAEAAHAAGKEVIIHLPMEP 115

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +       ++  R+  ++       G+ N+ G+    ++   +++ + 
Sbjct: 116 KIARKSWLGPGVISTDLKNDEIRKRVHAAIDEVPHAIGINNHMGSKATGDERVMKLVLEV 175

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
             +RGL F D  ++  ++    A ++ +P +   L+LDD   +  I ++++ L++
Sbjct: 176 CKERGLFFLDSHTNYWSIACRKAKEVGVPCIENHLFLDDIHTKKHISQQVRLLDK 230


>gi|126665725|ref|ZP_01736706.1| hypothetical protein MELB17_04132 [Marinobacter sp. ELB17]
 gi|126629659|gb|EBA00276.1| hypothetical protein MELB17_04132 [Marinobacter sp. ELB17]
          Length = 281

 Score = 43.5 bits (101), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 86/218 (39%), Gaps = 3/218 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
           T +  M  N         IAI++  +G  +   +R +  L   ITL+F           K
Sbjct: 15  TMLVGMVSNIALAGPPPTIAIIIDDMGHDRLEGER-LARLEQPITLSFLPYRRHTVELAK 73

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
            +    +E +L  PM             T  + Q   QL   LR +L+      GV N+ 
Sbjct: 74  LSHSLNKEIMLHAPMANTQHFGLGPGGLTEDMDQA--QLTRTLRRALQSVPHVQGVNNHM 131

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G++L    +  + +  E  +  L F D  +   ++   +A    +P    D++LD +   
Sbjct: 132 GSLLTQRLQPMDWVMTELGQYPLYFVDSRTIASSIAGDVARAHRIPSFTRDVFLDHEQTE 191

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           + +  + K L + AR  G AI +      +++ + + L
Sbjct: 192 EFVDRQFKLLIQRARQQGTAIAIGHPHKITVDYLEKHL 229


>gi|303239963|ref|ZP_07326485.1| protein of unknown function DUF610 YibQ [Acetivibrio cellulolyticus
           CD2]
 gi|302592442|gb|EFL62168.1| protein of unknown function DUF610 YibQ [Acetivibrio cellulolyticus
           CD2]
          Length = 282

 Score = 43.1 bits (100), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 39/207 (18%), Positives = 91/207 (43%), Gaps = 1/207 (0%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S+    +IAIV+   G  + G +  +++   ++T A            K+A +KG E I+
Sbjct: 55  SDKPAGKIAIVIDDFGQDRNGVKEMMSI-NRHLTFAVMPFLTYSQSDAKDAFEKGFEVIV 113

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+      +      +  T +  ++      +L       G   + G+ + +N    
Sbjct: 114 HLPMEPVSGKISWLGPKPILSTLSDTEVYEITSEALTNVPYAVGANIHMGSKISTNDRIM 173

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             +     + G+ F D  +S +++ + +A +  + +   +++LD Q  ++ ++E+L+   
Sbjct: 174 SDVLDIIKQNGIYFLDSKTSAKSVAKKIAAEKAVAFYERNVFLDGQTSKEHVKEQLRKAG 233

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWL 372
            IA   G++I +     E  +V +Q +
Sbjct: 234 AIALKDGKSIAIGHVGIEGGKVTAQAI 260


>gi|167854745|ref|ZP_02477524.1| hypothetical protein HPS_10725 [Haemophilus parasuis 29755]
 gi|167854159|gb|EDS25394.1| hypothetical protein HPS_10725 [Haemophilus parasuis 29755]
          Length = 281

 Score = 43.1 bits (100), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 41/210 (19%), Positives = 93/210 (44%), Gaps = 13/210 (6%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++ IV+  +G  +     AI  LP  + +A   +         +AK++G+E 
Sbjct: 21  FAPLAYANKLVIVIDDIGY-RIKEDNAIYTLPKEVNVAIIPSAPYATARANKAKEQGREI 79

Query: 224 ILQIPMQAFDESYNEDDSYTL-----KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           ++ +PMQ   +   E  +  +     +V++ + Q   ++ Y++        + N+ G+  
Sbjct: 80  LIHLPMQPKVKQPIEAGALLVGMGESEVSELIHQAQQQVPYAI-------ALNNHMGSKA 132

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            ++K + + + K  +++GL F D  ++  ++    A    L  +   ++LD+      ++
Sbjct: 133 TADKTTMQHLMKALSQQGLGFLDSKTAGDSVAYQTAKAYGLNALERHIFLDNSDVFADVQ 192

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
            + +   + AR  G AI +      SI V+
Sbjct: 193 RQFQHAVQYARKHGIAIMIGHPRKHSIAVL 222


>gi|157149233|ref|YP_001456552.1| hypothetical protein CKO_05073 [Citrobacter koseri ATCC BAA-895]
 gi|157086438|gb|ABV16116.1| hypothetical protein CKO_05073 [Citrobacter koseri ATCC BAA-895]
          Length = 258

 Score = 43.1 bits (100), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/156 (19%), Positives = 66/156 (42%), Gaps = 2/156 (1%)

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E D  TL+   +  ++   +R ++ +     G+ N+ 
Sbjct: 4   KAHNSGHEVLIHLPMAPLSKQPLEKD--TLRPEMSSDEIERIIRDAVNKVPYAVGLNNHM 61

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + S+    + + +   +  L F D  +   +     A    +  +   ++LDD  + 
Sbjct: 62  GSAMTSSLFGMQKVMQALERYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNE 121

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
             IR +     E+AR  G AI +      ++ V+ Q
Sbjct: 122 ADIRRQFNRAIELARRNGSAIAIGHPHPSTVRVLQQ 157


>gi|330980647|gb|EGH78750.1| hypothetical protein PSYAP_19071 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 155

 Score = 43.1 bits (100), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 58/120 (48%)

Query: 269 GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYL 328
           G+ N+ G+ + +   +   +  E  +R LLF    +S + +    A ++ L  +  D++L
Sbjct: 17  GINNHMGSRMTAEPVAMTWLMAELQRRHLLFVASRTSAKTVAAAEAQRIGLASVSRDVFL 76

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           DD+   + I  +L+   +IAR  G A+ +   +  +++V+ + L     + V  + L  +
Sbjct: 77  DDERTAEAITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSM 136


>gi|120601972|ref|YP_966372.1| hypothetical protein Dvul_0924 [Desulfovibrio vulgaris DP4]
 gi|120562201|gb|ABM27945.1| protein of unknown function DUF610, YibQ [Desulfovibrio vulgaris
           DP4]
          Length = 461

 Score = 42.7 bits (99), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 86/213 (40%), Gaps = 4/213 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           GA +AIV+  +G S  G  R +  L   +T A     +      + A + G+E ++  PM
Sbjct: 236 GALLAIVIDDIGESM-GAVRDLLKLDYPVTFAVWPRSSHAREAAEAAHRAGREVMIHQPM 294

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +       +     + V     ++   LR +L R     G+ N+ G+    +      + 
Sbjct: 295 EPLKYPSVKPGPGAIYVRMGRDEIEATLRDNLARVPHAVGLNNHMGSRFTQDVRGVRAVC 354

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +    +GL   D  +   ++    A +  LP    +++LD   D+  I  +L     +A 
Sbjct: 355 EALEGKGLFVLDSVTHSGSVFYREARRAGLPAGKRNVFLDVIHDKRNIMFQLDKAARVAH 414

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
             G A+ +     E++  + +W   +  RD SV
Sbjct: 415 EQGVAVAIGHPLAETVAALKEW---QRTRDKSV 444


>gi|224437004|ref|ZP_03657985.1| hypothetical protein HcinC1_03480 [Helicobacter cinaedi CCUG 18818]
          Length = 360

 Score = 42.7 bits (99), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 100/212 (47%), Gaps = 10/212 (4%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAF----ASNGNSLDRWMKEAKKKGQEA 223
           AS  ++ +++  L  S+    +A+  LP NIT +       NG + +   K   + G+  
Sbjct: 124 ASKPKVLLIMDDL--SKLSQIKALESLPLNITPSIFPKTRHNGITPN-LAKRVIQNGKIF 180

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +P++A  +++ + +   LKV    Q L  ++    +       + N+ G+    +K 
Sbjct: 181 MIHLPLEA--QNFMQKELEPLKVGIDKQSLKEQILQIKQDFPQLVYLNNHTGSKFTQSKT 238

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + + F +  L F D  + P   + +LA +     M  D++LD+Q +    +++L+ 
Sbjct: 239 DMKNLLEVFDELDLKFIDSVTIPNPASEILAKEQKRLIMQRDIFLDNQTNIAYTKKQLQS 298

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQE 375
           L + A+  G AI +      + + ++Q +Q+E
Sbjct: 299 LIQKAKKKGYAIAICHPHPSTFKALAQ-MQKE 329


>gi|269792105|ref|YP_003317009.1| hypothetical protein Taci_0491 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269099740|gb|ACZ18727.1| protein of unknown function DUF610 YibQ [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 325

 Score = 42.7 bits (99), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 87/202 (43%), Gaps = 11/202 (5%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIVV  +G   +  +R +  L   +T A         +  + A+  G   ++ +PMQA 
Sbjct: 103 LAIVVDDMGYDLSAARR-LAALRIPMTWAIIPGAPRASQVAEIARAHGIPYLVHLPMQAL 161

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
            +   +     + V    + +  R+R +     G  GV N+RG+   S+ ++     K  
Sbjct: 162 SDP--DGGESVIHVGMDAKDMRARVRRAFDSLPGAVGVNNHRGSAATSDSKTMGDFVKVL 219

Query: 293 A--KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD--KIREKLKGLEEIA 348
           A  + G  F D  +SPR++ R  A +  +  +    ++D    R+   +   +KG    A
Sbjct: 220 AELRPGWFFLDSATSPRSVARKEALRRGIRSLRNGYFIDSVPGREDRALAAAVKG----A 275

Query: 349 RTTGQAIGVAVAFDESIEVISQ 370
             +G A+ +      ++E +S+
Sbjct: 276 LKSGGAVAIGHPRPGTLEALSR 297


>gi|289672249|ref|ZP_06493139.1| hypothetical protein PsyrpsF_03340 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 159

 Score = 42.7 bits (99), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/135 (22%), Positives = 59/135 (43%), Gaps = 7/135 (5%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A +++++  LG +Q    R + L P  +TLA   +      + ++A + G+  +L +PM 
Sbjct: 31  AYLSLIIDDLGQNQDRDSRTLAL-PGPVTLAIMPDTPHATEFARQAHRAGKTVMLHMPMD 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                Y       L       +L +RL  +L +     G+ N+ G+ + +   +   +  
Sbjct: 90  PATGPYAWHPELPLP------ELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMTWLMA 143

Query: 291 EFAKRGLLFFDDGSS 305
           E  +R L F D  +S
Sbjct: 144 ELQRRHLFFVDSRTS 158


>gi|313143477|ref|ZP_07805670.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313128508|gb|EFR46125.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 354

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 100/212 (47%), Gaps = 10/212 (4%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAF----ASNGNSLDRWMKEAKKKGQEA 223
           AS  ++ +++  L  S+    +A+  LP NIT +       NG + +   K   + G+  
Sbjct: 118 ASKPKVLLIMDDL--SKLSQIKALESLPLNITPSIFPKTRHNGITPN-LAKRVIQNGKIF 174

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +P++A  +++ + +   LKV    Q L  ++    +       + N+ G+    +K 
Sbjct: 175 MIHLPLEA--QNFMQKELEPLKVGIDKQSLKEQILQIKQDFPQLVYLNNHTGSKFTQSKT 232

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + + F +  L F D  + P   + +LA +     M  D++LD+Q +    +++L+ 
Sbjct: 233 DMKNLLEVFDELDLKFIDSVTIPNPASEILAKEQKRLIMQRDIFLDNQTNIAYTKKQLQS 292

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQE 375
           L + A+  G AI +      + + ++Q +Q+E
Sbjct: 293 LIQKAKKKGYAIAICHPHPSTFKALAQ-MQKE 323


>gi|216264608|ref|ZP_03436600.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi 156a]
 gi|215981081|gb|EEC21888.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi 156a]
          Length = 293

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I  NL      + F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDIFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|315618682|gb|EFU99268.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 3431]
          Length = 319

 Score = 42.4 bits (98), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/203 (17%), Positives = 81/203 (39%), Gaps = 3/203 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E +  TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEKN--TLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWL 372
                I +      ++ V+ Q +
Sbjct: 200 RNSSTIAIGHPHPSTVRVLQQMV 222


>gi|117625892|ref|YP_859215.1| polysaccharide deacetylase [Escherichia coli APEC O1]
 gi|115515016|gb|ABJ03091.1| predicted polysaccharide deacetylase [Escherichia coli APEC O1]
          Length = 277

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRMQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178


>gi|1573763|gb|AAC22414.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
          Length = 231

 Score = 42.4 bits (98), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/180 (18%), Positives = 77/180 (42%), Gaps = 2/180 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A            +EAK +G++ ++ +PMQ       ED    L +  +  Q+
Sbjct: 1   MPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQPVSAVKIEDGG--LHLGMSAAQV 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            +R+  +        G+ N+ G+   ++ +    +     ++ L F D  +  +++   +
Sbjct: 59  NDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTALQEKHLFFLDSRTIGKSVAGKI 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A +  +  +   ++LDD  +   ++ + K     AR  G AI +      +I V+   L+
Sbjct: 119 AKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKHGSAIAIGHPRPNTIAVLQAGLR 178


>gi|312149619|gb|ADQ29690.1| divergent polysaccharide deacetylase superfamily [Borrelia
           burgdorferi N40]
          Length = 293

 Score = 42.4 bits (98), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I  NL      + F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKRLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|224533310|ref|ZP_03673904.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi CA-11.2a]
 gi|224513475|gb|EEF83832.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi CA-11.2a]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I  NL      + F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|82779107|ref|YP_405456.1| hypothetical protein SDY_4047 [Shigella dysenteriae Sd197]
 gi|81243255|gb|ABB63965.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 277

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178


>gi|15595115|ref|NP_212904.1| hypothetical protein BB0770 [Borrelia burgdorferi B31]
 gi|218249494|ref|YP_002375268.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi ZS7]
 gi|226321469|ref|ZP_03796996.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi Bol26]
 gi|2688701|gb|AAC67110.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|218164682|gb|ACK74743.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi ZS7]
 gi|226233265|gb|EEH32017.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi Bol26]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I  NL      + F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|221217888|ref|ZP_03589355.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 72a]
 gi|224532631|ref|ZP_03673253.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi WI91-23]
 gi|225548835|ref|ZP_03769812.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 94a]
 gi|225549946|ref|ZP_03770907.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 118a]
 gi|221192194|gb|EEE18414.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 72a]
 gi|224512487|gb|EEF82866.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi WI91-23]
 gi|225369405|gb|EEG98857.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 118a]
 gi|225370438|gb|EEG99874.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 94a]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I  NL      + F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|312148129|gb|ADQ30788.1| divergent polysaccharide deacetylase superfamily [Borrelia
           burgdorferi JD1]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/186 (17%), Positives = 87/186 (46%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I  NL      + F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHKNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|226320641|ref|ZP_03796200.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 29805]
 gi|226233964|gb|EEH32686.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 29805]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 34/186 (18%), Positives = 88/186 (47%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINL-LPANITL-AFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I L L  N  +  F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKINYAIIPFLPKSMSLYKRLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|74314149|ref|YP_312568.1| hypothetical protein SSON_3791 [Shigella sonnei Ss046]
 gi|73857626|gb|AAZ90333.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 277

 Score = 42.0 bits (97), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178


>gi|195941590|ref|ZP_03086972.1| hypothetical protein Bbur8_01736 [Borrelia burgdorferi 80a]
          Length = 293

 Score = 42.0 bits (97), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/186 (18%), Positives = 88/186 (47%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINL-LPANITL-AFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I L L  N  +  F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKINYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|110807708|ref|YP_691228.1| hypothetical protein SFV_3915 [Shigella flexneri 5 str. 8401]
 gi|110617256|gb|ABF05923.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 274

 Score = 42.0 bits (97), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 1   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 59  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 175


>gi|15804158|ref|NP_290197.1| hypothetical protein Z5041 [Escherichia coli O157:H7 EDL933]
 gi|30065110|ref|NP_839281.1| hypothetical protein S4115 [Shigella flexneri 2a str. 2457T]
 gi|56480388|ref|NP_709393.2| hypothetical protein SF3653 [Shigella flexneri 2a str. 301]
 gi|12518367|gb|AAG58761.1|AE005589_1 hypothetical protein Z5041 [Escherichia coli O157:H7 str. EDL933]
 gi|13363967|dbj|BAB37915.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30043371|gb|AAP19092.1| hypothetical protein S4115 [Shigella flexneri 2a str. 2457T]
 gi|56383939|gb|AAN45100.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|209754800|gb|ACI75712.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|209754802|gb|ACI75713.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|209754804|gb|ACI75714.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|209754806|gb|ACI75715.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|313647513|gb|EFS11963.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2a str. 2457T]
          Length = 277

 Score = 42.0 bits (97), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178


>gi|315931831|gb|EFV10786.1| Divergent polysaccharide deacetylase family protein [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 325

 Score = 42.0 bits (97), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 48/80 (60%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  SN+E+   +++    + + F D  +   +    +A +LN+PY+  D++LD
Sbjct: 241 INNHTGSLFTSNEEAMRKLYEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLD 300

Query: 330 DQVDRDKIREKLKGLEEIAR 349
           ++ D + ++++++   ++A+
Sbjct: 301 NEDDVNYVKKQIQNAVKLAQ 320


>gi|209754798|gb|ACI75711.1| hypothetical protein ECs4492 [Escherichia coli]
          Length = 277

 Score = 42.0 bits (97), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178


>gi|323179414|gb|EFZ64981.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1180]
          Length = 277

 Score = 41.6 bits (96), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178


>gi|225551830|ref|ZP_03772773.1| divergent polysaccharide deacetylase family protein [Borrelia sp.
           SV1]
 gi|225371625|gb|EEH01052.1| divergent polysaccharide deacetylase family protein [Borrelia sp.
           SV1]
          Length = 293

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/186 (18%), Positives = 88/186 (47%), Gaps = 7/186 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINL-LPANITL-AFASNGNSLDRWMKEAKKKGQEAILQ 226
           S  +  +++  +G  +   ++ I L L  N  +  F     SL + +K A K     I+ 
Sbjct: 71  SKPKFYLIIDDVGYDEFMLEQFIKLNLKINYAIIPFLPKSMSLYKKLKNANK---TVIIH 127

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            PMQ+  +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  +
Sbjct: 128 FPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDSKIMNNHMGSLITSNKDFMK 185

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           +I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + 
Sbjct: 186 IILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVIKELEKAKN 245

Query: 347 IARTTG 352
           IAR  G
Sbjct: 246 IARKNG 251


>gi|912478|gb|AAB18591.1| unnamed protein product [Escherichia coli str. K-12 substr. MG1655]
          Length = 277

 Score = 41.6 bits (96), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPATVRVLQQ 178


>gi|57242341|ref|ZP_00370280.1| probable periplasmic protein Cj0633 [Campylobacter upsaliensis
           RM3195]
 gi|57017021|gb|EAL53803.1| probable periplasmic protein Cj0633 [Campylobacter upsaliensis
           RM3195]
          Length = 356

 Score = 41.6 bits (96), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 2/119 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  S++E+   ++K   K  L F D  +   +    +A ++   Y+  D++LD
Sbjct: 238 INNHTGSLFTSDEEAMRKLYKALDKHHLTFVDSKTIHHSKAPKIAKEMRKIYIKRDVFLD 297

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           ++ D D ++ +L     +A+  G AI +      + + + +   +E ++ V +V LS L
Sbjct: 298 NEDDVDYVKNQLLNAVNLAQKRGYAIAIGHPKKNTFKALKE--SKELLKSVDLVYLSEL 354


>gi|213852179|ref|ZP_03381711.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 165

 Score = 40.8 bits (94), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 57/138 (41%), Gaps = 3/138 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E 
Sbjct: 17  FAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFD 301
             + + +      L F D
Sbjct: 134 GMQKVMQALEHYNLYFLD 151


>gi|82545982|ref|YP_409929.1| hypothetical protein SBO_3620 [Shigella boydii Sb227]
 gi|81247393|gb|ABB68101.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 277

 Score = 40.8 bits (94), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 32/177 (18%), Positives = 71/177 (40%), Gaps = 2/177 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E +  TL+   +  ++
Sbjct: 4   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLEKN--TLRPEMSSDEI 61

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 62  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 121

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 122 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPLTVRVLQQ 178


>gi|114776726|ref|ZP_01451769.1| hypothetical protein SPV1_10941 [Mariprofundus ferrooxydans PV-1]
 gi|114552812|gb|EAU55243.1| hypothetical protein SPV1_10941 [Mariprofundus ferrooxydans PV-1]
          Length = 311

 Score = 40.8 bits (94), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 82/204 (40%), Gaps = 4/204 (1%)

Query: 154 DTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINL-LPANITLAFASNGNSLDRW 212
           D  V A +         A IA+++   G      QR + L +P  + +A   +     + 
Sbjct: 59  DEPVQAPEPEISDAGKAAGIALILDDAGYDLPELQRMLKLGVP--VAIAVIPDAPYARQA 116

Query: 213 MKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF-GVM 271
              A + G   +L +PMQ   E Y+   S      Q  +  L R   +      Y  GV 
Sbjct: 117 AVMAHQAGHVVMLHLPMQPVSEKYSSRMSDAFLTDQMNEMQLRRTFINDLALVPYVEGVN 176

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+ L   ++    + +   ++GL F D  +S +++   +A ++ L       +LD+ 
Sbjct: 177 NHMGSALTQLEKPMHWVMQVCLEKGLFFVDSVTSGKSVAGRVATEMGLERGRRQFFLDNN 236

Query: 332 VDRDKIREKLKGLEEIARTTGQAI 355
           +D   ++   + +   AR   + +
Sbjct: 237 LDTPALKAMWEKVRICARKGHRCV 260


>gi|223889391|ref|ZP_03623977.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 64b]
 gi|223885077|gb|EEF56181.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 64b]
          Length = 293

 Score = 40.8 bits (94), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 32/180 (17%), Positives = 85/180 (47%), Gaps = 7/180 (3%)

Query: 175 IVVSGLGISQTGTQRAI--NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +++  +G  +   ++ I  NL      + F     SL + +K A K     I+  PMQ+ 
Sbjct: 77  LIIDDVGYDEFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANK---TVIIHFPMQS- 132

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
            +  N  + + + +    +++  ++  + ++      + N+ G+++ SNK+  ++I ++ 
Sbjct: 133 -KHRNSIEKFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMKIILEKL 191

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + IAR  G
Sbjct: 192 KEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKNIARKNG 251


>gi|218962072|ref|YP_001741847.1| hypothetical protein CLOAM1809 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730729|emb|CAO81641.1| conserved hypothetical protein [Candidatus Cloacamonas
           acidaminovorans]
          Length = 262

 Score = 40.8 bits (94), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 69/173 (39%), Gaps = 2/173 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + I++   G +        + LP  I  +   +        + A+K   E ++ IPMQA 
Sbjct: 38  VVIIIDDFGQNAGQLLDDFSALPKEIAFSILPDLPYTQTVARLAEKTNHETLIHIPMQAL 97

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N    Y ++       + + L+    +        N+ G+ + S+  +  +I +E 
Sbjct: 98  DHQANPGKRY-IRTGMDKYAISDLLQDFYAQIPNAIAANNHMGSEVTSDLATMNIILEEL 156

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK-IREKLKGL 344
              GL F D  ++ ++        L L     D++LD   + D  I  K++GL
Sbjct: 157 DNLGLYFLDSATTNKSAAFTAGKNLGLKIAKRDIFLDVPDNSDATIINKIEGL 209


>gi|315638452|ref|ZP_07893629.1| periplasmic protein [Campylobacter upsaliensis JV21]
 gi|315481443|gb|EFU72070.1| periplasmic protein [Campylobacter upsaliensis JV21]
          Length = 334

 Score = 40.4 bits (93), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 60/119 (50%), Gaps = 2/119 (1%)

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G++  S++E+   ++K   K  L F D  +   +    +A ++   Y+  D++LD
Sbjct: 216 INNHTGSLFTSDEEAMRKLYKALDKHHLSFVDSKTIHNSKAPKIAKEMQKIYIKRDVFLD 275

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           ++ D D ++ +L     +A+  G AI +      + + + +   +E ++ V +V LS L
Sbjct: 276 NEDDVDYVKNQLLSAVNLAQKRGYAIAIGHPKKNTFKALKE--SKELLKSVDLVYLSEL 332


>gi|254360760|ref|ZP_04976908.1| hypothetical protein MHA_0322 [Mannheimia haemolytica PHL213]
 gi|153091330|gb|EDN73304.1| hypothetical protein MHA_0322 [Mannheimia haemolytica PHL213]
          Length = 281

 Score = 39.7 bits (91), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 90/212 (42%), Gaps = 5/212 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F      A++AIV+  +G  +    R I  LP  +++A            K+A  + ++ 
Sbjct: 21  FTPLVQAAQMAIVIDDVGY-RIKEDREILALPKAVSVAIIPVAPYATERAKDAYNQKRDI 79

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY-FGVMNYRGAMLLSNK 282
           ++ +PM+   +   E+    +   +   + + +L ++ R    Y  G+ N+ G+   S+ 
Sbjct: 80  LIHLPMEPKSKQPIEEGGIHIGDNE---EKIRKLIHTSRGQVPYAIGLNNHMGSGATSDS 136

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            + + + K   +  L F D  +   ++    A +  +  +  D++LDD      ++++  
Sbjct: 137 ATMQHLLKVLKENTLFFLDSKTIGSSVAAKTARQFGINTLERDIFLDDSDLLADVQKQFA 196

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
                AR  G A+ +      +I V+ Q L Q
Sbjct: 197 HAINHARKNGVAVVIGHPRKNTISVLKQNLAQ 228


>gi|330954793|gb|EGH55053.1| hypothetical protein PSYCIT7_26251 [Pseudomonas syringae Cit 7]
          Length = 135

 Score = 39.3 bits (90), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/116 (20%), Positives = 55/116 (47%)

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+ + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+ 
Sbjct: 1   HMGSRMTAEPVAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDER 60

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             + I  +L+   +IAR  G A+ +   +  +++V+ + L     + V  + L  +
Sbjct: 61  TAEAITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSM 116


>gi|152978251|ref|YP_001343880.1| protein of unknown function DUF610 YibQ [Actinobacillus
           succinogenes 130Z]
 gi|150839974|gb|ABR73945.1| protein of unknown function DUF610 YibQ [Actinobacillus
           succinogenes 130Z]
          Length = 294

 Score = 39.3 bits (90), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 39/218 (17%), Positives = 100/218 (45%), Gaps = 4/218 (1%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           V A    F + A   ++AIV+  +G       + I  +P  +++A         +  ++A
Sbjct: 29  VSAQPARFVA-AQPHKLAIVIDDIGYHPKEDAQ-ILAMPKAVSVAIIPVAPYAAQRNRQA 86

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            ++G++ ++ +PMQ  +    E+   ++ ++Q  Q++  R++ + +  +   G+ N+ G+
Sbjct: 87  WQQGRDILIHMPMQPVNNMKIEEGGLSVGMSQ--QEVEQRVQRAKQIVSHAIGMNNHMGS 144

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
              ++      + +   ++GL F D  +  +++   +A    +  +   ++LDD  +   
Sbjct: 145 AATADPTLMTRLMRILQRQGLFFLDSRTIGKSVAGKIAKLEGVSVLERHVFLDDSDNFGD 204

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
           ++ + +   + AR  G AI +      +I V+   L+ 
Sbjct: 205 VQRQFQRALQHARQHGVAIVIGHPRKNTIAVLQAELRH 242


>gi|296127488|ref|YP_003634740.1| hypothetical protein Bmur_2471 [Brachyspira murdochii DSM 12563]
 gi|296019304|gb|ADG72541.1| protein of unknown function DUF610 YibQ [Brachyspira murdochii DSM
           12563]
          Length = 302

 Score = 39.3 bits (90), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 84/214 (39%), Gaps = 28/214 (13%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLL-------------PANITLAFAS 204
           P +D       S   I+I++   G +   T+R   L              P +I  ++A+
Sbjct: 67  PILDNIIKPIESSNFISIIIDDSGNTLDYTERYFKLAYEYGITFAVLPDSPHSIDFSYAA 126

Query: 205 NGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRG 264
             N +D             IL +PM+  D      +   ++      ++ N L YS  + 
Sbjct: 127 YSNDVD------------VILHMPMEGSDYF---GEKTIIRTGMNKDEVFNLLDYSFSKV 171

Query: 265 TGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVA 324
               G+ N+ G++   +      +          F D  +S  +L   LA + N+     
Sbjct: 172 PYANGMNNHTGSLACKDINIVSYMIDYAKNNNKYFVDSYTSAESLIYDLALENNVRTAKR 231

Query: 325 DLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           +++LD+  D D I ++ + L ++++  G AIG+ 
Sbjct: 232 NVFLDNDRDYDSIMKQWRELIKLSKEYGIAIGIG 265


>gi|294102438|ref|YP_003554296.1| protein of unknown function DUF610 YibQ [Aminobacterium colombiense
           DSM 12261]
 gi|293617418|gb|ADE57572.1| protein of unknown function DUF610 YibQ [Aminobacterium colombiense
           DSM 12261]
          Length = 343

 Score = 39.3 bits (90), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 81/188 (43%), Gaps = 7/188 (3%)

Query: 173 IAIVVSGLGISQTGTQR--AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           IAIV+   G S +  ++  AI+L    +T A            + A  K    ++ +PM+
Sbjct: 121 IAIVIDDFGFSYSLAEKIAAIDL---PVTWAIIPYQRFTHETARLAASKNIPYLVHMPME 177

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A  +      +  + V  +   L   +R       G  G+ N+RG+   S+K++ E + +
Sbjct: 178 ALAD--KSQGASLIGVGMSAPALSKVVRDVFALLPGAVGMNNHRGSKATSDKKTMEALME 235

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
                  +F D  +S  ++   +A    +P +   ++LD + D + +R++ +    IA+ 
Sbjct: 236 TLRPLEKVFVDSRTSSCSVAYDMALCYGIPAVYNSVFLDHEKDIEFMRKQFQRAITIAKR 295

Query: 351 TGQAIGVA 358
            G  + + 
Sbjct: 296 RGWVLAIC 303


>gi|332298458|ref|YP_004440380.1| protein of unknown function DUF610 YibQ [Treponema brennaborense
           DSM 12168]
 gi|332181561|gb|AEE17249.1| protein of unknown function DUF610 YibQ [Treponema brennaborense
           DSM 12168]
          Length = 355

 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 63/144 (43%), Gaps = 5/144 (3%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDS--YTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
           K  +  G+E +L  PMQA + + N      +       V++LL+    +L++     G+ 
Sbjct: 175 KRVRAAGKELLLHQPMQAKNLAVNPGPGAIHPDMDRDAVRKLLHS---NLQKIGPVAGMN 231

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+++  +    + +    A  G+ F D  ++       +A    +     D++LD+ 
Sbjct: 232 NHEGSLITESVTQMDAVLDVCAAEGIFFLDSRTTADTQVPAVAAARGMKIWERDIFLDNT 291

Query: 332 VDRDKIREKLKGLEEIARTTGQAI 355
            DR  I ++L     IA   G A+
Sbjct: 292 PDRRDILDQLYRGAAIANKKGYAV 315


>gi|58038808|ref|YP_190772.1| hypothetical protein GOX0333 [Gluconobacter oxydans 621H]
 gi|58001222|gb|AAW60116.1| Hypothetical protein GOX0333 [Gluconobacter oxydans 621H]
          Length = 266

 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/225 (19%), Positives = 86/225 (38%), Gaps = 18/225 (8%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IAIV+ G G S   T   ++ +PA + +  +   +++   +  A    +E  + +PMQ+ 
Sbjct: 31  IAIVLQGFGYSDALTYDVLSRIPAPVAVGISPYVSNISDIIARAHASHREVYVTLPMQSA 90

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR-------GAMLLSNKESA 285
                ++  + L    +       L + L R  G  G+ +         G    ++ + +
Sbjct: 91  HPERVDEGPHALGYGNSAADDQRELEWCLSRAAGAEGLTDASENGDDQPGGGYATSPDFS 150

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG-L 344
             I    + +GLL+    +     TR          M A  ++D   D   +  +L   L
Sbjct: 151 P-IASAISSKGLLYLAGSAQDGRRTR---------GMTATAWIDGDTDAATLDSRLAALL 200

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            +  +     + V       I+ ++ WL+    ++  VVP S  A
Sbjct: 201 PQDGKPAKILLMVGPITPVMIDRLANWLKGPAAQNFVVVPPSAFA 245


>gi|152992040|ref|YP_001357761.1| hypothetical protein SUN_0444 [Sulfurovum sp. NBC37-1]
 gi|151423901|dbj|BAF71404.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 354

 Score = 38.9 bits (89), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/164 (20%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 195 PANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLL 254
           P+++++   +   SL  +M           + +PM++    +N+    TLK + T  Q+ 
Sbjct: 171 PSHLSMKSHTLAKSLKHYM-----------IHLPMESGSRQFNKQYK-TLKTSFTKSQME 218

Query: 255 NRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLA 314
            R+R   +       + N+ G++   + ++   ++    K G +F D  +      R +A
Sbjct: 219 ARIREIRQLFPTARYINNHTGSVFTDDYKAMHTLYGIMKKEGFIFIDSRTIGTTKVRKIA 278

Query: 315 PKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
            K    Y+  D+++D+      I  +LK   +IA+  G AI + 
Sbjct: 279 YKYGDAYVARDIFIDNTQSIPYIHNQLKKAVKIAKKKGYAIAIG 322


>gi|300742559|ref|ZP_07072580.1| putative integral membrane protein [Rothia dentocariosa M567]
 gi|300381744|gb|EFJ78306.1| putative integral membrane protein [Rothia dentocariosa M567]
          Length = 406

 Score = 38.5 bits (88), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 7/111 (6%)

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPY--MVADLY--LDDQVDRD 335
           S++E AE   KE    G + F +G++P  +T   AP  N     M+  +   ++ QV + 
Sbjct: 78  SSREDAERQIKERETYGAIVFTEGAAPEVMT---APAANASANQMLTGVAQQMNAQVQQK 134

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
               K + L++  +  G+   +A    E ++   + LQQ  V+  +VVPL 
Sbjct: 135 ATAAKTQALQQAVQAGGEQGAIATQQLEQLKTEQEKLQQAQVKTTAVVPLG 185


>gi|213023020|ref|ZP_03337467.1| hypothetical protein Salmonelentericaenterica_10610 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 133

 Score = 38.1 bits (87), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 55/130 (42%), Gaps = 3/130 (2%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ +PM
Sbjct: 7   AGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIHLPM 65

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 66  APLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQKVM 123

Query: 290 KEFAKRGLLF 299
           +      L F
Sbjct: 124 QALEHYNLYF 133


>gi|237802213|ref|ZP_04590674.1| hypothetical protein POR16_25584 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025070|gb|EGI05126.1| hypothetical protein POR16_25584 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 130

 Score = 38.1 bits (87), Expect = 2.2,   Method: Composition-based stats.
 Identities = 21/101 (20%), Positives = 48/101 (47%)

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   E+
Sbjct: 11  LMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTAIEL 70

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A   G  + +   +  +++V+ + L +   + V  + L  +
Sbjct: 71  AHKQGSVVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSM 111


>gi|315633408|ref|ZP_07888699.1| exported polysaccharide deacetylase [Aggregatibacter segnis ATCC
           33393]
 gi|315477908|gb|EFU68649.1| exported polysaccharide deacetylase [Aggregatibacter segnis ATCC
           33393]
          Length = 275

 Score = 38.1 bits (87), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 37/201 (18%), Positives = 90/201 (44%), Gaps = 3/201 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  LG         I  +P  +++A         +  ++A ++G++ ++ +
Sbjct: 21  AYSAKLAIVIDDLGY-HAKEDAQILAMPKAVSVAIIPAAPYAKQRNQQAFQQGRDILIHM 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+   +   ED    L ++Q   ++ +R++ +    +   G+ N+ G+   ++      
Sbjct: 80  PMETQSKMKIEDGGLHLGMSQG--EVNHRVQTAHNIVSNAIGMNNHMGSAATADGPLMTK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +     +R L F D  +  R++   +A +  +  +   ++LDD      ++ + +   + 
Sbjct: 138 LMTALRERHLSFLDSRTIGRSVAGKMAKEQGVRTLDRHIFLDDSDAFADVQRQFQAAVQY 197

Query: 348 ARTTGQAIGVAVAFDESIEVI 368
           A+  G AI +      +I V+
Sbjct: 198 AQKHGIAIAIGHPRKNTIAVL 218


>gi|195132416|ref|XP_002010639.1| GI21654 [Drosophila mojavensis]
 gi|269969675|sp|B4L535|SWS_DROMO RecName: Full=Neuropathy target esterase sws; AltName: Full=Swiss
           cheese
 gi|193907427|gb|EDW06294.1| GI21654 [Drosophila mojavensis]
          Length = 1488

 Score = 38.1 bits (87), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 12/107 (11%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           +  NA G+ +++     G S T     I++L          +GNS       AK   +  
Sbjct: 223 YICNADGSTLSLKTVRKGESVTSLLSFIDVL----------SGNSSYYKTVTAKAMEKSV 272

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
           ++++PMQAF+E +NE+    ++V Q +   L R+ ++  R   Y G+
Sbjct: 273 VIRLPMQAFEEVFNENPDVMIRVIQVIMIRLQRVLFTALR--NYLGL 317


>gi|119953544|ref|YP_945754.1| cation transport ATPases [Borrelia turicatae 91E135]
 gi|119862315|gb|AAX18083.1| cation transport ATPases [Borrelia turicatae 91E135]
          Length = 303

 Score = 38.1 bits (87), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 28/151 (18%), Positives = 77/151 (50%), Gaps = 5/151 (3%)

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
           S+D + K A K  +  ++ +PMQ+  +  N  + + + +      +  ++  + +  +  
Sbjct: 109 SMDFYNKLASK-NKIIMIHLPMQS--KYKNSIEKFHININDNEFAIRTKIEKTFQTYSNA 165

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
             + N+ G+++ +N+   ++I  +  +    FFD  ++ ++++  +  K+ +     D++
Sbjct: 166 KIMNNHMGSLITANENIMQIILIKLKEENRYFFDSLTTQKSISAKIGKKIGIIVEQRDIF 225

Query: 328 LDDQVDRDKIREKLKGLEEIARTTG--QAIG 356
           LD++ +   + + L+  ++IART G  + IG
Sbjct: 226 LDNKDNEKAVIKALERAKQIARTKGIVKVIG 256


>gi|255524928|ref|ZP_05391876.1| transcriptional regulator, LysR family [Clostridium carboxidivorans
           P7]
 gi|255511406|gb|EET87698.1| transcriptional regulator, LysR family [Clostridium carboxidivorans
           P7]
          Length = 263

 Score = 37.7 bits (86), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 35/71 (49%)

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVP 158
           S++ +  +++ IS   + NKP R  S++     +E ++L + K   LAK  +  E    P
Sbjct: 85  SAEIEKNVKDGISDLVIFNKPNRKLSLEYEVIHQEEMLLVMHKDHPLAKKGMKIEGLRYP 144

Query: 159 AMDKNFCSNAS 169
            MD   C N +
Sbjct: 145 WMDIRLCKNEA 155


>gi|254457290|ref|ZP_05070718.1| putative periplasmic protein [Campylobacterales bacterium GD 1]
 gi|207086082|gb|EDZ63366.1| putative periplasmic protein [Campylobacterales bacterium GD 1]
          Length = 334

 Score = 37.7 bits (86), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 52/267 (19%), Positives = 115/267 (43%), Gaps = 20/267 (7%)

Query: 107 QNDISGKTVVNKPTR---------STSIDSLPTIEERLILGLSKKELLAKNKVGRE--DT 155
           +NDI  +T ++K  R         +TS     ++  RL   L K+  +       E  D 
Sbjct: 44  KNDIENQTAIDKKKRLSMLQKLEIATSKKDKSSVNTRLKDVLKKESKIDTGAAAHEYGDG 103

Query: 156 EVP----AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
            +P    A  ++    +S  ++AI++  + +       AI  L   +T++F         
Sbjct: 104 TLPEPPEAPKRDVIRTSSKPKLAIIIDDVSVR--SHVNAIKSLGIPLTMSFLPPSKLRPN 161

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
             K A K+    ++ +PM+A  ++++ ++  TL+++ +  ++  R++   +       + 
Sbjct: 162 SAKLADKENV-YMVHLPMEA--QNFSAEEPMTLRISDSDFKISQRVKDIKKEFPRVSYIN 218

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+   SN+ +   +        + F D  ++       +   L L Y+  D++LD  
Sbjct: 219 NHTGSKFTSNELAMNRLIYALKSEDINFIDSRTTADTKAPTVMKNLGLNYVARDVFLDHT 278

Query: 332 VDRDKIREKLKGLEEIARTTGQAIGVA 358
           +D+  I  ++K   ++A+  G AI + 
Sbjct: 279 MDKVSIIIQIKKAIQVAKLHGTAIAIG 305


>gi|325576789|ref|ZP_08147404.1| divergent polysaccharide deacetylase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160995|gb|EGC73113.1| divergent polysaccharide deacetylase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 280

 Score = 37.7 bits (86), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 34/203 (16%), Positives = 86/203 (42%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            ++AIV+  +G         + + P  I++A            +EAK +  + ++ +PMQ
Sbjct: 28  GKLAIVIDDIGYHPKEDAEVLAM-PKEISVAIIPAAPYAKIRNQEAKAQNHDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  E+   TL +++   Q+  R++ +        G+ N+ G+   ++      +  
Sbjct: 87  PVSNIKIEEGGLTLGLSEA--QVNERVKKAKAIVPNAIGMNNHMGSAATADATLMTYLMT 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + +   + AR 
Sbjct: 145 ALREQHLFFLDSRTIGKSVAGKIAKEQGVRVLDRHIFLDDSDNLVDVQRQFQSAIQYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      ++ V+   ++
Sbjct: 205 HGTAIAIGHPRPNTVAVLKSGIK 227


>gi|268679505|ref|YP_003303936.1| hypothetical protein Sdel_0870 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617536|gb|ACZ11901.1| protein of unknown function DUF610 YibQ [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 381

 Score = 37.7 bits (86), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 93/210 (44%), Gaps = 31/210 (14%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAF--ASNGNSLDRWMKEAKKKGQE---AILQ 226
           ++AI++    +S     R +  +P  +T AF   + G+       E  +   E   A++ 
Sbjct: 172 KLAIIIDD--VSFPWQTRLMKEIPYKVTPAFFPPTKGHP------ETVRLSHEFPFAMVH 223

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR----GAMLLSNK 282
           +P++A   S  E+D  TL  T ++  +  R++    R   +F  ++Y     G    ++ 
Sbjct: 224 LPLEAKYYSRPEED--TLNTTDSLDVIEKRIK----RIKAWFPHIHYYNNHTGGYFTADY 277

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMV----ADLYLDDQVDRDKIR 338
            + + + K      L F D     R +    AP++   Y +     D++LD+ +++  IR
Sbjct: 278 AAMDRLIKVMKDHNLSFVDS----RTVGNSKAPEVMKKYGMFLYSRDVFLDNSLEKSAIR 333

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
           ++LK     A+  G AI +      ++EV+
Sbjct: 334 KQLKEAVFKAKKYGYAIAIGHPHKNTLEVL 363


>gi|224534597|ref|ZP_03675173.1| divergent polysaccharide deacetylase family protein [Borrelia
           spielmanii A14S]
 gi|224514274|gb|EEF84592.1| divergent polysaccharide deacetylase family protein [Borrelia
           spielmanii A14S]
          Length = 288

 Score = 37.4 bits (85), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 34/189 (17%), Positives = 86/189 (45%), Gaps = 9/189 (4%)

Query: 172 RIAIVVSGLGISQTGTQRAINL-LPANITLA-FASNGNSLDRWMKEAKKKGQEAILQIPM 229
           +  +++  +G  +   ++ I L L  N  +  F     SL    K+ K   +  I+  PM
Sbjct: 69  KFYLIIDDVGYDEFMLEQFIKLNLEINYAIIPFLPKSTSL---YKKLKNNNKAVIIHFPM 125

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           Q+  +  N  + + + +    +++  ++  + +       + N+ G+++ SNK+   +I 
Sbjct: 126 QS--KHRNAIEKFHINIKDKKEEIHKKIEKTFKMYPDVKIMNNHMGSLITSNKDLMRIIL 183

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            +  +    FFD  +   ++  ++  ++ +     D++LD +  ++ +  +L+  + IAR
Sbjct: 184 IKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDSKDTKEAVLNELEKAKNIAR 243

Query: 350 TTG--QAIG 356
             G  + IG
Sbjct: 244 KHGIVKVIG 252


>gi|301155117|emb|CBW14581.1| predicted polysaccharide deacetylase [Haemophilus parainfluenzae
           T3T1]
          Length = 280

 Score = 37.0 bits (84), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 34/203 (16%), Positives = 86/203 (42%), Gaps = 3/203 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            ++AIV+  +G         I  +P  I++A            ++AK +  + ++ +PMQ
Sbjct: 28  GKLAIVIDDIG-YHPKEDAEILAMPKEISVAIIPAAPYAKIRNQQAKAQNHDILIHMPMQ 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                  E+   TL +++   Q+  R++ +        G+ N+ G+   ++      +  
Sbjct: 87  PVSNIKIEEGGLTLGLSEA--QVNERVKKAKSIVPNAIGMNNHMGSAATADTTLMTYLMS 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + +   + AR 
Sbjct: 145 ALREQHLFFLDSRTIGKSVAGKIAKEQGVRVLDRHIFLDDSDNLVDVQRQFQNAIQYARK 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQ 373
            G AI +      ++ V+   ++
Sbjct: 205 HGTAIAIGHPRPNTVAVLKSGIK 227


>gi|212705014|ref|ZP_03313142.1| hypothetical protein DESPIG_03082 [Desulfovibrio piger ATCC 29098]
 gi|212671566|gb|EEB32049.1| hypothetical protein DESPIG_03082 [Desulfovibrio piger ATCC 29098]
          Length = 422

 Score = 37.0 bits (84), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 41/197 (20%), Positives = 79/197 (40%), Gaps = 10/197 (5%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF---DESYNEDDSYTLKVTQTV 250
           LP  + LA   +        + A+  G + +L +PM+A    + +        L+     
Sbjct: 212 LPFPVALALWPHAAVRRSVQQVARDMGLDVLLHMPMEAMPRKNGTAPNPGPGALETDMDA 271

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
             + + L  +L +     G  N+ G+     +++  ++      RGL   D  S  R  +
Sbjct: 272 YAMEHALDKALAQVPTALGFNNHMGSGFTGQRDACRMLAGLAYGRGLFVLD--SVTRGNS 329

Query: 311 RVLAPKLNLPYMVA--DLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
           ++    +    + A   ++LDD    DK+   L     +AR  G AI +      ++  +
Sbjct: 330 QLENSMVRQGIVTASRHVFLDDPQGTDKVLAALDKAARLARKQGIAIAIGHPHASTLRAL 389

Query: 369 SQWLQQEHVRDVSVVPL 385
            +W  +E    V+VVPL
Sbjct: 390 ERWENRE---GVAVVPL 403


>gi|225619872|ref|YP_002721129.1| putative divergent polysaccharide deacetylase [Brachyspira
           hyodysenteriae WA1]
 gi|225214691|gb|ACN83425.1| putative divergent polysaccharide deacetylase [Brachyspira
           hyodysenteriae WA1]
          Length = 302

 Score = 37.0 bits (84), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 89/220 (40%), Gaps = 27/220 (12%)

Query: 150 VGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLL-PANITLAFASNGNS 208
           V   DT  P ++K    N     I+I++   G +   + R   L    NIT A   +   
Sbjct: 66  VNSPDTAKPILNK---INEHSNCISIIIDDSGNTLDNSDRYFYLANEYNITFAVLPDSYH 122

Query: 209 LDRWMKEAKKKGQEAILQIPMQAFD---------ESYNEDDSYTLKVTQTVQQLLNRLRY 259
              +   A       IL IPM+  D         +  NED+ + L            L Y
Sbjct: 123 STDFSYAAYSNNVNIILHIPMEGSDYFGEQTLIRKGMNEDEIFRL------------LDY 170

Query: 260 SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN-LTRVLAPKLN 318
           S  +     G+ N+ G+ + S+ ES      ++AK    +F D  +  + L   +A +  
Sbjct: 171 SFSKVPYANGMNNHTGS-VASSDESVVSYMLDYAKNNDKYFVDSYTVSDSLIYDMAIEYG 229

Query: 319 LPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           +      ++LD++ D   I ++ + L ++++  G A+G+ 
Sbjct: 230 VKTARRSVFLDNERDHSSIMKQWRELIKLSKEYGIAVGIG 269


>gi|256827728|ref|YP_003151687.1| NlpC/P60 family protein [Cryptobacterium curtum DSM 15641]
 gi|256583871|gb|ACU95005.1| NlpC/P60 family protein [Cryptobacterium curtum DSM 15641]
          Length = 371

 Score = 37.0 bits (84), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 207 NSLDRWMKEAKKKGQEAILQ--IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRG 264
           N++   + EA  K QEA+ +     QA DE+  + D  T  +TQ  ++L  R+R   R G
Sbjct: 63  NAMQDSLDEASDKYQEALDEQNAAQQAMDEAQRQVDEATANITQMQKRLSTRVRSMYRTG 122

Query: 265 TGYF 268
           +G F
Sbjct: 123 SGTF 126


>gi|325289668|ref|YP_004265849.1| protein of unknown function DUF610 YibQ [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324965069|gb|ADY55848.1| protein of unknown function DUF610 YibQ [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 282

 Score = 36.6 bits (83), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 38/205 (18%), Positives = 88/205 (42%), Gaps = 3/205 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +IA+++   G ++ G    I  +  ++T A             EA K+G E I+ +PMQ+
Sbjct: 59  KIAVIIDDFGEARDGVNE-IMKIKKHLTFAVMPFLTYTTSDATEAHKRGYEVIVHMPMQS 117

Query: 232 FD-ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
              ++ N      + +  +  ++    + S+       GV  + G++   N+     + +
Sbjct: 118 QTVDNINWLGRRPIMLKTSNDEIKKIAKESIDSVPHAVGVNIHMGSLASQNERVISNVME 177

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD-RDKIREKLKGLEEIAR 349
               R L F D  ++P  + + +A +  + ++  +++L+     +  I  +L    E+A 
Sbjct: 178 VVKARNLYFVDSRTTPNTVCKAVAKRFGVKFLQRNIFLEHSSKTKGYIEGQLVEAGELAL 237

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQ 374
             G A+ +     E   + +Q L++
Sbjct: 238 KEGYAVVIGHVGAEGGAITAQVLEE 262


>gi|212632982|ref|YP_002309507.1| hypothetical protein swp_0073 [Shewanella piezotolerans WP3]
 gi|212554466|gb|ACJ26920.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 247

 Score = 36.6 bits (83), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 40/202 (19%), Positives = 90/202 (44%), Gaps = 6/202 (2%)

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
           +A+  LP ++TL+             +A ++G E ++ +PMQA +       + T  +++
Sbjct: 34  KAVLALPPSVTLSVLPLTPLGKAVATKAHQQGSEILVHLPMQALNGKTIGPGALTNAMSE 93

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
             Q    +L  ++       G  N+ G++L    +    +     +R + F D  ++   
Sbjct: 94  --QDFKLQLEQAIDSVPFASGANNHMGSLLTQLDKPMHWVMDTLLQRDIYFIDSVTTKFT 151

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA--FDESIE 366
               +A  + +P +   ++LD+  D+     +L+  + IA T  Q   V +A  + E++ 
Sbjct: 152 QAGAVAESVGVPLLKRTIFLDN--DKTDAGLELQFQKAIALTKTQTDVVVIAHPYPETLT 209

Query: 367 VISQWLQQEHVRDVSVVPLSCL 388
            ++  L +    ++++VP S L
Sbjct: 210 FLNNNLHRLAQANIALVPPSKL 231


>gi|157816414|gb|ABV82201.1| GH25996p [Drosophila melanogaster]
          Length = 1425

 Score = 36.6 bits (83), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 51/107 (47%), Gaps = 12/107 (11%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + SNA G+ +++     G S T     I++L  N +        ++++            
Sbjct: 222 YISNADGSTLSLKTVRKGESVTSLLSFIDVLSGNPSYYKTVTAKAIEK----------SV 271

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
           ++++PMQAF+E + ++    ++V Q +   L R+ ++  R   YFG+
Sbjct: 272 VIRLPMQAFEEVFQDNPDVMIRVIQVIMIRLQRVLFTALR--NYFGL 316


>gi|111115601|ref|YP_710219.1| hypothetical protein BAPKO_0818 [Borrelia afzelii PKo]
 gi|110890875|gb|ABH02043.1| hypothetical protein BAPKO_0818 [Borrelia afzelii PKo]
          Length = 293

 Score = 36.6 bits (83), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 32/183 (17%), Positives = 84/183 (45%), Gaps = 7/183 (3%)

Query: 172 RIAIVVSGLGISQTGTQRAINL-LPANITLA-FASNGNSLDRWMKEAKKKGQEAILQIPM 229
           +  +++  +G  +   ++ I L L  N  +  F     SL    K+ K   +  I+  PM
Sbjct: 74  KFYLIIDDVGYDEFMLEQFIKLNLEINYAIIPFLPKSTSL---YKKLKNNNKTVIIHFPM 130

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           Q+  +  N  + + + +    +++  ++  + +       + N+ G+++ SNK+  ++I 
Sbjct: 131 QS--KHRNAIEKFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDLMKIIL 188

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            +  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + IAR
Sbjct: 189 IKLKEIDRYFFDSVTIAGSIPEIIGKEIGVRVEKRDVFLDSKDTEEAVLKELEKAKNIAR 248

Query: 350 TTG 352
             G
Sbjct: 249 KHG 251


>gi|51599020|ref|YP_073208.1| hypothetical protein BG0793 [Borrelia garinii PBi]
 gi|51573591|gb|AAU07616.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 288

 Score = 36.6 bits (83), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/145 (17%), Positives = 71/145 (48%), Gaps = 4/145 (2%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           K+ K   +  I+  PMQ+  +  N  + + + +    +++  ++  + +       + N+
Sbjct: 110 KKLKNNNKTIIIHFPMQS--KHRNSIEKFHINIKDKKEEIYKKIEKTFKMYPDAKIMNNH 167

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+++ SNK+  ++I  +  +    FFD  +   ++  ++  ++ +     D++LD++  
Sbjct: 168 MGSLITSNKDLMKIILIKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDNKDT 227

Query: 334 RDKIREKLKGLEEIARTTG--QAIG 356
            + + ++L+  + IAR  G  + IG
Sbjct: 228 EESVLKELEKAKNIARKHGIVKVIG 252


>gi|187918622|ref|YP_001884187.1| cation transport ATPases [Borrelia hermsii DAH]
 gi|119861470|gb|AAX17265.1| cation transport ATPases [Borrelia hermsii DAH]
          Length = 297

 Score = 36.6 bits (83), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 44/81 (54%)

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+++ SN++  ++I  +  +    FFD  ++  +++      + +     D++LD++
Sbjct: 175 NHMGSLITSNEDIMQIILIKLKEENRYFFDSLTTQESISEKTGKNIGILVEQRDIFLDNK 234

Query: 332 VDRDKIREKLKGLEEIARTTG 352
            +   + + LK  ++IART G
Sbjct: 235 DNEKAVIQALKRAKQIARTKG 255


>gi|291279748|ref|YP_003496583.1| hypothetical protein DEFDS_1366 [Deferribacter desulfuricans SSM1]
 gi|290754450|dbj|BAI80827.1| hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 357

 Score = 36.6 bits (83), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/114 (20%), Positives = 55/114 (48%)

Query: 269 GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYL 328
           G  N+ G+ L  ++E    +  E      +F D  +S + +   +  KLN+   + + ++
Sbjct: 236 GANNHMGSALTESREKMFEVLNELKNYTDIFVDSHTSSKTVAYNVCKKLNMRCGLNNKFI 295

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
           D+  D++ I+E L     + +   + I +    + +IEV+S+ L +   +++ +
Sbjct: 296 DNIDDKNSIKEILYKSLSLFQKQDKVIIIGHLKENTIEVLSEELPKISKKNIKI 349


>gi|216263687|ref|ZP_03435682.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           afzelii ACA-1]
 gi|215980531|gb|EEC21352.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           afzelii ACA-1]
          Length = 293

 Score = 36.6 bits (83), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 32/183 (17%), Positives = 84/183 (45%), Gaps = 7/183 (3%)

Query: 172 RIAIVVSGLGISQTGTQRAINL-LPANITLA-FASNGNSLDRWMKEAKKKGQEAILQIPM 229
           +  +++  +G  +   ++ I L L  N  +  F     SL    K+ K   +  I+  PM
Sbjct: 74  KFYLIIDDVGYDEFMLEQFIKLNLEINYAIIPFLPKSTSL---YKKLKNNNKTVIIHFPM 130

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           Q+  +  N  + + + +    +++  ++  + +       + N+ G+++ SNK+  ++I 
Sbjct: 131 QS--KHRNAIEKFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDLMKIIL 188

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            +  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + IAR
Sbjct: 189 IKLKEIDRYFFDSVTIAGSIPEIIGKEIGVRVEKRDVFLDSKDTEEAVLKELEKAKNIAR 248

Query: 350 TTG 352
             G
Sbjct: 249 KHG 251


>gi|219684182|ref|ZP_03539126.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii PBr]
 gi|219672171|gb|EED29224.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii PBr]
          Length = 292

 Score = 36.2 bits (82), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/145 (17%), Positives = 71/145 (48%), Gaps = 4/145 (2%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           K+ K   +  I+  PMQ+  +  N  + + + +    +++  ++  + +       + N+
Sbjct: 114 KKLKNNNKTIIIHFPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNH 171

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+++ SNK+  ++I  +  +    FFD  +   ++  ++  ++ +     D++LD++  
Sbjct: 172 MGSLITSNKDLMKIILIKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDNKDT 231

Query: 334 RDKIREKLKGLEEIARTTG--QAIG 356
            + + ++L+  + IAR  G  + IG
Sbjct: 232 EESVLKELEKAKNIARKHGIVKVIG 256


>gi|219685601|ref|ZP_03540417.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii Far04]
 gi|219672879|gb|EED29902.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii Far04]
          Length = 292

 Score = 36.2 bits (82), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/145 (17%), Positives = 71/145 (48%), Gaps = 4/145 (2%)

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           K+ K   +  I+  PMQ+  +  N  + + + +    +++  ++  + +       + N+
Sbjct: 114 KKLKNNNKTIIIHFPMQS--KHRNSIEKFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNH 171

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+++ SNK+  ++I  +  +    FFD  +   ++  ++  ++ +     D++LD++  
Sbjct: 172 MGSLITSNKDLMKIILIKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDNKDT 231

Query: 334 RDKIREKLKGLEEIARTTG--QAIG 356
            + + ++L+  + IAR  G  + IG
Sbjct: 232 EESVLKELEKAKNIARKHGIVKVIG 256


>gi|218961345|ref|YP_001741120.1| hypothetical protein CLOAM1042 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730002|emb|CAO80914.1| hypothetical protein CLOAM1042 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 357

 Score = 36.2 bits (82), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 45/249 (18%), Positives = 100/249 (40%), Gaps = 27/249 (10%)

Query: 161 DKNFCSNASGAR-IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
           D N   N    R I IVV   G            L   +  +         + MK AK++
Sbjct: 118 DNNLYRNKQKKRTITIVVDDFGTIGGDLLTGFLALDKEVCFSIFPEEEYSVQTMKLAKEQ 177

Query: 220 GQEAILQIPMQ--AFDE----------SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
           G+  ++ IPM+   + E           Y+E      ++ + + + + +L Y +      
Sbjct: 178 GRLTLIHIPMEPIGYPEVNPGKNPILVQYDER-----QIEKIMTRFIEQLPYCV------ 226

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            G  N+ G++  +++E    +     K    F D  ++  ++   +A K +L     DL+
Sbjct: 227 -GANNHMGSLATTDEEVMNSVMAILKKHNKFFLDSRTTNVSVAYSVAQKNHLKSYRNDLF 285

Query: 328 LDD-QVDRDKIREKLKGLEEIARTTGQAIGVAVAFD-ESIEVISQWLQQEHVRDVSVVPL 385
           LD   + +  +  KL  + E++      I +    + + ++ + +++ +      +++PL
Sbjct: 286 LDSPNISQSTMDAKLNQIIELSNRNQNVIAITHCHNYDKLDYLKRFINRLKAAGFTLIPL 345

Query: 386 SCLAKLSSP 394
           + + K + P
Sbjct: 346 TDIDKYNVP 354


>gi|169602553|ref|XP_001794698.1| hypothetical protein SNOG_04280 [Phaeosphaeria nodorum SN15]
 gi|111066920|gb|EAT88040.1| hypothetical protein SNOG_04280 [Phaeosphaeria nodorum SN15]
          Length = 395

 Score = 36.2 bits (82), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%)

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
           +D+Y     + V  L N LRY+++     F V   +   L    +     F+   +RG L
Sbjct: 76  EDTYAASFQKLVNALFNNLRYNVKVSHSAFRVFKSKAQQLKDKYQRMFENFESHRERGEL 135

Query: 299 FFDDGSSP 306
           F+DD  +P
Sbjct: 136 FYDDMDNP 143


Searching..................................................done


Results from round 2




>gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040235|gb|ACT57031.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 396

 Score =  482 bits (1240), Expect = e-134,   Method: Composition-based stats.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY
Sbjct: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
           SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT
Sbjct: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
           RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL
Sbjct: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD
Sbjct: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
           SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF
Sbjct: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA
Sbjct: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
Sbjct: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396


>gi|209551457|ref|YP_002283374.1| hypothetical protein Rleg2_3886 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537213|gb|ACI57148.1| protein of unknown function DUF610 YibQ [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 397

 Score =  355 bits (911), Expect = 6e-96,   Method: Composition-based stats.
 Identities = 145/409 (35%), Positives = 209/409 (51%), Gaps = 30/409 (7%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMI 58
           M  DL+ PL +   ++       + RLG +    C F I G S+Y     AF G   E  
Sbjct: 1   MGTDLHAPLGRN--RKAGSRRPGVLRLGRIAASLCLFAIGGFSLYT----AFRGDGLERT 54

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVN 117
                 + A  P   P        P     N   + +     +    ++  ++G  +VV 
Sbjct: 55  KPPA-EQAATPPSNTP-------QPPTTTANQAADGMPRAEPRSGANVEQMVTGDGSVVT 106

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKE-------LLAKNKVGREDTEVP----AMDK--NF 164
           K +      S P + + + +G   +        LL     GR     P     MD+    
Sbjct: 107 KYSPRPRDGSGPVLVDAMQIGQDPRMAAQPNEALLEDTPFGRLPIVGPDGRRPMDQYARP 166

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G RIAIVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +
Sbjct: 167 SSGARGVRIAIVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEIL 226

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+P++ FD   N+    TL  T+ V + +  L  ++   T Y GVMNY G   LS+  +
Sbjct: 227 LQVPLEPFDYPANDPGPETLLTTKPVARNIENLHKAMGEITNYTGVMNYLGGRFLSDSTA 286

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  L
Sbjct: 287 MEPVMRDIGKRGLLFLDDGTSAQSKTADVAKGTELPYAFADLQLDGQLDINAVLKKLDEL 346

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           E IAR  GQAIGVA AFDES++ I++W ++  +R + +V ++ L+    
Sbjct: 347 ERIARKNGQAIGVASAFDESVDAIAKWSEEAAMRGIEIVGVAALSNDPR 395


>gi|241206894|ref|YP_002977990.1| hypothetical protein Rleg_4210 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860784|gb|ACS58451.1| protein of unknown function DUF610 YibQ [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 398

 Score =  347 bits (890), Expect = 2e-93,   Method: Composition-based stats.
 Identities = 142/409 (34%), Positives = 206/409 (50%), Gaps = 29/409 (7%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMI 58
           M  DL+ PL +   ++         RLG +    C F I G S+Y     AF G   E  
Sbjct: 1   MGTDLHTPLGRN--RKTGRKRPGFLRLGRIAASLCLFAIGGFSLYT----AFRGDGLERT 54

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVN 117
                 + AP P   P                  + +     +    ++  ++G  +VV 
Sbjct: 55  KPPAAEQAAPPPANTPQPPTAT-------TGQTADGMPRADPRSGANVEQMVTGDGSVVT 107

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKE-------LLAKNKVGREDTEVP----AMDK--NF 164
           K +        P + + + +G   +        LL +   GR     P     MD+    
Sbjct: 108 KYSPRPRDGGGPVLVDAMQIGQDPRMAAQPNDALLEETPFGRLPIVGPDGRRPMDQYARP 167

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G RIAIVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +
Sbjct: 168 SSGARGVRIAIVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEIL 227

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+P++ FD   N+    TL  T+   + +  L  ++   T Y GVMNY G   LS+  +
Sbjct: 228 LQVPLEPFDYPANDPGPETLLTTKPAARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAA 287

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  L
Sbjct: 288 MEPVMRDIGKRGLLFLDDGTSAQSKTAAIAKGTELPYAFADLQLDGQLDINAVLKKLDEL 347

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           E IAR  GQAIGVA AFDES++ I++W ++  +R + +V ++ L+    
Sbjct: 348 ERIARKNGQAIGVASAFDESVDAIAKWSEEAAMRGIEIVGVAALSNDPR 396


>gi|116254417|ref|YP_770255.1| polysaccharide deacetylase protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259065|emb|CAK10176.1| putative polysaccharide deacetylase protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 388

 Score =  345 bits (886), Expect = 6e-93,   Method: Composition-based stats.
 Identities = 138/395 (34%), Positives = 201/395 (50%), Gaps = 29/395 (7%)

Query: 15  KRKSFYSQIISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT 72
           ++       I RLG +    C F I G S+Y     AF G   E        + A  P  
Sbjct: 5   RKTGSRRPGILRLGRIAASLCLFAIGGFSLYT----AFRGDELERTKPPTGEQAATPPAN 60

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTI 131
            P                  + +     +    ++  ++G  +VV K +  T     P +
Sbjct: 61  TPQP---------PTAGQAADGMPRADPRSGANVEQMVTGDGSVVTKYSPRTRDGGGPVL 111

Query: 132 EERLILGLSKKE-------LLAKNKVGREDTEVP----AMDK--NFCSNASGARIAIVVS 178
            + + +G   +        LL +   GR     P     MD+     S A G RIAIVVS
Sbjct: 112 VDAMQIGQDPRMAAQPNEALLEETPFGRLPIVGPDGRRPMDQYARPSSGARGVRIAIVVS 171

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
           GLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+
Sbjct: 172 GLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPAND 231

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
               TL  T++  + +  L  ++   T Y GVMNY G   LS+  + E + ++  KRGLL
Sbjct: 232 PGPETLLTTKSAARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLL 291

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  LE IAR  GQAIGVA
Sbjct: 292 FLDDGTSAQSKTAAIAKGTELPYAFADLQLDGQLDINAVLKKLDELERIARKNGQAIGVA 351

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            AFDES++ I++W ++  +R + +V ++ L+    
Sbjct: 352 SAFDESVDAIAKWSEEAAMRGIEIVGVAALSNDPR 386


>gi|190893932|ref|YP_001980474.1| hypothetical protein RHECIAT_CH0004369 [Rhizobium etli CIAT 652]
 gi|190699211|gb|ACE93296.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 388

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 140/395 (35%), Positives = 202/395 (51%), Gaps = 29/395 (7%)

Query: 15  KRKSFYSQIISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT 72
           ++       + RLG +    C F I G S+Y     AF G   E        + A   L+
Sbjct: 5   RKTGSRRPGVLRLGRIAASLCLFAIGGFSLYT----AFRGEGLERAKPPATEQAASQTLS 60

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTI 131
            P              +   N +     +    ++  I+G  +VV K +      S P +
Sbjct: 61  KPPTATA---------DQAANGMPRADPRSGANVEQMITGDGSVVTKYSPRPRDGSGPVL 111

Query: 132 EERLILGLSKKE-------LLAKNKVGREDTEVP----AMDK--NFCSNASGARIAIVVS 178
            + + +G   +        LL     GR     P     MD+     S   G RIAIVVS
Sbjct: 112 VDAMQIGQDPRMAAQPNEALLEDTAFGRLPIVGPDGRRPMDQYARPSSGVRGIRIAIVVS 171

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
           GLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+
Sbjct: 172 GLGLSQTGTQRAIAELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPAND 231

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
               TL  ++ V + +  L  ++   T Y GVMNY G   LS+  + E + ++  KRGLL
Sbjct: 232 PGPETLLTSKPVARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLL 291

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F DDG+S ++ T  +A    LPY  ADL LD Q+D + I EKL  LE IAR  GQAIG+A
Sbjct: 292 FLDDGTSAQSKTATVAKGAELPYAFADLQLDGQLDINAILEKLDELERIARKNGQAIGIA 351

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            AFDES++ I++W ++  +R + +V ++ L+    
Sbjct: 352 SAFDESVDAIAKWSEEASMRGIEIVGVAALSNDPR 386


>gi|86359657|ref|YP_471549.1| hypothetical protein RHE_CH04079 [Rhizobium etli CFN 42]
 gi|86283759|gb|ABC92822.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 377

 Score =  343 bits (879), Expect = 3e-92,   Method: Composition-based stats.
 Identities = 137/386 (35%), Positives = 205/386 (53%), Gaps = 27/386 (6%)

Query: 24  ISRLG-LFLLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQ 81
           + RLG +    C F I G S+Y     AF G   E        + A    + P       
Sbjct: 1   MLRLGRIAASLCLFAIGGFSLYT----AFRGDGLERKKPPATEQAAAPSSSTP------- 49

Query: 82  SPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTIEERLILG-- 138
            P++       + +     +    ++  ++G  +VV K +      S P + + + +G  
Sbjct: 50  QPAQTPAGQAADGMPRAEPRSGANVEQMVTGDGSVVTKYSPRPRDGSGPVLVDAMQIGQD 109

Query: 139 -----LSKKELLAKNKVGREDTEVP----AMDK--NFCSNASGARIAIVVSGLGISQTGT 187
                L  + LL  +  GR     P     MD+     S A G R+AIVVSGLG+SQTGT
Sbjct: 110 PRMAALPNETLLEDSAYGRLPIVGPDGRRPMDQYARPSSGARGVRVAIVVSGLGLSQTGT 169

Query: 188 QRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT 247
           QRAI  LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  +
Sbjct: 170 QRAIAELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTS 229

Query: 248 QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPR 307
           + V + +  L  ++   T Y G++NY G   LS+  + E I ++  KRGLLF DDG+S +
Sbjct: 230 KPVARNIENLHKAMGEITNYTGILNYLGGRFLSDPAAMEPIMRDIGKRGLLFLDDGTSAQ 289

Query: 308 NLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
           + T  +A    LPY  ADL LD Q+D + I +KL  LE +AR  GQAIG+A AFDES++ 
Sbjct: 290 SKTADVAKGTELPYAFADLQLDGQLDVNAILKKLDELERVARKNGQAIGIASAFDESVDA 349

Query: 368 ISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I++W ++  +R + +V ++ L+K   
Sbjct: 350 IAKWSEEASMRGIEIVGVAALSKDPR 375


>gi|218515367|ref|ZP_03512207.1| hypothetical protein Retl8_17560 [Rhizobium etli 8C-3]
          Length = 367

 Score =  338 bits (868), Expect = 7e-91,   Method: Composition-based stats.
 Identities = 138/378 (36%), Positives = 196/378 (51%), Gaps = 28/378 (7%)

Query: 31  LLFCTF-IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNN 89
              C F IVG S+Y     AF G   E        + A   L+ P              +
Sbjct: 1   ASLCLFAIVGFSLYT----AFRGEGLERAKPPATEQAASQTLSKPPTATA---------D 47

Query: 90  TVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTIEERLILGLSKKE----- 143
              N +     +    ++  I+G  +VV K +      S P + + + +G   +      
Sbjct: 48  QAANGMPRADPRSGANVEQMITGDGSVVTKYSPRPRDGSGPVLVDAMQIGQDPRMAAQPN 107

Query: 144 --LLAKNKVGREDTEVP----AMDK--NFCSNASGARIAIVVSGLGISQTGTQRAINLLP 195
             LL     GR     P     MD+     S   G RIAIVVSGLG+SQTGTQRAI  LP
Sbjct: 108 EALLEDTAFGRLPIVGPDGRRPMDQYARPSSGVRGIRIAIVVSGLGLSQTGTQRAIAELP 167

Query: 196 ANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLN 255
             ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ V + + 
Sbjct: 168 EEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKPVARNIE 227

Query: 256 RLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAP 315
            L  ++   T Y GVMNY G   LS+  + E + ++  KRGLLF DDG+S ++ T  +A 
Sbjct: 228 NLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLLFLDDGTSAQSKTATVAK 287

Query: 316 KLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQE 375
              LPY  ADL LD Q+D + I EKL  LE IAR  GQAIG+A AFDES++ I++W ++ 
Sbjct: 288 GAELPYAFADLQLDGQLDINAILEKLDELERIARKNGQAIGIASAFDESVDAIAKWSEEA 347

Query: 376 HVRDVSVVPLSCLAKLSS 393
            +R + +V ++ L+    
Sbjct: 348 SMRGIEIVGVAALSNDPR 365


>gi|153008397|ref|YP_001369612.1| hypothetical protein Oant_1063 [Ochrobactrum anthropi ATCC 49188]
 gi|151560285|gb|ABS13783.1| protein of unknown function DUF610 YibQ [Ochrobactrum anthropi ATCC
           49188]
          Length = 407

 Score =  337 bits (864), Expect = 2e-90,   Method: Composition-based stats.
 Identities = 120/410 (29%), Positives = 188/410 (45%), Gaps = 27/410 (6%)

Query: 3   IDLNHPLR--KKTPKRKSFYSQIISRL--GLFLLFCTFIVGLSIYILISH---AFVGTIS 55
           +DLN PL   KK  KR    S+       GL +L    + G +++ +  +   AF  T +
Sbjct: 2   LDLNSPLGLDKKPQKRGGSRSRAFRSFMTGLVILGGLCLAGGAVFAIWQNNQAAFRKTET 61

Query: 56  EMI-------PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
             +       P +   E  P+    P      +  S +    +     +      G    
Sbjct: 62  AAVDPTQIEAPVANKTEAKPVTGNTPPPGSALRGASGQPGPAIIKVTPDMPPGMPGAATG 121

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF---- 164
              G  VV + T  +        +++ +  L ++ L+ ++  G          +      
Sbjct: 122 MAEGNVVVVQNTHQSG-------QDKRVAHLPEQALVEQSPTGPLPVRGADGLRPMDAYA 174

Query: 165 --CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S A GARIAIV+ GLG+SQTG+  A++ LP  +TL FA  GNSL RWM+ A++ G E
Sbjct: 175 AGWSGARGARIAIVIGGLGLSQTGSMEAVDKLPPEVTLGFAPQGNSLQRWMQAARQNGHE 234

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +LQ+PM+ FD         TL V     +    L ++L R T Y GVMNY GA   S  
Sbjct: 235 LVLQLPMEPFDYPRINPGRNTLTVDDGASKNQAFLLWALSRMTNYAGVMNYMGARFTSET 294

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           E+   +  E  KRGL + DDG+S R+    +A    +P+  AD+ +D   +R  I ++L 
Sbjct: 295 EAFSPVLGEIGKRGLYYLDDGTSARSQADRIAGSDAVPFAAADILIDAAQERGAILDRLD 354

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            LE  AR  G AIG   AF  +++ +++W  +   R + +VP+S L +  
Sbjct: 355 ELERTARANGSAIGTGSAFAVTVDAVAEWANEVKKRGIEIVPVSALVRDP 404


>gi|15966920|ref|NP_387273.1| hypothetical protein SMc03784 [Sinorhizobium meliloti 1021]
 gi|307301692|ref|ZP_07581451.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           BL225C]
 gi|15076193|emb|CAC47746.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306903390|gb|EFN33979.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           BL225C]
          Length = 400

 Score =  330 bits (846), Expect = 2e-88,   Method: Composition-based stats.
 Identities = 141/407 (34%), Positives = 204/407 (50%), Gaps = 25/407 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M+ DLN PL +   +  +        LG  L +C   +G    I IS       S + P 
Sbjct: 1   MATDLNAPLGQNRKESPARKR----DLGRVLRYCGLGLGALAVIGIS-----AWSALSPG 51

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVVNK 118
              R  A +P      +  + +PS          L    +     +++ ++  G TV   
Sbjct: 52  HQTRSPA-MPAATEATLATEPAPSSEGQGNGPGALHRSGALSGAHVEDVLTDDGATVRKY 110

Query: 119 PTRSTSIDSLPTIE-------ERLILGLSKKELLAKNKVGREDTEVPAMDKN------FC 165
             RS        I+       +  +  L  + LL     GR     P   +         
Sbjct: 111 TPRSRETGGPALIDVEATRGQDPRMAALPNESLLEDRPEGRLPVIGPDGLRPMEQYARPW 170

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E +L
Sbjct: 171 SGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEILL 230

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           Q+PM+ FD + N+   + L+V+    + L  L  S+ + T Y GVMNY G   LSN ++ 
Sbjct: 231 QVPMEPFDYATNDPGPHALRVSSDAGKNLAELHRSMGQITNYTGVMNYLGGRFLSNADAL 290

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           E + ++  KRGLLF DDG+S ++L+  LA    +P+  ADL LD ++ R+ +  +L  LE
Sbjct: 291 EPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFEVPHGFADLVLDGELSRNAVLRRLDELE 350

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            IAR  G AIGVA AFDES+  I++W ++   R + VV ++ L K  
Sbjct: 351 RIARRNGTAIGVASAFDESVAAIAEWFEEAGGRGIEVVGVAALVKDP 397


>gi|307316285|ref|ZP_07595729.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           AK83]
 gi|306898125|gb|EFN28867.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           AK83]
          Length = 400

 Score =  330 bits (845), Expect = 3e-88,   Method: Composition-based stats.
 Identities = 141/407 (34%), Positives = 205/407 (50%), Gaps = 25/407 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M+ DLN PL +   +  +        LG  L +C   +G    I IS       S + P 
Sbjct: 1   MATDLNAPLGQNRKESPARKR----DLGRVLRYCGLGLGALAVIGIS-----AWSALSPG 51

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVVNK 118
              R  A +P      +  + +PS          L    +     +++ ++  G TV   
Sbjct: 52  HQTRSPA-MPAATEATLATEPAPSSEGQGNGPGALHRSGALSGAHVEDVLTDDGATVRKY 110

Query: 119 PTRSTSIDSLPTIE-------ERLILGLSKKELLAKNKVGREDTEVPAMDKN------FC 165
             RS        I+       +  +  L  + LL     GR     P   +         
Sbjct: 111 TPRSRETGGPALIDVEATRGQDPRMAALPNESLLEDRPEGRLPVIGPDGLRPMEQYARPW 170

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E +L
Sbjct: 171 SGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEILL 230

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           Q+PM+ FD + N+   + L+V+    + L  L  S+ + T Y GVMNY G   LSN ++ 
Sbjct: 231 QVPMEPFDYATNDPGPHALRVSSDAGKNLAELHRSMGQITNYTGVMNYLGGRFLSNADAL 290

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           E + ++  KRGLLF DDG+S ++L+  LA    +P+  ADL LD ++ R+ +  +L+ LE
Sbjct: 291 EPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFEVPHGFADLVLDGELSRNAVLRRLEELE 350

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            IAR  G AIGVA AFDES+  I++W ++   R + VV ++ L K  
Sbjct: 351 RIARRNGTAIGVASAFDESVAAIAEWFEEAGGRGIEVVGVAALVKDP 397


>gi|85713722|ref|ZP_01044712.1| hypothetical protein NB311A_04259 [Nitrobacter sp. Nb-311A]
 gi|85699626|gb|EAQ37493.1| hypothetical protein NB311A_04259 [Nitrobacter sp. Nb-311A]
          Length = 400

 Score =  325 bits (832), Expect = 1e-86,   Method: Composition-based stats.
 Identities = 119/410 (29%), Positives = 196/410 (47%), Gaps = 33/410 (8%)

Query: 4   DLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           DL+ PL +   P+R+  +   + +   FLL    +V L  ++  +H  +G   E +   V
Sbjct: 7   DLSMPLGQNSAPRRRLRFPFTLPQAAGFLLGSILVVFLG-FVFFNHDPLG--GEPVARVV 63

Query: 63  IREIAPIPLTIPLNIEDKQS--PSKRDNNTVCNQLKNDSSQHDGQIQNDISG---KTVVN 117
           IR         P++ E   +  P+ +  ++     ++ + Q    I +  SG     VV 
Sbjct: 64  IRH-------TPVSDEKSAATRPASQQPDSAAVATRSATGQKTITIIDGSSGSRQDVVVA 116

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG------- 170
            P      D+     E    G+ ++ LL K++ G          K F + A G       
Sbjct: 117 GPDS----DAADARSEAAATGIHQR-LLEKSRYGMIPVVAADGLKAFKAYAMGTEADRAK 171

Query: 171 ----ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                 +AIVVSGLGI  T T  AI  LP+ +TLAF    +   + +++A+ +  E +LQ
Sbjct: 172 AATMPVVAIVVSGLGIGTTKTIDAIMKLPSAVTLAFTPYSSDPGKLVEQARAQHHEVLLQ 231

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+  D   N+    TL  T    Q ++RL + L R  GY G+ N+ GA  ++   + +
Sbjct: 232 LPMEPHDYPDNDPGPQTLLTTLGTDQNIDRLHWQLSRFQGYVGLTNFMGARFVTAVAAMQ 291

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            I +E AKRGL + DDG++P ++   LA    +P++ ADL +D      +I + L  LEE
Sbjct: 292 PIIREAAKRGLGYLDDGTAPTSVAGQLAKGQAMPFIKADLTIDAVPTSVEIDKTLARLEE 351

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +A+  G A+G+  A   SI+ +  W++    R V +VPL+  A L S S+
Sbjct: 352 LAKGRGTAVGMTSALPVSIDRVGAWIKGLESRGVMLVPLTT-AMLKSKSN 400


>gi|227823692|ref|YP_002827665.1| hypothetical protein NGR_c31780 [Sinorhizobium fredii NGR234]
 gi|227342694|gb|ACP26912.1| hypothetical protein NGR_c31780 [Sinorhizobium fredii NGR234]
          Length = 401

 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 136/409 (33%), Positives = 196/409 (47%), Gaps = 28/409 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLF--CTFIVGLSIYILISHAFVGTISEMI 58
           M  DLN PL +   KR           G   L      I GLS +               
Sbjct: 1   MGTDLNAPLGQGLKKRPPRKRNPRRMFGYAFLGVFSLAIAGLSGWAAF-----------A 49

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVV 116
           P S++R  AP           ++  S          L+   ++    ++  ++  G TV 
Sbjct: 50  PDSLLRTEAPGTSVETPQASTERPASPTKPKVAGGSLRQSGARSGAHVEEMLTDDGATVT 109

Query: 117 NKPTRSTSIDSLPTIEERLILG-------LSKKELLAKNKVGREDTEVP----AMDK--N 163
               RS   D    I    + G       L  ++L+     GR     P     MD+   
Sbjct: 110 KYTPRSRDGDGPALISAGPMRGQDPRMAALPNEDLIEDTPQGRLPIVGPDGLRPMDQYAR 169

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A G RI +VV GLG+SQTGTQRAI  L   +TLAFA+ GNSL RWM++A++ G E 
Sbjct: 170 PWSGARGTRIGLVVGGLGLSQTGTQRAIRDLAPEVTLAFAAAGNSLQRWMQDARRDGHEI 229

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQIPM+ FD   N    + L V++   + L  L  S+ + T Y G+MNY G   LS  +
Sbjct: 230 LLQIPMEPFDYPDNAPGPHALLVSRGATKNLAELHRSMGQITNYTGIMNYLGGRFLSEAD 289

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E + ++  KRGLLF DDG+S ++L+  L+    +P+  ADL LD ++ R+ I  KL  
Sbjct: 290 ALEPLMRDLGKRGLLFLDDGTSAQSLSGTLSGAFGVPHGFADLVLDSELSRNAILRKLDE 349

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           LE +AR  G AIGVA AFDES+  I++W+++   R +  V +S +    
Sbjct: 350 LERVARRNGTAIGVASAFDESVATIAEWMEEAGGRGIEFVGISAVVNDP 398


>gi|239832921|ref|ZP_04681250.1| protein of unknown function DUF610 YibQ [Ochrobactrum intermedium
           LMG 3301]
 gi|239825188|gb|EEQ96756.1| protein of unknown function DUF610 YibQ [Ochrobactrum intermedium
           LMG 3301]
          Length = 406

 Score =  322 bits (824), Expect = 9e-86,   Method: Composition-based stats.
 Identities = 114/409 (27%), Positives = 181/409 (44%), Gaps = 26/409 (6%)

Query: 3   IDLNHPLR--KKTPKRKSFYSQIIS--RLGLFLLFCTFIVGLSIYILISHA---FVGTIS 55
           +DLN PL   KK  KR    S+        L ++    + G +++ +       F  T +
Sbjct: 2   LDLNSPLGLDKKPQKRGGLRSRAFRSSMKALAVVAGLCLAGGAVFAIWQTNQAGFRKTET 61

Query: 56  EMIPYSVIREIA------PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
             +  +     A      P     P      +    +    +     +  +         
Sbjct: 62  AAVEPAQPEAPAVKPVMKPATGNTPPPGSALRGVGGQPGPAIIKVTPDMPTGMPNVAAGT 121

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF----- 164
             G  VV + T  +        +++ +  L +  L+ ++  G          +       
Sbjct: 122 ADGNVVVVQNTHQSG-------QDQRVAHLPEPALVEQSSTGPLPVRGADGLRPMDAYAV 174

Query: 165 -CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A GARIA+V+ GLG+SQTG+  AI+ LP  +TL FA  GNSL RWM+ A++ G E 
Sbjct: 175 GWSGARGARIALVIGGLGLSQTGSMEAIDKLPQEVTLGFAPQGNSLQRWMQAARQNGHEL 234

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQ+PM+ FD         TL V    ++    L ++L R T Y GVMNY GA   S  E
Sbjct: 235 VLQLPMEPFDYPRVNPGRNTLTVGDGAKKNEASLLWALSRMTNYAGVMNYMGARFTSETE 294

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               +  E  +RGL + DDG+S R+    +A    +P+  AD+ +D   +R  I ++L  
Sbjct: 295 VFSPVLGEIGRRGLYYLDDGTSARSEADRIASSDAVPFAAADVLIDAAQERGAILDRLDE 354

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           LE IAR  G AIG   AF  +++ ++ W  +   R + +VP+S L +  
Sbjct: 355 LERIARANGSAIGTGSAFAVTVDAVAAWANEVKKRGIEIVPVSALVRDP 403


>gi|75674648|ref|YP_317069.1| hypothetical protein Nwi_0450 [Nitrobacter winogradskyi Nb-255]
 gi|74419518|gb|ABA03717.1| Protein of unknown function [Nitrobacter winogradskyi Nb-255]
          Length = 400

 Score =  318 bits (816), Expect = 8e-85,   Method: Composition-based stats.
 Identities = 116/408 (28%), Positives = 190/408 (46%), Gaps = 29/408 (7%)

Query: 4   DLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           DL+ PL +   P+R+      + +    LL    +V L  ++  +H  +G   E      
Sbjct: 7   DLSTPLGQNPAPRRRLRLPFSLPQATGLLLGSILVVFLG-FVFFNHDPLG--GEPKARVA 63

Query: 63  IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG---KTVVNKP 119
           IR+ AP+    P  I     P  +  ++      + + Q    I +  SG     VV+ P
Sbjct: 64  IRQ-APVSDDKPTAIR----PPPQQPDSAAVTAPSANGQKTITIIDGSSGSRQDVVVSGP 118

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------- 170
                 D+      + ++G+ ++ LL K++ G          K F + A+G         
Sbjct: 119 GP----DAADAGSAKAVVGVDQR-LLEKSRHGMIPVAAADGLKPFKAYAAGTEADRAKAA 173

Query: 171 --ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               +AIVV GLG+  T T  AI  LP  +TLAF   G+   R + +A+ +  E +LQ+P
Sbjct: 174 KMPVVAIVVGGLGVGATKTTDAIMKLPPAVTLAFTPYGSDPGRLVAQARAQRHEVLLQVP 233

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ +D   N+    TL  T   +Q ++RL + L R  GY G+ N+ GA  ++     +  
Sbjct: 234 MEPYDYPDNDPGPQTLLTTLGAEQNIDRLHWQLSRFQGYVGLTNFMGARFVAAAAVMQPF 293

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
             E A+RGL + DDG++P ++   LA    +P+  ADL +D      +I + L  LE++A
Sbjct: 294 MHEAARRGLGYLDDGAAPLSVAGRLAEGQAMPFARADLIVDAVPTSVEIDKALARLEDLA 353

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
              G AIG+  A   S++ I  W++    R V +VPL+  A L S S+
Sbjct: 354 MKRGVAIGMTSALPVSVDRIGVWIKSLESRGVMLVPLTT-AMLKSKST 400


>gi|222087889|ref|YP_002546427.1| hypothetical protein Arad_4893 [Agrobacterium radiobacter K84]
 gi|221725337|gb|ACM28493.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 400

 Score =  315 bits (808), Expect = 6e-84,   Method: Composition-based stats.
 Identities = 138/404 (34%), Positives = 202/404 (50%), Gaps = 30/404 (7%)

Query: 1   MSIDLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           M  DL+ PL + + P RK         L  F L    I   S+Y     A +    +  P
Sbjct: 1   MGTDLHAPLGQNRGPDRKRRRPPFGRILAGFCL--IAIASFSLY----SALLRDTLQKTP 54

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNK 118
             V  E A      P       +  +         L     Q        ++   +VV  
Sbjct: 55  PPV--ETAEKTAPTPPADTRPAAADQP-------SLTEVDPQSGANTSRIVTSDGSVVTM 105

Query: 119 PTRSTSIDSLPTI-------EERLILGLSKKELLAKNKVGREDTEVPAMDK------NFC 165
            + +    S P +       ++  +     + LL  +  G+     P+  +         
Sbjct: 106 FSPTARDGSGPVLINANQIGQDPRMAATPNESLLEDSPFGKLPITAPSGLRSMDQYARPW 165

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G R+AIVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E ++
Sbjct: 166 SGARGTRVAIVVSGLGLSQTGTQRAIEKLPEEITLAFAASGNSLQRWMQEARRGGHEILI 225

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           Q+P + FD   N     TL  +Q+  + ++ L  ++ + T Y GVMNY G   LSN ++ 
Sbjct: 226 QVPFEPFDYPSNNPGPETLLTSQSAAKNIDNLHKAMGKITNYTGVMNYLGGRFLSNTDAL 285

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + ++  KRGLLF DDGSS ++ +  +A  L  P+  AD+ LD ++ +D I +KL  LE
Sbjct: 286 QPVMRDIGKRGLLFLDDGSSAQSKSGTVAKALETPHAFADMQLDGELQQDAILKKLDELE 345

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            IAR  G AIGVA AFDESI+ IS+W Q+  +R + +V +S LA
Sbjct: 346 RIARRNGTAIGVASAFDESIDAISKWSQEAAMRGIEIVAVSALA 389


>gi|315121752|ref|YP_004062241.1| hypothetical protein CKC_00010 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495154|gb|ADR51753.1| hypothetical protein CKC_00010 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 354

 Score =  315 bits (807), Expect = 9e-84,   Method: Composition-based stats.
 Identities = 223/364 (61%), Positives = 262/364 (71%), Gaps = 25/364 (6%)

Query: 37  IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLK 96
           I GLSIYIL+S+A +GT+SE+ PYS +RE     + +PL      +P+    NT  +  +
Sbjct: 3   IFGLSIYILMSNALIGTVSEIGPYSFVREA----VLVPLKNSSVANPASSPVNTAPSPTQ 58

Query: 97  --NDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK----- 149
             N +   D           V N+  RST +DSLPTIE RLI      EL+ K K     
Sbjct: 59  VVNSTDHKDA---------LVANESKRSTLLDSLPTIEGRLI---PVSELMEKTKPHLIS 106

Query: 150 -VGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNS 208
                 +   A     C N SGARIAIVVS LGISQTGTQRAINLLP N+TLAFASNGNS
Sbjct: 107 VESENKSVSSAYSTRSCPNVSGARIAIVVSALGISQTGTQRAINLLPQNVTLAFASNGNS 166

Query: 209 LDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF 268
           L+RWM+ AK+KGQE +LQIPMQ+F+E  N+ D YTLK+T++ QQLL+RLRYSLRRG GYF
Sbjct: 167 LNRWMQAAKQKGQEVMLQIPMQSFNELNND-DVYTLKITKSSQQLLSRLRYSLRRGKGYF 225

Query: 269 GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYL 328
           GVMNYRGAM LSNK+S E IFKEFA  GLLFFDDGSS RNLTRV+AP++NLPY VADLYL
Sbjct: 226 GVMNYRGAMFLSNKDSVETIFKEFAALGLLFFDDGSSSRNLTRVVAPQINLPYAVADLYL 285

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           DD VDRD IREKLK L +IAR TGQAIGVA AFDES+E IS+WLQ+EH  DVS+VPLSCL
Sbjct: 286 DDVVDRDSIREKLKKLSDIARVTGQAIGVASAFDESVEEISKWLQEEHASDVSIVPLSCL 345

Query: 389 AKLS 392
            KL+
Sbjct: 346 VKLA 349


>gi|92116147|ref|YP_575876.1| protein of unknown function DUF610, YibQ [Nitrobacter hamburgensis
           X14]
 gi|91799041|gb|ABE61416.1| protein of unknown function DUF610, YibQ [Nitrobacter hamburgensis
           X14]
          Length = 401

 Score =  309 bits (791), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 113/399 (28%), Positives = 184/399 (46%), Gaps = 27/399 (6%)

Query: 4   DLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           DL+ PL +   PKR+      + +    LL    +V +  ++L +H  +G   E      
Sbjct: 7   DLSTPLGQNPAPKRRFRLPFTLPQAAAVLLGSILVVFVG-FVLFNHDPLG--GEPAARIA 63

Query: 63  IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG---KTVVNKP 119
           IR+        P +      P+ +  +      + ++ +    I +  SG     VV   
Sbjct: 64  IRQTV-----APEDKSAAVPPASQPTSAAAVTAQPEAGRKTITIIDGSSGSRQDVVVAGA 118

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------- 170
              T+      +    + G+  + LL K++ G          K F + A+G         
Sbjct: 119 DSDTAGGGAAPV---TMAGIDPR-LLEKSRYGMIPAVAADGLKPFKAYATGTDADRAKAA 174

Query: 171 --ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               IAIVV GLG+    T  AI  LP  +TLAF   G+   + +++A+ +  E +LQ+P
Sbjct: 175 TMPVIAIVVGGLGVGAAKTADAIMKLPPAVTLAFTPYGSDPGKLVEQARAQRHEILLQVP 234

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ +D   N+    TL  T   +Q ++RL + L R  GY G+ N+ GA  ++     + I
Sbjct: 235 MEPYDYPDNDPGPQTLLTTLGTEQNIDRLHWHLSRFQGYVGLANFMGARFVAAATVMQPI 294

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +E AKRGL + DDGS+PR++   LA    +P+  ADL +D      +I + L  LE++A
Sbjct: 295 IREAAKRGLGYLDDGSTPRSVAGQLAEGQAMPFAKADLTIDAVPTSVEIDKALARLEDLA 354

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           +  G AIG+A A   S+E I  W +    R V +VPL+ 
Sbjct: 355 KERGAAIGMASALPVSVERIGAWAKGLESRGVMLVPLTT 393


>gi|150398212|ref|YP_001328679.1| hypothetical protein Smed_3017 [Sinorhizobium medicae WSM419]
 gi|150029727|gb|ABR61844.1| protein of unknown function DUF610 YibQ [Sinorhizobium medicae
           WSM419]
          Length = 399

 Score =  307 bits (787), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 139/409 (33%), Positives = 207/409 (50%), Gaps = 30/409 (7%)

Query: 1   MSIDLNHPLRKKTPKRKSFYS--QIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           M+ DLN PL +   +R++     + + R     L    I+GLS +           S + 
Sbjct: 1   MATDLNAPLGQNRKERRAHKRDLRRLLRYSGLSLAAVAIMGLSAW-----------SALF 49

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVV 116
           P  + R  A   +     +   ++ S     T  + LK   +     ++  ++  G TV 
Sbjct: 50  PVPLTRSPAAPTVAEANPVA--EASSSGAPVTSPSPLKRSGALSGADVEEVLTDHGATVR 107

Query: 117 NKPTRSTSIDSLPTIE-------ERLILGLSKKELLAKNKVGREDTEVPAMDKN------ 163
               R         I+       +  +  L  + LL     GR     P   +       
Sbjct: 108 KYTPRPRETGGPAFIDVGSTRGQDPRMAALPNESLLEDRPEGRLPIIGPDGLRPMEQYAR 167

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E 
Sbjct: 168 PWSGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEI 227

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQ+PM+ FD   N+     L+V+   ++ L +L  S+ + T Y GVMNY G   LSN +
Sbjct: 228 LLQVPMEPFDAPDNDPGPPALRVSADARENLAQLHRSMGQITNYTGVMNYLGGRFLSNAD 287

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E + ++  KRGLLF DDG+S ++L+  LA   ++P+  AD+ LD ++ R  I  +L  
Sbjct: 288 ALEPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFDVPHGFADVVLDSELSRSTILRRLDD 347

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           LE IAR  G AIGVA AFDES+  I++W+++   R + VV ++ L K  
Sbjct: 348 LERIARKGGTAIGVASAFDESVTSIAEWIEEAGGRGIEVVGVAALVKDP 396


>gi|220924600|ref|YP_002499902.1| hypothetical protein Mnod_4734 [Methylobacterium nodulans ORS 2060]
 gi|219949207|gb|ACL59599.1| protein of unknown function DUF610 YibQ [Methylobacterium nodulans
           ORS 2060]
          Length = 404

 Score =  303 bits (777), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 112/395 (28%), Positives = 172/395 (43%), Gaps = 12/395 (3%)

Query: 5   LNHPL--RKKTPKRKSFYSQIISRLGLFLLFCTFIVG-LSIYILISHAFVGTISEMIPYS 61
           L+ PL  R + P R + +   I    +     + +VG L+  I  +   +G     +   
Sbjct: 16  LSRPLGIRNEAPSRLARWRAAIPVRPILAAGSSVLVGALACLIAFTEDPLGGEPHAVVTI 75

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
            +RE       +    E   +P+  D +    +++  S     + +       VV +   
Sbjct: 76  TLREP------VAPAPEPTLAPAAPDGSRSAGEVERASGVAVTRPEGAAVPDAVVIRVPD 129

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC---SNASGARIAIVVS 178
              +   P  + RL+       L      G    ++ A  +        A   RIA+VV+
Sbjct: 130 PAELSLAPAPDPRLVEKGRYGVLPRIGPDGARALDIYARPEATSLRSGAAPAGRIALVVT 189

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
           GLGI QT TQ A+  LP  +TLAFA  G+ + +    A++ G E ++Q PM+ FD   N+
Sbjct: 190 GLGIGQTVTQEAVTRLPPAVTLAFAPYGSDIGKAATRAREAGHEVLVQAPMEPFDYPDND 249

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
               TL       +   RL + L R  G  GV+NY GA L     S E + +E   RGL 
Sbjct: 250 PGPQTLLAGAKPAENTGRLAFVLARVPGAIGVVNYMGARLTGEAASLEPVLREIGARGLG 309

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F DDGSSPR+L   +  +   P   AD  +D Q   D I  +L  LEE AR  G A+G A
Sbjct: 310 FLDDGSSPRSLALEVGRRTRTPVARADAVVDAQPLPDAIDRELARLEETARRKGFALGTA 369

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +A   ++E I +W +    R + +VP S   +   
Sbjct: 370 MALPLTVERILRWSRDLEARGILLVPASHALRTRR 404


>gi|222150173|ref|YP_002551130.1| hypothetical protein Avi_4301 [Agrobacterium vitis S4]
 gi|221737155|gb|ACM38118.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 398

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 131/404 (32%), Positives = 194/404 (48%), Gaps = 26/404 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           +S DL+  L +   KR++   +I     L       ++GLS+Y  ++             
Sbjct: 3   LSADLHAALGQNRKKRRTGGPKISPFKALTASSSVALLGLSVYTTLTP----LPLRNPLP 58

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK-TVVNKP 119
                     +           PS+                    ++       +VV K 
Sbjct: 59  LATTPPVAAAVPAEEPAAKAPGPSRSMEARAPT--------SGATVERSTLPDGSVVTKY 110

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE---VPAMDK----------NFCS 166
           + ++   S P +     +G   +     N    E+T    +P   +             S
Sbjct: 111 SPASRDGSGPALVTTPHVGQDPRVAATPNPDLLENTPEGQIPVTGRDGLRPVEQYARPWS 170

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A G R+AIVVSGLG+SQTGTQRAI  LP  +TLAFA++GNSL RWM+EA++ G E +LQ
Sbjct: 171 GAHGTRVAIVVSGLGLSQTGTQRAIKHLPEQVTLAFAASGNSLSRWMQEARRGGHEILLQ 230

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +P++      N+    TL+V +     L  L  ++   T Y G+MNY G   LS+  + +
Sbjct: 231 VPLEPVGYPANDPGRGTLQVGRAATDNLRDLHRAMASMTNYTGLMNYMGGRFLSDSGAMD 290

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + ++ A RGLLF DDGSS R+LT   A  +N+P+ VADL LDDQ+    I ++L  LE 
Sbjct: 291 PVMRDIAARGLLFLDDGSSARSLTATFAKAMNMPFSVADLQLDDQIQEQAILKRLDELER 350

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           IAR  G AIGVA AFDES+  I++W +    R + +V +S LA 
Sbjct: 351 IARRNGSAIGVASAFDESVNAIAKWAEGAKARGIEIVGVSALAM 394


>gi|316931861|ref|YP_004106843.1| hypothetical protein Rpdx1_0469 [Rhodopseudomonas palustris DX-1]
 gi|315599575|gb|ADU42110.1| protein of unknown function DUF610 YibQ [Rhodopseudomonas palustris
           DX-1]
          Length = 412

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 118/417 (28%), Positives = 185/417 (44%), Gaps = 26/417 (6%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIIS---RLGLFLLFCTFIVGLSIYILISHAFVGTIS- 55
           M+ D L+ PL +K  + +      +       +  L   F++    + + SH  +G    
Sbjct: 1   MAADELSTPLGQKRSRWQRLRHYRLPFNATQAIATLLGVFVLAFLGFAIFSHDPLGGEPV 60

Query: 56  ---EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
              E+ P +   + A        + + + +P+   +     Q      Q    I +   G
Sbjct: 61  VRLEIPPAADAPKQAAAAPAKAPDGKAENAPAAGPDQHGGKQA--APGQKTITIIDGSKG 118

Query: 113 ---KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV----PAMDKNFC 165
                VV   T   S    P     +       +LL +++ G          P       
Sbjct: 119 TRQDVVVGADTADKS--EPPGGASAVAADGINPKLLEQSRYGMIPVMAGGLKPFNAYAMA 176

Query: 166 SNASGAR------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
           ++A  A+      + IVV GLGI    T  A+  LPA +TLAF   G+   +   EA+ K
Sbjct: 177 TDAERAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAPVTLAFTPYGSDPGKLATEARAK 236

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
             E ILQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  +
Sbjct: 237 RHEIILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFV 296

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           + + + + I ++ AKRGL + DDG++PR++   LA  L +P+  ADL +D       I +
Sbjct: 297 ATEPAMQAIIRDAAKRGLGYLDDGTAPRSVAGTLANSLAIPFARADLTIDQVPAGADIDK 356

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            L  LE IA+  G AIG+A A   +IE I  W +    R + +VPL+  A L S SS
Sbjct: 357 ALTRLESIAKERGSAIGMASALPVTIERIVNWSKSLESRGIVLVPLTT-AMLKSKSS 412


>gi|86747385|ref|YP_483881.1| hypothetical protein RPB_0259 [Rhodopseudomonas palustris HaA2]
 gi|86570413|gb|ABD04970.1| Protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris HaA2]
          Length = 405

 Score =  293 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 116/409 (28%), Positives = 186/409 (45%), Gaps = 17/409 (4%)

Query: 1   MSID-LNHPLRKKTPK-RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           MS D L+ PL +K  + R+      +++  +  L   F++    + L +   +G   E I
Sbjct: 1   MSADELSTPLGQKRSRLRRFRLPFTVTQA-IATLLGLFLLAFVGFALFNDDPLG--GEPI 57

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRD-NNTVCNQLKNDSSQHDGQIQNDISGKTVVN 117
            +  ++   P          DK + +K +       +      Q    I +   G     
Sbjct: 58  AHITLKPPTPDEAKEAAAAADKANGAKTEKTERAAAKDAALPGQKTITIIDGSKGTRQDV 117

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV----PAMDKNFCSNASGAR- 172
             +      +     E  + G     LL +++ G          P       ++A  A+ 
Sbjct: 118 VVSAGNDDKADTPPAEPAMAGGINPRLLEQSRYGMIPVMAGALKPFSAYAMSTDAERAKA 177

Query: 173 -----IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
                IAIVV+GLG+    T  A+  LP  +TLAF   G    + +++A+ K  E +LQI
Sbjct: 178 DRMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGADPGKLVEQARAKQHEVLLQI 237

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + + + 
Sbjct: 238 PMEPFDYPDNDPGPQTLLTSGAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEAAMQP 297

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           I +E AKRGL + DDGS+PR++   LA  L +P+  ADL +D      +I + L  LE +
Sbjct: 298 IIREAAKRGLGYLDDGSAPRSVAPALAKSLAMPFARADLAIDSVPTGGEIDKALARLEGL 357

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           A+  G AIG A A   SIE I  W +    R + +VPL+  A L S S+
Sbjct: 358 AKERGLAIGTASALPLSIERIVSWSKSLESRGILLVPLTT-AMLKSKST 405


>gi|39933247|ref|NP_945523.1| hypothetical protein RPA0170 [Rhodopseudomonas palustris CGA009]
 gi|39652872|emb|CAE25614.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 412

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 109/414 (26%), Positives = 178/414 (42%), Gaps = 20/414 (4%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIIS---RLGLFLLFCTFIVGLSIYILISHAFVGTIS- 55
           M+ D L+ PL +K  + +      +      G+  L   F++    + L  +   G    
Sbjct: 1   MAADELSTPLGQKRNRWQRLRHYRLPFNATQGIAALLGLFVLTFLGFALFGNDPFGGEPV 60

Query: 56  ---EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
              E+       + A          + + + +              + Q    I +   G
Sbjct: 61  VRVEIKAGPEEAKQAAAEAGKDQGGKPENAAAAGAEKKDAEPKDAAAGQKTITIIDGSKG 120

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV----PAMDKNFCSNA 168
                     +   + P        G++ K LL +++ G          P       ++A
Sbjct: 121 TRQDVVVGTDSPDKAEPPAGPTTSDGINPK-LLEQSRYGMIPVMAGGLKPFSAYAMTTDA 179

Query: 169 SGAR------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
             A+      + IVV GLGI    T  A+  LPA + LAF   G+   +   EA+ K  E
Sbjct: 180 DRAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAAVALAFTPYGSDPGKLATEARAKRHE 239

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ILQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ +
Sbjct: 240 VILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATE 299

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            + + + ++ AKRGL + DDG++PR++   LA  L +P++ ADL +D       I + L 
Sbjct: 300 PAMQAVIRDAAKRGLGYLDDGTAPRSVAGTLAKSLAIPFVRADLTIDQVPAGADIDKSLA 359

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            LE IA+  G A+G+A A   +IE I  W +    R + + PL+  A L S SS
Sbjct: 360 RLESIAKERGSAVGMASALPVTIERIVNWSKSLESRGILLAPLTT-AMLKSKSS 412


>gi|299135455|ref|ZP_07028645.1| protein of unknown function DUF610 YibQ [Afipia sp. 1NLS2]
 gi|298589863|gb|EFI50068.1| protein of unknown function DUF610 YibQ [Afipia sp. 1NLS2]
          Length = 392

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 109/404 (26%), Positives = 176/404 (43%), Gaps = 24/404 (5%)

Query: 1   MSIDLNHPLRKKTPK-RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           M+ DL+ PL + TP+ R+        +  +  +   F++    + +     +G    ++ 
Sbjct: 1   MTDDLSAPLGQTTPRKRRFRLPFTAPQA-IATVCGLFLLAFLGFAIFGRDPMGGEPVVV- 58

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
                     P  +P         S   +          S Q    I +  SG+    K 
Sbjct: 59  ------AKYDPAKLPGADH-----SAIPSAAPVAPAAAPSGQKTVTIIDGSSGERREMKV 107

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAK-------NKVGREDTEVPA--MDKNFCSNASG 170
               +   L      ++ G++++ L             G +   V A   D      A+ 
Sbjct: 108 GDDGTPAGLDADTPAMMSGINQRLLENSRYGMVPIAADGLKPWRVYASGTDLQRARAATT 167

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             I+IV+ GLG+    T  AI  LPA +TLAF   G+   + ++ A+ +  E +LQ+PM+
Sbjct: 168 PTISIVIGGLGVGAAKTNDAIVKLPAAVTLAFTPYGSDPGKLVERARARKHEVLLQLPME 227

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            +D   N+    TL  T   +Q ++RL + + R  GY G+ N+ G+  L    + + I +
Sbjct: 228 PYDYPDNDPGPQTLLATAGPEQNVDRLMWLMSRFQGYVGLTNFMGSRFLVTDSAMQPIIQ 287

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           + AKRGL + DDGS PR+L   LA    +P   AD  LD      +I + L  LE +AR 
Sbjct: 288 QAAKRGLAWLDDGSVPRSLAGQLAGAQGVPTATADAVLDQVPTAAEIDKSLMKLETLARE 347

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
            G A+G+A A   SIE I  W Q+   R + +VPL + L K  S
Sbjct: 348 RGSAVGMASALPISIERIGAWAQRLESRGILLVPLTTTLMKSKS 391


>gi|192288598|ref|YP_001989203.1| hypothetical protein Rpal_0165 [Rhodopseudomonas palustris TIE-1]
 gi|192282347|gb|ACE98727.1| protein of unknown function DUF610 YibQ [Rhodopseudomonas palustris
           TIE-1]
          Length = 412

 Score =  291 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 110/414 (26%), Positives = 178/414 (42%), Gaps = 20/414 (4%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIIS---RLGLFLLFCTFIVGLSIYILISHAFVGTIS- 55
           M+ D L+ PL +K  + +      +      G+  L   F++    + L  +   G    
Sbjct: 1   MAADELSTPLGQKRNRWQRLRHYRLPFNATQGIAALLGLFVLTFLGFALFGNDPFGGEPV 60

Query: 56  ---EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
              E+       + A          + + + +           +  + Q    I +   G
Sbjct: 61  VRVEIKASPDEAKQAAAEAGKDQGGKPENAAAAGAEKKDAEPKEAAAGQKTITIIDGSKG 120

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV----PAMDKNFCSNA 168
                     +   + P        G++ K LL +++ G          P       ++A
Sbjct: 121 TRQDVVVGTDSPDKAEPPAGPTTSDGINPK-LLEQSRYGMIPVMAGGLKPFSAYAMTTDA 179

Query: 169 SGAR------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
             A+      + IVV GLGI    T  A+  LPA + LAF   G+   +   EA+ K  E
Sbjct: 180 DRAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAAVALAFTPYGSDPGKLATEARAKRHE 239

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ILQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ +
Sbjct: 240 VILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATE 299

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            + + I ++ AKRGL + DDG++PR++   LA  L +P+  ADL +D       I + L 
Sbjct: 300 PAMQAIIRDAAKRGLGYLDDGTAPRSVAGTLAKSLAIPFARADLTIDQVPAGADIDKSLA 359

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            LE IA+  G A+G+A A   +IE I  W +    R + + PL+  A L S SS
Sbjct: 360 RLESIAKERGSAVGMASALPVTIERIVNWSKSLESRGILLAPLTT-AMLKSKSS 412


>gi|27375546|ref|NP_767075.1| hypothetical protein blr0435 [Bradyrhizobium japonicum USDA 110]
 gi|27348683|dbj|BAC45700.1| blr0435 [Bradyrhizobium japonicum USDA 110]
          Length = 407

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 116/405 (28%), Positives = 181/405 (44%), Gaps = 16/405 (3%)

Query: 4   DLNHPLRKKTPKRKSFYSQIISRL-GLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           DL+ PL +   +RK       + +  L +L   F+V  + + + +   +G   E +    
Sbjct: 7   DLSAPLGQDKLRRKRRLRLPFTAMQALAMLLGLFLVTFAGFAIFNKDPLG--GEPMTRIA 64

Query: 63  IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS-QHDGQIQNDISGKT--VVNKP 119
           IRE          +   + S  +  + T     +     Q    + +  +G    VV   
Sbjct: 65  IREPKATDEKPAASGHGQDSKQESKHETREAPKQAAPGEQKTVTMIDGSTGARHDVVIGA 124

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGR--------EDTEVPAMDKNFCSNASGA 171
             +       +    ++ G+  K LL K++ G         +   V A D +    A   
Sbjct: 125 GEADDKGEAASAPPPVMAGIDPK-LLEKSRYGMIPVVADGSKPFNVYAADADRAKAAKMP 183

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
            +AIV+ GLG+    T  AI  LPA +TLAF   G+   +  + A+ +  E  LQIPM+ 
Sbjct: 184 VVAIVIGGLGVGAAKTTDAIMKLPAAVTLAFTPYGSDPGKIAERARTQRHEIFLQIPMEP 243

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           +D   N+    TL  + +  Q ++RL + L R  GY G+ N+ GA  ++   + + I +E
Sbjct: 244 YDFPDNDPGPQTLLTSLSADQNMDRLYWHLSRMQGYAGITNFMGARFVATDAAMQPIIRE 303

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            AKRGL FFDDGSSPR++    A    +P+   D+ +D      +I   L  LE  AR  
Sbjct: 304 AAKRGLGFFDDGSSPRSIAPQAAASQAMPFGKGDIAIDVVPTPAEIDRALNKLESAARER 363

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           G AIG A A   SIE I  W +    R + +VPL+  A L S SS
Sbjct: 364 GTAIGTASALPVSIERIGAWTKTLGDRGILLVPLTT-AMLKSKSS 407


>gi|90421691|ref|YP_530061.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB18]
 gi|90103705|gb|ABD85742.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB18]
          Length = 412

 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 116/410 (28%), Positives = 180/410 (43%), Gaps = 19/410 (4%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTIS---- 55
           M+ D L+ PL +K P+++ F         +  L    ++  + + L +    G       
Sbjct: 1   MTTDELSAPLGQKRPRKRKFRLPFSGTQAIATLLGLVLLAFAGFALFNDNPQGGEPMVRM 60

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
            + P     + A          E     +   ++   +       Q    I +  SG   
Sbjct: 61  AIRPQPAADKPAAPETDKAAKAESHDGAAGGSHDKAAHV--EVPGQKTVTIIDGSSGARQ 118

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGR----EDTEVPAMDKNFCSNASGA 171
                      +   +   + +G+ +K LL K++ G      D   P         A  A
Sbjct: 119 QVVVPGGGGDTAASDVAPAITVGIDQK-LLEKSRYGMIPMVADGVKPFNAYATAGEADRA 177

Query: 172 R------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           +      IAIVV GLG+    T  AI  LPA +TLAF   G+   + ++ A+ +  E +L
Sbjct: 178 KAARMPSIAIVVGGLGVGAAKTNDAIMKLPAAVTLAFTPYGSDPAKLVERARAQRHEVLL 237

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           QIPM+ FD   N+    TL  T   +Q ++RL + L R  GY G+ N+ G   ++ + + 
Sbjct: 238 QIPMEPFDYPDNDPGPQTLLTTLPSEQNIDRLYWHLSRFQGYIGITNFMGGRFVTTEPAL 297

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + I +E AKRGL + DDG SPR +  +LA    LP+  ADL +D      +I   L  LE
Sbjct: 298 QPIVREAAKRGLGYLDDGQSPRGVAALLATTQTLPFGKADLSIDVVPTALEIDRALYRLE 357

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            +AR  G AIG+A A   SIE I+ W +    R + +VPL+  A L S S
Sbjct: 358 SLARDNGNAIGMASALPISIERIATWSRSLEGRGLLLVPLTT-AMLKSKS 406


>gi|15890022|ref|NP_355703.1| hypothetical protein Atu2773 [Agrobacterium tumefaciens str. C58]
 gi|15157997|gb|AAK88488.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 399

 Score =  288 bits (736), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 132/406 (32%), Positives = 195/406 (48%), Gaps = 30/406 (7%)

Query: 1   MSIDLNHPL-RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           MS DL  PL  ++           +  L L +L    I GLSIY  +S            
Sbjct: 1   MSSDLRKPLLGRQKKSAGINRRFSVIML-LSVLAVLSIGGLSIYTALS------------ 47

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCN--QLKNDSSQHDGQIQNDISGK-TVV 116
              +++ A  P   P   E     ++ D     +   L+  S +    I         VV
Sbjct: 48  PGNLQKTAAGPDGQPQLAEKAPEKAQVDVPAAGDTAGLQPQSGRSGANINRATLPDGNVV 107

Query: 117 NKPTRSTSIDSLPTI-------EERLILGLSKKELLAKNKVGREDTEVPAMDKN------ 163
           +  +        P +       ++  +     +ELL +   G+         +       
Sbjct: 108 SVYSPRPRDSDGPVLMSGQTYGQDPRMATRPNEELLEETAFGQLPVVGADGLRPMEQYAR 167

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA++GNSL RWM++A+++G E 
Sbjct: 168 PWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEI 227

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQIP++ F          TL      +  ++RL  S+ + T Y GVMNY G   L+ + 
Sbjct: 228 LLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQS 287

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E + ++  KRGLLF DDGSS ++L+  +A  ++ P   AD+ LD +V    I  KL  
Sbjct: 288 ALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDD 347

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           LE IAR  GQAIGVA AFDESI  IS+W ++   R + +V +S L 
Sbjct: 348 LERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV 393


>gi|193084246|gb|ACF09908.1| uncharacterized protein [uncultured marine group III euryarchaeote
           KM3-28-E8]
          Length = 394

 Score =  283 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 86/397 (21%), Positives = 148/397 (37%), Gaps = 19/397 (4%)

Query: 8   PLRKKTPKRKSFYSQIISRLGLFLLFCTFIV--GLSIYILISHAFVGTISEMIPYSVIR- 64
           P       R S     +  L     F   +V   + +  +   A +G           + 
Sbjct: 3   PFMSSDDIRVSRTYGGMPMLLASRRFRLLVVTAFVVLVGIGLGAQIGNWLATAELPSAQI 62

Query: 65  --EIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRS 122
             E+  +P  +      + +          N   N       +  +         +   +
Sbjct: 63  ALEVREMPYQVVTRTYRRLAREYELTVPAKNLEPNFEPIAVARSWDF----VAEVETRLN 118

Query: 123 TSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK------NFCSNASGARIAIV 176
             + +    +E L LG+ K  L   N        +  M +                IAIV
Sbjct: 119 QGVGAPRHEQEDLELGMQKSTL--PNSAPPPPLRLGGMPQWMVNAVPPPITRGRPMIAIV 176

Query: 177 VSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESY 236
           +  LG+S    +R I  LP  ITLAF     +L +  KE +  G E I+ + M+  D   
Sbjct: 177 MDDLGLSPKRVRRTIA-LPGPITLAFLPYARNLRKLAKEGRAAGHELIIHMNMEPKDH-D 234

Query: 237 NEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRG 296
            +     L  +    ++  RL ++L +  GY GV N+ G+         EV+ +   +RG
Sbjct: 235 IDPGPNALLTSMDPMEIRERLLWALNQFDGYIGVSNHMGSRFTEWPNGMEVVIRALKRRG 294

Query: 297 LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIG 356
           LL+FD  +S +++   LA      Y   D++LD +     +  +L   E+IAR  G AI 
Sbjct: 295 LLYFDSLTSTKSVGLTLARAHGTAYARRDVFLDHERFAKAVAWQLAQTEQIARRRGYAIA 354

Query: 357 VAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +   +D + +V+  WL     R   +VPLS + +   
Sbjct: 355 IGHPYDVTFDVLENWLPDAEARGFVMVPLSTIVRRQR 391


>gi|307942948|ref|ZP_07658293.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773744|gb|EFO32960.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 385

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 102/385 (26%), Positives = 171/385 (44%), Gaps = 17/385 (4%)

Query: 4   DLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVI 63
           DL+ PL     +R       +  +G+  +F T  +   I+I I    +G     +     
Sbjct: 13  DLSAPLG-LGKRRFLRLPFGLIGIGIVSVFATVAL---IWIGIVDDPLGGEPTAVIPLST 68

Query: 64  REIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRST 123
            +         + I          +       +    +++   Q  +      N      
Sbjct: 69  ADGLASRDIEVVEIRPAMDGELGPSLRKNGGDQRLGPRYELMDQEAL------NAAAGGL 122

Query: 124 SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF-CSNASGARIAIVVSGLGI 182
                P + ER   G   +      +       + A  + F    AS  +IAIV++GLG+
Sbjct: 123 PNYPDPRVSERTGFGFLPRIGSEGVR------PLDAYARPFETEFASTPKIAIVITGLGL 176

Query: 183 SQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSY 242
           S+ GTQ  ++ LPA+ TL  +  G +LDRW++ A+ KG E +L +PM+ FD   N+   +
Sbjct: 177 SEAGTQNVLDQLPADTTLGLSPYGANLDRWIQGARTKGHEIVLSLPMEPFDFPDNDPGPH 236

Query: 243 TLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD 302
           TL V+ T  +L  RL + L R T Y GVM   GA   S + + +++ ++   RGL+F D+
Sbjct: 237 TLLVSLTQSELTERLTWLLTRITNYVGVMPEMGARYTSTRPTLQLLMEKLRDRGLMFVDN 296

Query: 303 GSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD 362
           G+S R++   +A +   P+   D+ LD     D+I  KL  LE IAR  G A+    A  
Sbjct: 297 GTSSRSVADEIAEETTTPFSGVDVVLDAVPREDEINAKLLQLEGIARARGVAVATGSALP 356

Query: 363 ESIEVISQWLQQEHVRDVSVVPLSC 387
            ++  I +W +    R + +VP+S 
Sbjct: 357 VTVRQIEKWARDLEERGLLLVPVSA 381


>gi|163761381|ref|ZP_02168455.1| hypothetical protein HPDFL43_17685 [Hoeflea phototrophica DFL-43]
 gi|162281376|gb|EDQ31673.1| hypothetical protein HPDFL43_17685 [Hoeflea phototrophica DFL-43]
          Length = 418

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 123/417 (29%), Positives = 196/417 (47%), Gaps = 36/417 (8%)

Query: 1   MSIDLNHPLR---KKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           M  D++ PL    + + +R++  +   +      L    I+G + +I  S + +  +   
Sbjct: 1   MGNDIHKPLGTNTRPSAQRQARPASAWASRLAIGLVLLAILGSAGWIAFSSSQIERLGTS 60

Query: 58  IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVC------------NQLKNDSSQHDGQ 105
           +        +      P +  D  S   +  ++V             + L++   Q   +
Sbjct: 61  V------TASGPGSDTPPDTVDVASAQNQKEDSVSGQSGSGISGTSDDPLQSLHGQSGAE 114

Query: 106 IQNDISGK---TVVNKP-----------TRSTSIDSLPTIEERLILGLSKKELLAKNKVG 151
           +   +       V   P           T    +   P +       + ++  +    V 
Sbjct: 115 VVKTLDDDGNEIVTITPLQRPDNRPVLLTPPGRVGQNPRLAHLPDPSVLEEAGIGDLPVR 174

Query: 152 REDTEVPAMDK-NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
            E+ E P        S A GAR+ I+V GLG+SQTGTQ AI  LP +ITLAFA+NGNSL 
Sbjct: 175 GENGERPFDIYGRPWSGARGARVVIIVGGLGLSQTGTQHAIAALPEDITLAFAANGNSLQ 234

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
           RWM+EA+++G E +LQIP + FD   N+    TL V    +  L+ L  S+ R T Y G+
Sbjct: 235 RWMQEARREGHEILLQIPFEPFDYPANDPGPRTLTVEAGAEANLDNLHASMARITNYTGI 294

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            N+ G   LS+ ++ E + ++ A RGL+F DDG+S ++LT   +  L +P+  AD+ LD 
Sbjct: 295 TNFMGGRFLSDADALEPVMRDIADRGLMFLDDGTSAQSLTEPFSKTLGIPFAAADMVLDA 354

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
             +R  I  KL  LE  AR  G AIGVA AF+ S++ I+ W  +   R + +V  S 
Sbjct: 355 TQERGYILAKLDDLERSARRNGIAIGVASAFEVSVDAIASWANEAKARGIEIVSASA 411


>gi|115522300|ref|YP_779211.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisA53]
 gi|115516247|gb|ABJ04231.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisA53]
          Length = 403

 Score =  281 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 123/410 (30%), Positives = 183/410 (44%), Gaps = 23/410 (5%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           MS D L+ PL +K  +++ F     +   L   F  F+   + Y         T  E I 
Sbjct: 1   MSTDELSTPLGRKPVRKRGFRLPFSAVQALAAAFALFLGLFAYYATFRENP--TGGEPIA 58

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG---KTVV 116
              I+    +        E K  P+K ++            Q    I +  SG   + VV
Sbjct: 59  RVAIK-PEQLGGKAAAPAESKDKPAKSESAAKATPPAEAEGQRTVTIIDGTSGERKQVVV 117

Query: 117 NKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG------ 170
              T    I+         + G++ K LL +++ G        + K F + A+G      
Sbjct: 118 ASETAGAKIERDEA--PTSVAGINPK-LLEQSRYGAIPIAADGL-KPFAAYATGSDADRA 173

Query: 171 -----ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
                  IAIVV GLG+    T  AI  LPA +TLAF   G+  +  +  A+ +  E +L
Sbjct: 174 TAARLPTIAIVVGGLGVGAAKTADAIMKLPAAVTLAFTPYGSDPNGLVARARAQRHEVLL 233

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           QIPM+ F+   N+    TL  + + +Q ++RL + L R  GY G+ N+ G   +    + 
Sbjct: 234 QIPMEPFEYPDNDPGPQTLLTSLSAEQNIDRLHWHLSRFQGYVGIANFMGGRFVITDTAL 293

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             I KE AKRGL + DDG +PR+L   LA    +P+  ADL +D      +I + L  LE
Sbjct: 294 SPIMKEAAKRGLGYLDDGQAPRSLASSLAAAQTVPFGKADLGIDAVPTALEIDKALSRLE 353

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            +AR  G AIG A A   SIE I+ W +    R + +VPL+  A L S S
Sbjct: 354 ALARENGNAIGTASALPVSIERIAAWAKSLQSRGLLLVPLTT-AMLKSKS 402


>gi|144898156|emb|CAM75020.1| Protein of unknown function DUF610 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 222

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 119/218 (54%), Gaps = 2/218 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IA+V+  LG+ +  ++R +  LPA +TLA+ +  ++L    + A+++G E ++ +PMQ  
Sbjct: 2   IAVVIDDLGVDRKRSER-VTTLPAPLTLAWMTYADNLRPITQAARQRGHELMVHVPMQPQ 60

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
            ESY +     L+V    ++L  RLR+ L R  G+ G+ N+ G+   +++    V+  E 
Sbjct: 61  SESY-DPGPDVLEVGLPTEELRRRLRWGLSRFDGFVGINNHMGSRFTADRAGMNVVMDEI 119

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
             RGLLF D  ++ +++   LA +  +P+    ++LD+++    +R +L   E  AR  G
Sbjct: 120 RARGLLFLDSVTTQKSVAPDLARQYGVPFAARHVFLDNEMTVSAVRGQLAKTEAYARKYG 179

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AI +    D +IE ++ WL     +   +VP++ + K
Sbjct: 180 AAIAIGHPHDGTIEALAGWLPGLEAKGFVLVPVTTIVK 217


>gi|91975045|ref|YP_567704.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB5]
 gi|91681501|gb|ABE37803.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB5]
          Length = 411

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 116/414 (28%), Positives = 188/414 (45%), Gaps = 30/414 (7%)

Query: 4   DLNHPLRKKTPK-RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISE------ 56
           +L+ PL +K  + R+      I++  +  L   F++G   + L ++  +G          
Sbjct: 7   ELSTPLGQKRGRLRRFRLPFTITQA-IATLLGVFLLGFLGFALFNNDPLGGEPTVQVMIK 65

Query: 57  -MIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG--- 112
              P       AP   +        +    +D             Q    I +   G   
Sbjct: 66  PPAPDEKKEAAAPADKSSAAKAAKSEFAEAKDGKDAVQP-----GQKTITIIDGSKGTRQ 120

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV----PAMDKNFCSNA 168
             VV+  +    +D+ P  E  +  G++ K LL +++ G          P       ++A
Sbjct: 121 DVVVSSGSGDDKVDA-PPAEPAMANGINPK-LLEQSRYGMIPVAAGALKPVSAYAMTTDA 178

Query: 169 SGAR------IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
             A+      IAIVV+GLG+    T  A+  LP  +TLAF   G+   + +++A+ K  E
Sbjct: 179 DRAKAEKMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGSDPGKLVEQARAKQHE 238

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +LQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++  
Sbjct: 239 VLLQIPMEPFDYPDNDPGPQTLLTSGAPEQNLDRLTWHLSRIQGYVGLSNFMGARFVATD 298

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
            + + I +E AKRGL + DDGS+PR++   LA  L +P+  AD  +D      +I + L 
Sbjct: 299 AAMQPIIREAAKRGLGYLDDGSAPRSVAPSLAKSLAMPFARADSAIDAVPTAAEIDKALA 358

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            LE +A+  G A+G A A   SIE I  W +    R + +VPL  +A L S S+
Sbjct: 359 RLEALAKERGSAVGTASALPVSIERIVSWSKSLESRGILLVPL-TMAMLKSKST 411


>gi|83310908|ref|YP_421172.1| hypothetical protein amb1809 [Magnetospirillum magneticum AMB-1]
 gi|82945749|dbj|BAE50613.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 374

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 74/376 (19%), Positives = 151/376 (40%), Gaps = 19/376 (5%)

Query: 18  SFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNI 77
             + +    +G+ +      VG+ + + +     G   +  P    +E AP+ +  P   
Sbjct: 16  PLWERPSVLVGVMVAVLVLGVGIGLALGLWS---GKAGKAPPPGAEQEPAPVIMASP--- 69

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLIL 137
               +   +   +  ++  +              G +   +   ++ + +L  +      
Sbjct: 70  ----AAPSQPMPSAGDEPDDGRPLLQPPPPRPDPGSSEALEFGHASDVVALAPLPPPPPA 125

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPAN 197
              K          R    VP              IAI++  LG+ +  ++R +  L   
Sbjct: 126 PEVKLPPAGAAIWLRNALPVP-------KTGGKPVIAIIIDDLGVDRRRSER-MAQLKGP 177

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           +TL++ +    +     +A+ +G E ++ +PMQ    SY +  +  L+V  +  ++  RL
Sbjct: 178 LTLSYMTYAEDVAHQSHDARARGHELMVHVPMQPQSASY-DPGAEVLEVGLSSDEIRRRL 236

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
            + L R  GY G+ N+ G+   S+     V+  E  +RGL F D  +S R +    A   
Sbjct: 237 DWGLSRFDGYVGINNHMGSRFTSDPAGMRVVMAELRRRGLAFIDSVTSERTVGAETARHY 296

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
            +P+    ++LD+      +R +L   E  AR  G AI +    D +IE ++ WL     
Sbjct: 297 GVPFAARHVFLDNDQGVAHVRAQLAKTEAYARKHGAAIAIGHPHDGTIEALAGWLPGLEG 356

Query: 378 RDVSVVPLSCLAKLSS 393
           R  ++VP+S + ++ +
Sbjct: 357 RGFALVPVSTIIRMGN 372


>gi|325294144|ref|YP_004280008.1| hypothetical protein AGROH133_09217 [Agrobacterium sp. H13-3]
 gi|325061997|gb|ADY65688.1| hypothetical protein AGROH133_09217 [Agrobacterium sp. H13-3]
          Length = 373

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 128/377 (33%), Positives = 181/377 (48%), Gaps = 28/377 (7%)

Query: 29  LFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDN 88
           L  L    I GLS+Y  +S               +++ A  P T P   ED    +  D 
Sbjct: 3   LSALAVLTIGGLSVYTALS------------PGNLQKTASGPDTQPQLAEDAPKTAAADV 50

Query: 89  --NTVCNQLKNDSSQHDGQIQNDISGK-TVVNKPTRSTSIDSLPTIEERLILGLSKKE-- 143
                   LK +S +    I         VV+  +        P +      G   +   
Sbjct: 51  ADPNDTAGLKPESGRSGANINRATMPDGNVVSVYSPRPRDSDGPVLMSGQTYGQDPRMAT 110

Query: 144 -----LLAKNKVGREDTEVPAMDKN------FCSNASGARIAIVVSGLGISQTGTQRAIN 192
                LL +   GR         +         S A G R+AIVV GLG+SQTG+Q+AI 
Sbjct: 111 RPNDALLEETAFGRLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIR 170

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
            LP  +TL FA++GNSL RWM+EA+++G E +LQIP++ F          TL      + 
Sbjct: 171 ELPPEVTLGFAASGNSLQRWMQEARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKV 230

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
            ++RL  S+ + T Y G+MNY G   LS + + E + ++  KRGLLF DD SS ++L+  
Sbjct: 231 NIDRLHRSMAKITNYTGIMNYLGGRFLSEQAALEPVMRDIGKRGLLFLDDASSAQSLSGG 290

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           +A  ++ P   AD+ LD +V    I  KL  LE IAR  GQAIGVA AFDESI  IS+W 
Sbjct: 291 IAKAISAPQGFADVLLDGEVTEATILRKLDELERIARRNGQAIGVASAFDESIAAISKWS 350

Query: 373 QQEHVRDVSVVPLSCLA 389
           ++   R + +V +S L 
Sbjct: 351 REAGGRGIEIVGVSALV 367


>gi|254470624|ref|ZP_05084027.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211959766|gb|EEA94963.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 387

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 103/385 (26%), Positives = 169/385 (43%), Gaps = 25/385 (6%)

Query: 23  IISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQS 82
            +  +G+ ++   F  G  I+I I     G      P + I   + +    P +IE    
Sbjct: 2   PLGLIGVAIMTVIFTTGF-IWIGIVDDPNGGE----PMATIELSSALDGVAPSDIEIVDL 56

Query: 83  PSKRD-----------NNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTI 131
           P               N    +     S Q    +++  SG T +    R    + L   
Sbjct: 57  PDGSQLDLIEAEQFDANGVGPDGSYRPSRQLGSALKDQASGPTSLVDLARRVDYEGLDGG 116

Query: 132 EERLILGLSK-KELLAKNKVGREDTEVPAMDKNFCSNASGA--------RIAIVVSGLGI 182
                L     ++LL  NK G      P   +   + A           RIAI+++G+G+
Sbjct: 117 FSSESLSTEPIEQLLEPNKFGSLPKISPEGVRPLDAYARRPNPATLTQARIAILINGIGL 176

Query: 183 SQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSY 242
           +   T +AI  LPA+I+L  +  G+ ++ WM+ A+  G E +LQ PM+ FD   N+    
Sbjct: 177 NSDMTIKAIEDLPADISLGLSPYGDDVNSWMESARLSGHEVLLQAPMEPFDYPDNDAGPQ 236

Query: 243 TLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD 302
           +L      +Q   RL + L + + Y G++N+ G    SN+        +   RGL++ DD
Sbjct: 237 SLLTNLDQKQNDERLSWVLGQTSNYVGLVNFMGDRFTSNETRMSEFLSKVRDRGLMYVDD 296

Query: 303 GSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD 362
           GSSPR+    +A    +P++ ADL LD  +  + I  +L  LE IAR  G A+  A AF 
Sbjct: 297 GSSPRSKAGQVAGTQKVPFVQADLVLDQNLSAEAIGTQLLELETIARQRGIAVATATAFP 356

Query: 363 ESIEVISQWLQQEHVRDVSVVPLSC 387
            ++  +  W Q+   R +S+VP+S 
Sbjct: 357 VTLNALEAWSQRLEERGLSLVPVSS 381


>gi|148252020|ref|YP_001236605.1| hypothetical protein BBta_0413 [Bradyrhizobium sp. BTAi1]
 gi|146404193|gb|ABQ32699.1| hypothetical protein BBta_0413 [Bradyrhizobium sp. BTAi1]
          Length = 407

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 104/405 (25%), Positives = 176/405 (43%), Gaps = 16/405 (3%)

Query: 4   DLNHPLRKKTPKRKSFYSQIISRL-GLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           +L+ PL +   +R+       + L  L +L   F+V  + + L     +G   E I    
Sbjct: 7   ELSAPLGQTEKRRRRRIRLPFTLLQALAVLLGLFLVVFAGFALFGDNPLG--GEPIARIA 64

Query: 63  IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK---TVVNKP 119
           I   A           D +  +  ++       ++   +    I +  SG      +   
Sbjct: 65  INAGAKPDDKSGAAKPDAKHGATAEHGAAAPAKQDGGDRKTVTIIDGSSGARQEVAIGGG 124

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGR--------EDTEVPAMDKNFCSNASGA 171
              T+           + G+  + LL K++ G         +     A + +    A   
Sbjct: 125 GSETAEPGAAAPAASQMPGVDPR-LLEKSRYGMIPVMADGVKPFTAYAAEADRAKAARMP 183

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
            +AIV+ GLG+    T  AI  LP  +TLAF   G    +  + A+ +  E +LQ+PM+ 
Sbjct: 184 AVAIVIGGLGVGAAKTVEAIMKLPPAVTLAFTPYGADPTKLAERARAQRHEILLQVPMEP 243

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           +D   N+    TL  T    Q ++RL + + R  GY G+ N+ GA  ++ + + + I  E
Sbjct: 244 YDYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIGNFMGARFVATEAAMQPIVNE 303

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            AKRGL  FDDG++PR++   LA    +P+   D+ +D      +I   L  LE +A+  
Sbjct: 304 AAKRGLALFDDGAAPRSVAASLAAGRAMPFAKGDVAIDAVPTPVEIDNALAKLESLAKER 363

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           G AIG A A   SI+ I  W++    + + +VPL+  A L S S+
Sbjct: 364 GIAIGTASALPVSIDRIGAWIKGLDRKGILLVPLTT-AMLKSKSN 407


>gi|117926782|ref|YP_867399.1| hypothetical protein Mmc1_3508 [Magnetococcus sp. MC-1]
 gi|117610538|gb|ABK45993.1| protein of unknown function DUF610, YibQ [Magnetococcus sp. MC-1]
          Length = 482

 Score =  278 bits (710), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 76/339 (22%), Positives = 134/339 (39%), Gaps = 4/339 (1%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND--I 110
             ++ +  +   E +  P T      ++  P+  +     +       +  G   +    
Sbjct: 132 EEADTVLKATPSEASSEPATKAATDLEQAKPTPAELEEQPSVEIEADGEKGGLGPSATPA 191

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
           +   V ++  ++   D      E     L ++ L            V         ++  
Sbjct: 192 TQPLVPSETAKAHGDDKSHPKSESKSDILYEEHLSEDLDKPEPPAVVEKKPVP-AKHSHM 250

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +IA+++  LG +  G  R I  LPA+ITLA    G    + +  A KKGQE IL  PMQ
Sbjct: 251 VKIAVIIDDLGYN-GGVGRGIVSLPADITLAVLPGGPYSRQLVNMAHKKGQEIILHQPMQ 309

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                        L       ++   L ++L R     G+ N+ G+ L  N+     + K
Sbjct: 310 PQGYPRVNPGPGALLEGMDADEIAEVLNHNLERFPEVVGINNHMGSALTENRVIMNDVMK 369

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              KR L F D  +SPR++    A    +P     ++LD++     I ++L+  EEIA+ 
Sbjct: 370 VLVKRELYFIDSRTSPRSVAYRAALSHGVPRAKRSVFLDNKRTVAAILKRLQEAEEIAKR 429

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           +G AI +   +  +++ + QWL     R + VV  S L 
Sbjct: 430 SGSAIAIGHPYGVTLQALKQWLPGLQARGIVVVRASNLL 468


>gi|110635778|ref|YP_675986.1| protein of unknown function DUF610, YibQ [Mesorhizobium sp. BNC1]
 gi|110286762|gb|ABG64821.1| protein of unknown function DUF610, YibQ [Chelativorans sp. BNC1]
          Length = 330

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 109/323 (33%), Positives = 168/323 (52%), Gaps = 12/323 (3%)

Query: 76  NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEER- 134
           + + ++SPS         +  + S  H   I +  S       P R   +      E   
Sbjct: 2   SPDRERSPSATAKPAPQLEAASASRLHSTFIPHLDSDDV---GPLRRGLVFRDSLAEGGQ 58

Query: 135 --LILGLSKKELLAKNKVGREDTEVPAMDKNF------CSNASGARIAIVVSGLGISQTG 186
              +  L  + L+ ++++G          + F       S A GARIAIV+ GLGISQTG
Sbjct: 59  NLRVAHLPDRALIEESELGPLPVRAADGLRPFDAYARPWSGARGARIAIVIGGLGISQTG 118

Query: 187 TQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKV 246
           TQ AI  LP  ITLAFA  GNSL RWM+EA++ G E I+Q+P++           YTL  
Sbjct: 119 TQEAIEKLPPEITLAFAPLGNSLMRWMQEARRDGHEVIMQVPLEPAGYPSTNPGRYTLLT 178

Query: 247 TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
                + +  LR+ L R T Y GVMNY GA   +++++ +++  E ++RGLL+FDDG S 
Sbjct: 179 NVGADKNIRNLRWVLSRITNYTGVMNYMGARFTADRKAMDLLMDELSQRGLLYFDDGMSA 238

Query: 307 RNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIE 366
           R+L   +A    +P++  D  +D + +R  I +KL  LE IAR  G A+G  +A + +++
Sbjct: 239 RSLAEEVALAKGVPFVAGDDVIDQERERGAILKKLDELERIARAKGFAVGSGIALNATVD 298

Query: 367 VISQWLQQEHVRDVSVVPLSCLA 389
            ++ W  +   R V +VP+S +A
Sbjct: 299 AVTSWAGEVRKRGVELVPISAVA 321


>gi|209883750|ref|YP_002287607.1| protein of unknown function, YibQ [Oligotropha carboxidovorans OM5]
 gi|209871946|gb|ACI91742.1| protein of unknown function, YibQ [Oligotropha carboxidovorans OM5]
          Length = 390

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 105/402 (26%), Positives = 176/402 (43%), Gaps = 22/402 (5%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M  D + PL +  P+R+ F     +   +  +   F++    + +     +G        
Sbjct: 1   MVDDFSAPLGQNAPRRRRFRLPFTAPQAIATVSGLFLLTFLGFAIFGRDPMGGE------ 54

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK---TVVN 117
                  PI        +   +                + Q    I +  SG+    VV 
Sbjct: 55  -------PIVTATYDPAKLPGATQSAIPPAAPITAAAPNGQKTVTIIDGSSGQRREMVVG 107

Query: 118 KPTRSTSIDSLPTIE---ERLILGLSKKELLAKNKVGREDTEVPAM--DKNFCSNASGAR 172
               + +    P ++    + +L  S+  L+  +  G +   V A   D      A+   
Sbjct: 108 AEGSTDTESDTPALQTGINQRLLENSRYGLVPISADGLKPWRVYAASTDLQRARAATMPT 167

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           I++V+ GLG+    T  A+  LP  +TLAF   G+   + +  A+ +  E +LQ+PM+ +
Sbjct: 168 ISLVIGGLGVGSAKTNDAVLRLPGAVTLAFTPYGSDPGKLIARARAQKHEVLLQVPMEPY 227

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T + +Q ++RL + + R  GY G+ N+ G+  + +  + + I +E 
Sbjct: 228 DYPDNDPGPQTLLATASAEQNVDRLMWHMSRFQGYVGLANFMGSRFVVSDAAMQPIVQEA 287

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           A+RGL +FDDGS PR+L   LA     P   ADL +D      +I + L  LE +AR  G
Sbjct: 288 ARRGLAWFDDGSVPRSLAGQLAGAQGAPSTTADLVIDQVPTSAEIDKNLAKLENLARERG 347

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
            A+G+A A   SIE I  W Q+   R + +VPL + L K  S
Sbjct: 348 TAVGMASALPVSIERIGAWAQRLENRGILLVPLTTTLMKSKS 389


>gi|157377603|ref|YP_001476203.1| protein of unknown function DUF610, YibQ [Shewanella sediminis
           HAW-EB3]
 gi|157319977|gb|ABV39075.1| protein of unknown function DUF610, YibQ [Shewanella sediminis
           HAW-EB3]
          Length = 253

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 50/224 (22%), Positives = 97/224 (43%), Gaps = 4/224 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
             A  +++AI++  +G  Q+    A+  LP  +T +   +        K+A   G E +L
Sbjct: 15  GYAEASQVAIIIDDIGYRQS--DEAVLSLPNTVTFSVLPHTPLGSEVAKKAHNMGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T    +L + L  +        G  N+ G++L    E  
Sbjct: 73  HLPMQALNGK--TMGPGGLTNTMDEAELKHTLEKAFDNIPYAKGANNHMGSLLTQLDEPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   +R L F D  ++        A +L +P +   ++LD+ V +  + E+ + L 
Sbjct: 131 LWVMESLKQRELYFVDSMTTRFTKASNKAEQLGIPLLRRQVFLDNDVSQSALEERFEHLI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            +A   GQA+ +A  + E+I+ + + L +     + +V  S L 
Sbjct: 191 SLAHKQGQAVAIAHPYPETIKFLKRNLHRLDKAGIELVKTSSLL 234


>gi|238754759|ref|ZP_04616111.1| hypothetical protein yruck0001_30950 [Yersinia ruckeri ATCC 29473]
 gi|238707067|gb|EEP99432.1| hypothetical protein yruck0001_30950 [Yersinia ruckeri ATCC 29473]
          Length = 328

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 93/228 (40%), Gaps = 4/228 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G      +  I  +P  I++A             +A  +G+E ++ 
Sbjct: 20  TAQAGKLSIVIDDFGYRPQN-ENQILQMPLPISVAILPYAPHAKEMAIKAHSQGREVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM        E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSRQPLERD--TLQPSMSSEEIQRIIRQAVSNVPYAVGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +         A    +  +   ++LDD  +   IR++     +
Sbjct: 137 KVMQALEHYSLYFLDSVTIGNTQASKAAEGTGVKVIKRKVFLDDVQNDVAIRQQFNRAIQ 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           +AR  G AI +      +I V+ Q L+Q    D+ +V  S L     P
Sbjct: 197 LARKNGSAIAIGHPHPSTIRVLQQMLRQLPP-DIVLVRPSALLNEPVP 243


>gi|300721222|ref|YP_003710492.1| hypothetical protein XNC1_0147 [Xenorhabdus nematophila ATCC 19061]
 gi|297627709|emb|CBJ88235.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 349

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 98/227 (43%), Gaps = 4/227 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +F  NA  AR+AIV+  +G  +   +  I  +P  +++A   +         +A ++G+E
Sbjct: 29  SFTLNARAARLAIVIDDVGY-RIHEENKILQMPIAVSVAILPDSPHGREMAVKAYQQGRE 87

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL    + +++   ++ ++++     G+ N+ G+ + S+ 
Sbjct: 88  VLIHLPMAPLSQQPLEK--NTLHPAMSREEIGRIIQEAIQKVPHAVGMNNHMGSAMTSDL 145

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              E + +  ++  L F D  +         A   ++P +  +++LD+     + R +  
Sbjct: 146 TGMEKVMQVLSRHHLYFLDSVTIGNTQVTKAATGTSVPVIRRNIFLDNVQTEAETRHQFN 205

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
               +AR  G AI +      ++  + Q L      D+ +V    L 
Sbjct: 206 RAITLARKKGSAIAIGHPHPTTVRALQQALATLP-DDIELVTPGILL 251


>gi|238794396|ref|ZP_04638007.1| hypothetical protein yinte0001_39420 [Yersinia intermedia ATCC
           29909]
 gi|238726297|gb|EEQ17840.1| hypothetical protein yinte0001_39420 [Yersinia intermedia ATCC
           29909]
          Length = 343

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 98/227 (43%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G       + I  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANAAQAGKLSIVIDDFGYRPQNENK-ILQMPLPISVAILPNAPYAREMAIKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIMRQAVNNVPYAKGMNNHMGSAMTSSFS 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +E     L F D  +   +     A   ++  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQELDHYQLYFLDSVTIGNSQAGRAAEGTHVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLN 239


>gi|56415596|ref|YP_152671.1| hypothetical protein SPA3558 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364523|ref|YP_002144160.1| hypothetical protein SSPA3321 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56129853|gb|AAV79359.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197096000|emb|CAR61587.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 320

 Score =  275 bits (704), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|168464987|ref|ZP_02698879.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|195632452|gb|EDX50936.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
          Length = 320

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|168232551|ref|ZP_02657609.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194470628|ref|ZP_03076612.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194456992|gb|EDX45831.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333317|gb|EDZ20081.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 320

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|62182199|ref|YP_218616.1| hypothetical protein SC3629 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197248431|ref|YP_002148639.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|224585506|ref|YP_002639305.1| hypothetical protein SPC_3788 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|62129832|gb|AAX67535.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197212134|gb|ACH49531.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|224470034|gb|ACN47864.1| hypothetical protein SPC_3788 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322716687|gb|EFZ08258.1| Uncharacterized protein yibQ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 320

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVLKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|168260540|ref|ZP_02682513.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205350154|gb|EDZ36785.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 320

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|204928803|ref|ZP_03220002.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204322236|gb|EDZ07434.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|322612872|gb|EFY09824.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618937|gb|EFY15824.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625286|gb|EFY22113.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630047|gb|EFY26820.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634238|gb|EFY30973.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635861|gb|EFY32570.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643053|gb|EFY39629.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322643820|gb|EFY40369.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649830|gb|EFY46253.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653036|gb|EFY49371.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661145|gb|EFY57373.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662366|gb|EFY58579.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667244|gb|EFY63410.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674379|gb|EFY70472.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678413|gb|EFY74474.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680919|gb|EFY76953.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687145|gb|EFY83118.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192105|gb|EFZ77338.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198212|gb|EFZ83319.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323200832|gb|EFZ85902.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206586|gb|EFZ91544.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210501|gb|EFZ95387.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216211|gb|EGA00939.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220434|gb|EGA04888.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225297|gb|EGA09531.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228411|gb|EGA12542.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234232|gb|EGA18320.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237217|gb|EGA21284.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244736|gb|EGA28740.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249217|gb|EGA33135.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250928|gb|EGA34804.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257323|gb|EGA41022.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262248|gb|EGA45809.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264541|gb|EGA48045.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268831|gb|EGA52289.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 320

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|161616784|ref|YP_001590749.1| hypothetical protein SPAB_04603 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168818465|ref|ZP_02830465.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194445745|ref|YP_002042956.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|198245856|ref|YP_002217668.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205354691|ref|YP_002228492.1| hypothetical protein SG3725 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858943|ref|YP_002245594.1| hypothetical protein SEN3528 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238910259|ref|ZP_04654096.1| hypothetical protein SentesTe_03869 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|161366148|gb|ABX69916.1| hypothetical protein SPAB_04603 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404408|gb|ACF64630.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197940372|gb|ACH77705.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205274472|emb|CAR39505.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205344542|gb|EDZ31306.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|206710746|emb|CAR35107.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|320088125|emb|CBY97887.1| Uncharacterized protein yibQ Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|326625452|gb|EGE31797.1| Uncharacterized protein yibQ [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629830|gb|EGE36173.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 320

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|16766991|ref|NP_462606.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167994326|ref|ZP_02575418.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168241884|ref|ZP_02666816.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194447310|ref|YP_002047737.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197265013|ref|ZP_03165087.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|200387258|ref|ZP_03213870.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|16422273|gb|AAL22565.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194405614|gb|ACF65833.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197243268|gb|EDY25888.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|199604356|gb|EDZ02901.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205327801|gb|EDZ14565.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338812|gb|EDZ25576.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261248854|emb|CBG26707.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995965|gb|ACY90850.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160243|emb|CBW19765.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914732|dbj|BAJ38706.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226758|gb|EFX51808.1| putative divergent polysaccharide deacetylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|323132066|gb|ADX19496.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990555|gb|AEF09538.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 320

 Score =  275 bits (704), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|188025459|ref|ZP_02958730.2| hypothetical protein PROSTU_00480 [Providencia stuartii ATCC 25827]
 gi|188023551|gb|EDU61591.1| hypothetical protein PROSTU_00480 [Providencia stuartii ATCC 25827]
          Length = 303

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 100/230 (43%), Gaps = 4/230 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
               AS A++AIV+   G  +T     I  LP  IT+A   +         +A ++G+E 
Sbjct: 2   MSLQASAAKLAIVIDDFGY-RTKEDNQILALPTPITIAILPDSPHGQLVANKAHQQGREV 60

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+ +PM+   +   E    TL  T + +++   ++ ++ +     G+ N+ G+ + S+  
Sbjct: 61  IIHMPMKPLSKQPLEK--NTLSPTMSAEEIDRIIKRAISQVPYAKGMNNHMGSEMTSSLS 118

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               +    +K    F D  +         A +  +P +   ++LD+    ++ R +L  
Sbjct: 119 GMRHVMNSLSKANFFFLDSVTIGNTQAVKAANEFGVPVVRRHIFLDNHQSEEETRVQLNK 178

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
               AR  G AI +      ++  + ++L Q    D+ +V +S L + SS
Sbjct: 179 AVAYARKHGNAIAIGHPHPSTVRALQKYLPQLPA-DIELVSVSALLQGSS 227


>gi|163749815|ref|ZP_02157060.1| hypothetical protein KT99_01686 [Shewanella benthica KT99]
 gi|161330329|gb|EDQ01308.1| hypothetical protein KT99_01686 [Shewanella benthica KT99]
          Length = 256

 Score =  275 bits (703), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 50/224 (22%), Positives = 96/224 (42%), Gaps = 4/224 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S  + A++AI++  +G  Q+    A+  LP NITL+   +    +     A ++G E +L
Sbjct: 15  SYVNAAQVAIIIDDIGYRQS--DEAVLTLPDNITLSILPHTPLGNSVAHIAHERGYEVML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +         T     +   +   +  +        G  N+ G++L    E  
Sbjct: 73  HLPMQALNGKKLGPGGIT--NDMSETDIKQTISQAFENIPFAKGANNHMGSLLTQLDEPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + +   +  L F D  ++        A KL +P +   ++LD+ V    + ++ + L 
Sbjct: 131 QWVMESLKQHHLYFVDSMTTRYTKAGSTADKLGIPQLKRQIFLDNDVSPAGLNQQFERLI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            +A   GQ + +A    E+IE +   L +     +S+V  S L 
Sbjct: 191 ALAHRQGQVVAIAHPHPETIEYLKLNLPRLQQEGISLVKTSELL 234


>gi|168235310|ref|ZP_02660368.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194735049|ref|YP_002116641.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710551|gb|ACF89772.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197291430|gb|EDY30782.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 320

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|46201425|ref|ZP_00055095.2| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 373

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 80/392 (20%), Positives = 148/392 (37%), Gaps = 28/392 (7%)

Query: 9   LRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAP 68
           +  K P  +     +   + + +      + L ++   S       +E  P  VI E   
Sbjct: 3   MGNKVPLWERPSVLVGLMIAVLVAGVGIGLVLGLWSGKSAKTQMAGAEQAPAPVISETTS 62

Query: 69  IPLTI----PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTS 124
            P         N E                  +  +   G   + +S      +P  S  
Sbjct: 63  PPPPPPPLPSANEEADDGRPLLQPPPPRPDPGSSEALEFGHASDVVSLVPAPAQPPASPE 122

Query: 125 IDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQ 184
           +   P      +               R    VP              IAI++  LG+ +
Sbjct: 123 VKLPPAGAAVWL---------------RNALPVP-------KTGGKPVIAIIIDDLGVDR 160

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
             ++R +  L   +TL++ +    + R   +A+  G E ++ +PMQ    SY +  +  L
Sbjct: 161 RRSER-MAQLKGPLTLSYMTYAEDVARQSHDARAHGHELMVHVPMQPQSASY-DPGAEVL 218

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
           +V    +++  RL + L R  GY G+ N+ G+   S+     V+  E  +RGL F D  +
Sbjct: 219 EVGLPPEEIRRRLDWGLSRFDGYVGINNHMGSRFTSDAAGMRVVMAELRRRGLAFIDSVT 278

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
           S   +    A    +P+    ++LD+      +R +L   E  AR  G AI +    D +
Sbjct: 279 SEHTVGAETARHYGVPFAARHVFLDNDQGVAHVRAQLAKTEAYARKHGAAIAIGHPHDGT 338

Query: 365 IEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           IE ++ WL     R  ++VP+S + ++ + +S
Sbjct: 339 IEALAGWLPGLEARGFALVPVSTIIRMGNGTS 370


>gi|146337569|ref|YP_001202617.1| hypothetical protein BRADO0424 [Bradyrhizobium sp. ORS278]
 gi|146190375|emb|CAL74371.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 405

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 103/402 (25%), Positives = 169/402 (42%), Gaps = 12/402 (2%)

Query: 4   DLNHPLRKKTPKRKSFYSQIISRL-GLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV 62
           +L+ PL +   +R+       + L  L ++    +V  + + L     +G   E +    
Sbjct: 7   ELSAPLGQTETRRRRRIRLPFTALQALAMVLGLILVVFAGFALFGDNPLG--GEPVARVA 64

Query: 63  IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRS 122
           I E A          +       +  +      K D  +    I +  SG          
Sbjct: 65  INEGAKPGDKPDAAAKPDAKSDAKSEHGAAAAAKPDGERKTITIIDGSSGARQEVAIGAG 124

Query: 123 TSIDSLPTIEERLILGLSKKELLAKNKVGREDT--------EVPAMDKNFCSNASGARIA 174
                 P       +      LL K++ G               A D +    A    +A
Sbjct: 125 GRDTPEPGAAPANPMPGVDPRLLEKSRYGMIPVMTDGLKSFTAYAADADRAKAARMPAVA 184

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IV+ GLGI    T  AI  LP  +TLAF   G+   +  + A+ +  E +LQ+PM+ +D 
Sbjct: 185 IVIGGLGIGAAKTVDAIMKLPPAVTLAFTPYGSDPSKLAERARAQRHEILLQVPMEPYDY 244

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
             N+    TL  T    Q ++RL + + R  GY G+ N+ GA  ++ + + + I  E AK
Sbjct: 245 PDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIGNFMGARFVATETAMQPIVNEAAK 304

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGL  FDDG++PR++   LA    +P+   D+ +D      +I   L  LE +A+  G A
Sbjct: 305 RGLALFDDGAAPRSVAASLATGRAVPFAKGDVAIDAVPTAVEIDNALAKLESLAKERGVA 364

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +G A A   SI+ I  W++    + + +VPL+  A L S S+
Sbjct: 365 VGTASALPVSIDRIGTWIKGLDRKGILLVPLTT-AMLKSKSN 405


>gi|167549047|ref|ZP_02342806.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325644|gb|EDZ13483.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 320

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 96/235 (40%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  I  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQILALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G  I +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RAIELARRNGSTIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|13473411|ref|NP_104978.1| hypothetical protein mll3999 [Mesorhizobium loti MAFF303099]
 gi|14024160|dbj|BAB50764.1| mll3999 [Mesorhizobium loti MAFF303099]
          Length = 247

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 102/243 (41%), Positives = 146/243 (60%), Gaps = 3/243 (1%)

Query: 147 KNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNG 206
           ++  GR   +V A      S A GAR+AIV+ GL +SQTGTQ AI  LPA +TLAFA  G
Sbjct: 2   RSADGRRPFDVYA---RPWSGARGARVAIVIGGLAVSQTGTQAAIAKLPAEVTLAFAPQG 58

Query: 207 NSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTG 266
           NS+ RWM+ A++ G E ++Q+P++ FD         TL V  + ++ L  L ++L R T 
Sbjct: 59  NSIGRWMQAARQGGHEIVMQVPLEPFDYPNVNPGRNTLTVAGSAEENLKNLHWALSRTTN 118

Query: 267 YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADL 326
           Y GVMNY GA   ++K + E    E  KRGL + DDGSS R+L   LA K  +P++  D 
Sbjct: 119 YTGVMNYMGARFSADKAAMEPFMAELGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDT 178

Query: 327 YLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
            +D   DR  I +KL GLE  AR  G A+G+  AFD +++++S W+ +   R + +VP+S
Sbjct: 179 AIDAVQDRGAILKKLDGLEATARAKGTAVGIGSAFDLTVDIVSSWIAEAKKRGIEIVPIS 238

Query: 387 CLA 389
            +A
Sbjct: 239 AVA 241


>gi|16762604|ref|NP_458221.1| hypothetical protein STY4089 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144093|ref|NP_807435.1| hypothetical protein t3813 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213163814|ref|ZP_03349524.1| hypothetical protein Salmoneentericaenterica_28901 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213420031|ref|ZP_03353097.1| hypothetical protein Salmonentericaenterica_20595 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213427149|ref|ZP_03359899.1| hypothetical protein SentesTyphi_16972 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647904|ref|ZP_03377957.1| hypothetical protein SentesTy_11844 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824144|ref|ZP_06543741.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25367617|pir||AD0974 probable exported protein STY4089 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504909|emb|CAD03288.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139730|gb|AAO71295.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 320

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 97/235 (41%), Gaps = 5/235 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E
Sbjct: 16  AFAHPVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV-PLSCLAKLSSPSS 396
              E+AR  G AI +      ++ V+ Q + +    D+++V P S L +    +S
Sbjct: 193 RTIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEPQVDTS 246


>gi|238760441|ref|ZP_04621579.1| hypothetical protein yaldo0001_39810 [Yersinia aldovae ATCC 35236]
 gi|238701336|gb|EEP93915.1| hypothetical protein yaldo0001_39810 [Yersinia aldovae ATCC 35236]
          Length = 336

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 96/226 (42%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A   +++IV+   G       + I  +P  I++A   N         +A  +G+E +
Sbjct: 18  ASAAQAGKLSIVIDDFGYRPQNENK-ILQMPLPISVAILPNAPHAKEMAMKAHNQGREIL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+   
Sbjct: 77  IHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYAKGMNNHMGSAMTSSLPG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +      L F D  +   +     A    +  +   ++LDD  +   IR++    
Sbjct: 135 MQKVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 195 VELARRNGSAIAIGHPHPATIKVLQQMLPQLPT-DIVLVRPSELLN 239


>gi|237728916|ref|ZP_04559397.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226909538|gb|EEH95456.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 311

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F +     ++AIV+   G  +  T+  +  +P+ I++A   N         +A   G E 
Sbjct: 18  FATPVFAGKLAIVIDDFGY-RPHTENQVLAMPSTISVAVLPNAPHAREMAIKAHNSGHEV 76

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R ++ +     G+ N+ G+ + S+  
Sbjct: 77  LIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIRDAVSKVPNAVGLNNHMGSAMTSSLF 134

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 135 GMQKVMQALERYDLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 195 AVELARRNGSAIAIGHPHPSTVRVLQQMLYSLPA-DITLVRPSSLLN 240


>gi|238897058|ref|YP_002921804.1| hypothetical protein KP1_5309 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040666|ref|ZP_06013904.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|238549386|dbj|BAH65737.1| hypothetical protein KP1_5309 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042030|gb|EEW43063.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 315

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 94/228 (41%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   +++IV+   G  +  T+  +  LPA I++A   N         +A  +G E
Sbjct: 16  ALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPATISVAVLPNAPHAREMATKAHNQGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAVGLNNHMGSAMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRNQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +AR  G AI +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLN 239


>gi|152994760|ref|YP_001339595.1| hypothetical protein Mmwyl1_0726 [Marinomonas sp. MWYL1]
 gi|150835684|gb|ABR69660.1| protein of unknown function DUF610 YibQ [Marinomonas sp. MWYL1]
          Length = 392

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 63/266 (23%), Positives = 117/266 (43%), Gaps = 6/266 (2%)

Query: 128 LPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGT 187
              IE +   G  K + L+K+    +   VPA       +    RIAI++  LG ++ G 
Sbjct: 125 DAPIESKPAGGFPKPDALSKSS---KKEVVPAKILAVDVHPKMPRIAILIDDLGYNRHGM 181

Query: 188 QRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT 247
             ++ +LP  + LA   +          A+K+ +  +L  PM+  ++   +     L   
Sbjct: 182 DSSL-MLPVEVALAILPSTPFAMETALTAQKQKRITLLHAPME--NQRELKLGPGGLYAK 238

Query: 248 QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPR 307
            T  +L   L   L    G  GV N+ G++L +  +S + + +    R L F D  +SP+
Sbjct: 239 MTEHELKATLSKDLDGLPGIQGVNNHMGSLLTTKADSMKWVMETLKGRSLFFIDSLTSPK 298

Query: 308 NLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
           ++ +  A +  L  +  D++LD+      I ++   L ++AR  G A+ +   + E++  
Sbjct: 299 SVAKKTAQEYGLETVSRDVFLDNIRTEQAIDKQFSRLLKLARLHGSALAIGHPYPETMAY 358

Query: 368 ISQWLQQEHVRDVSVVPLSCLAKLSS 393
           + + L       V +V LS L   SS
Sbjct: 359 LKKRLNHLEQDGVRLVRLSDLLTASS 384


>gi|260466735|ref|ZP_05812921.1| protein of unknown function DUF610 YibQ [Mesorhizobium
           opportunistum WSM2075]
 gi|259029465|gb|EEW30755.1| protein of unknown function DUF610 YibQ [Mesorhizobium
           opportunistum WSM2075]
          Length = 392

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 116/400 (29%), Positives = 182/400 (45%), Gaps = 28/400 (7%)

Query: 1   MSIDLNHPLRK--KTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           +  D+  PL +  + P+     S  +    + +L    +VG+S  I +            
Sbjct: 4   IGKDIERPLGQTVRVPRAAGKISAGVVASAIVVL---AVVGVSGAIALREKPF------- 53

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNK 118
                R+   + ++ P      +  +               ++  G     I  +T    
Sbjct: 54  -----RKPQEVAVSTPKVTAAAEPAAPPALAPAAVPKAQTPAKTGGP--QIIHVQTEEGD 106

Query: 119 PTRSTSI---DSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF------CSNAS 169
                 I   D     +   I  L  K L+  ++ G          + F       S A 
Sbjct: 107 GPPKAGIVIRDPSSIGQNLKIAHLPDKALIEASETGPLPMRAADGRRPFDVYARPWSGAR 166

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           GAR+AIV+ GL +SQTGTQ AI  LP  +TL FA  GNS+ RWM+ A++ G E ++Q+P+
Sbjct: 167 GARVAIVIGGLAVSQTGTQAAIAKLPPEVTLGFAPQGNSIGRWMQAARQGGHEIVMQVPL 226

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           + FD         TL V  +  + L  L ++L R T Y GVMNY GA   ++  +     
Sbjct: 227 EPFDYPSVNPGRNTLTVAASADENLKSLHWALSRTTNYTGVMNYMGARFSADATAMGPFM 286

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            E  KRGL + DDGSS R+L   LA K  +P++  D+ +D   DR +I +KL  LE  AR
Sbjct: 287 AELGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDMAIDAVQDRGEILKKLDSLEATAR 346

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             G A+G+  AFD +++ +S W+ +   R + +VP+S +A
Sbjct: 347 AKGFAVGIGSAFDLTVDTVSSWVAEAKKRGIEIVPISAVA 386


>gi|319780956|ref|YP_004140432.1| hypothetical protein Mesci_1219 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166844|gb|ADV10382.1| protein of unknown function DUF610 YibQ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 392

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 114/398 (28%), Positives = 177/398 (44%), Gaps = 24/398 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIV-GLSIYILISHAFVGTISEMIP 59
           +  D+  PL +    R    +  +S   +       +V G+S  I +         E+  
Sbjct: 4   IGKDIERPLGQAV--RPPRAAGKLSGGAIMATVAVLVVAGISGAIALREKPFRKPQEV-- 59

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
                     P            P+                     +     G      P
Sbjct: 60  ------AVSTPKVTAAAEPAAAPPALAPAAPKPEAPVKSGGPQIIHV-QTEEGD----GP 108

Query: 120 TRSTSI--DSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF------CSNASGA 171
            ++  +  D     +   +  +  K L+  ++ G          + F       S   GA
Sbjct: 109 PKAAIVIRDPSTVGQNLKVAHIPDKALIEASETGPLPVRAADGRRPFDVYARPWSGGRGA 168

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+AIV+ GL +SQTGTQ AI  LPA +TLAFA  GNS+ RWM+ A++ G E ++Q+P++ 
Sbjct: 169 RVAIVIGGLSVSQTGTQAAIAKLPAEVTLAFAPQGNSIGRWMQAARQSGHEIVMQVPLEP 228

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           FD         TL V  +  + L  L ++L R T Y GVMNY GA   ++  + E    E
Sbjct: 229 FDYPKVNPGRNTLTVAASADENLKSLHWALSRTTNYTGVMNYMGARFSADAAAMEPFIAE 288

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             KRGL + DDGSS R+L   LA K  +P++  D+ +D   DR +I +KL  LE  AR  
Sbjct: 289 LGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDMAIDAVQDRGEILKKLDSLEATARAK 348

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           G A+G+  AFD +++ +S W+ +   R + +VP+S +A
Sbjct: 349 GTAVGIGSAFDLTVDTVSSWVVEAKKRGIEIVPISAVA 386


>gi|161505759|ref|YP_001572871.1| hypothetical protein SARI_03935 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867106|gb|ABX23729.1| hypothetical protein SARI_03935 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 320

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 94/228 (41%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F       ++AIV+   G  +  T+  +  LP +I++A   N         +A   G E
Sbjct: 16  AFAQPVFAGKLAIVIDDFGY-RPHTENQVLALPPDISVAVLPNAPQAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R +++      G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPEMSSDEIDRIIREAVKNVPYAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              E+AR  G AI +      ++ V+ Q + +    D+++V  S L  
Sbjct: 193 RAIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPSSLLN 239


>gi|123440475|ref|YP_001004469.1| hypothetical protein YE0075 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087436|emb|CAL10217.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 341

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 95/227 (41%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + +   +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANTSLAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAKEMAIKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPLMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQVLEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVKASALLN 239


>gi|238789568|ref|ZP_04633352.1| hypothetical protein yfred0001_24040 [Yersinia frederiksenii ATCC
           33641]
 gi|238722321|gb|EEQ13977.1| hypothetical protein yfred0001_24040 [Yersinia frederiksenii ATCC
           33641]
          Length = 337

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANAAQAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAKEMAVKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             ++AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVDLARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLN 239


>gi|288933028|ref|YP_003437087.1| hypothetical protein Kvar_0143 [Klebsiella variicola At-22]
 gi|288887757|gb|ADC56075.1| protein of unknown function DUF610 YibQ [Klebsiella variicola
           At-22]
          Length = 318

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 93/228 (40%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   +++IV+   G  +  T+  +  LP+ I++A   N         +A   G E
Sbjct: 16  ALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMATKAHNLGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAIGLNNHMGSAMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRNQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +AR  G AI +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLN 239


>gi|238798823|ref|ZP_04642292.1| hypothetical protein ymoll0001_38940 [Yersinia mollaretii ATCC
           43969]
 gi|238717331|gb|EEQ09178.1| hypothetical protein ymoll0001_38940 [Yersinia mollaretii ATCC
           43969]
          Length = 352

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANAAQAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAREMAVKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVSNVPYAKGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPS-DIVLVRPSALLN 239


>gi|206578516|ref|YP_002236021.1| polysaccharide deacetylase family protein [Klebsiella pneumoniae
           342]
 gi|290511821|ref|ZP_06551189.1| yibQ [Klebsiella sp. 1_1_55]
 gi|206567574|gb|ACI09350.1| polysaccharide deacetylase family protein [Klebsiella pneumoniae
           342]
 gi|289775611|gb|EFD83611.1| yibQ [Klebsiella sp. 1_1_55]
          Length = 318

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 93/228 (40%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   +++IV+   G  +  T+  +  LP+ I++A   N         +A   G E
Sbjct: 16  ALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMATKAHNLGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAVGLNNHMGSAMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRTQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +AR  G AI +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLN 239


>gi|152972465|ref|YP_001337611.1| hypothetical protein KPN_03959 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150957314|gb|ABR79344.1| hypothetical protein KPN_03959 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 315

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 93/228 (40%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   +++IV+   G  +  T+  +  LP+ I++A   N         +A   G E
Sbjct: 16  ALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMATKAHNLGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   + +++   +R +  +     G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPEMSSEEIERIIREAYGKVPYAVGLNNHMGSAMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNEADIRNQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +AR  G AI +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLN 239


>gi|238750811|ref|ZP_04612309.1| hypothetical protein yrohd0001_10680 [Yersinia rohdei ATCC 43380]
 gi|238710955|gb|EEQ03175.1| hypothetical protein yrohd0001_10680 [Yersinia rohdei ATCC 43380]
          Length = 341

 Score =  271 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 47/227 (20%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G       + I  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANAAQAGKLSIVIDDFGYRPQNENK-ILQMPLPISVAILPNAPYAREMAVKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQVLEHYQLYFLDSVTIGNSQASNAAQGTGVKVIKRKVFLDDSQNEAAIRQQFTR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPSTIKVLQQMLPQLPS-DIVLVKPSALLN 239


>gi|317494739|ref|ZP_07953151.1| divergent polysaccharide deacetylase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917341|gb|EFV38688.1| divergent polysaccharide deacetylase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 305

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 47/231 (20%), Positives = 97/231 (41%), Gaps = 4/231 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            ++A   ++AIV+   G  +   +  I  +P  I++A             +A  +G+E +
Sbjct: 18  AASAYAGKLAIVIDDFGY-RPQEENKILQMPLAISVAVLPTAPHAREMATKAHAQGREIL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E D  TL+ + +  ++   +  ++       G+ N+ G+++ SN + 
Sbjct: 77  IHLPMAPISKQPLEKD--TLQPSMSEAEIQRIIHQAVNSVPYAVGMNNHMGSLMTSNLQG 134

Query: 285 AEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
            + + +   +   L F D  +   +     +    +  +   ++LDD  +   IR++   
Sbjct: 135 MQKVMRTLEQYHFLYFLDSMTIGNSQVTNASAGTGIKVIKRRVFLDDSQNEASIRQQFNR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
             +IAR  G AI +      ++ V+ Q L       V V P S L   S P
Sbjct: 195 AIQIARKNGSAIAIGHPHPSTVRVLQQMLPSLPADIVLVRPSSLLNGASVP 245


>gi|146309788|ref|YP_001174862.1| protein of unknown function DUF610, YibQ [Enterobacter sp. 638]
 gi|145316664|gb|ABP58811.1| protein of unknown function DUF610, YibQ [Enterobacter sp. 638]
          Length = 314

 Score =  271 bits (693), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 43/228 (18%), Positives = 91/228 (39%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S     ++AIV+   G  +   +  +  +P  I++A   N         +A   G E
Sbjct: 16  ALASPVYAGKLAIVIDDFGY-RPHNENQVLAMPTAISVAVLPNAPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R +  +     G+ N+ G+ + S+ 
Sbjct: 75  VLIHLPMAPLSKQPLEKD--TLRPDMSSDEIERIIRDAYGKVPFAVGLNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +   +     +    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSMTIGNSQALRASQGTGVKVIKRKVFLDDTQNDADIRAQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 193 RAVQLARRNGSAIAIGHPHPSTVRVLQQMLPTLPS-DITLVRPSDLLN 239


>gi|238764340|ref|ZP_04625291.1| hypothetical protein ykris0001_18390 [Yersinia kristensenii ATCC
           33638]
 gi|238697491|gb|EEP90257.1| hypothetical protein ykris0001_18390 [Yersinia kristensenii ATCC
           33638]
          Length = 336

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 95/227 (41%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             +     +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANAVQAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAKEMAIKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEVQRIIRQAVSNVPYATGMNNHMGSAMTSSFP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQALEHYQLYFLDSMTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLN 239


>gi|290477275|ref|YP_003470196.1| hypothetical protein XBJ1_4335 [Xenorhabdus bovienii SS-2004]
 gi|289176629|emb|CBJ83438.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 335

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 99/233 (42%), Gaps = 5/233 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F  NA  AR+AIV+   G       + I  +P  +++A   +        ++A K+G+E 
Sbjct: 28  FTLNAHAARLAIVIDDFGYRVHHENK-ILQMPTAVSIAILPDSPHGREMAQKAHKQGREI 86

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL  + + +++   +  ++++     G+ N+ G+ + S+  
Sbjct: 87  LIHLPMAPLSKQPLEK--NTLHPSMSREEIGRIIHDAIQKVPHAMGMNNHMGSAMTSSLN 144

Query: 284 SAEVIFKEFAK-RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             E + +  +    L F D  +  +      A    +  +   ++LD+     + R +L 
Sbjct: 145 GMENVMQVLSSYHHLYFLDSVTIGKTQVTKAAMGTPVQVLRRHVFLDNVQTEAETRHQLN 204

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
               +AR  G AI +   +  ++  + Q L      D+ +V  S L   +S S
Sbjct: 205 RAIALARKQGSAIAIGHPYPTTVRALQQALTALP-DDIELVTPSRLLNPTSAS 256


>gi|332159700|ref|YP_004296277.1| hypothetical protein YE105_C0076 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325663930|gb|ADZ40574.1| hypothetical protein YE105_C0076 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861126|emb|CBX71390.1| uncharacterized protein yibQ [Yersinia enterocolitica W22703]
          Length = 334

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + +   +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANTSLAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAKEMAIKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVKASALLN 239


>gi|51594416|ref|YP_068607.1| hypothetical protein YPTB0058 [Yersinia pseudotuberculosis IP
           32953]
 gi|153950008|ref|YP_001399074.1| divergent polysaccharide deacetylase [Yersinia pseudotuberculosis
           IP 31758]
 gi|170026350|ref|YP_001722855.1| hypothetical protein YPK_4143 [Yersinia pseudotuberculosis YPIII]
 gi|186893404|ref|YP_001870516.1| hypothetical protein YPTS_0060 [Yersinia pseudotuberculosis PB1/+]
 gi|51587698|emb|CAH19298.1| HYPOTHETICAL 30.7 KD PROTEIN IN SECB-TDH INTERGENIC REGION
           [Yersinia pseudotuberculosis IP 32953]
 gi|152961503|gb|ABS48964.1| Divergent polysaccharide deacetylase [Yersinia pseudotuberculosis
           IP 31758]
 gi|169752884|gb|ACA70402.1| protein of unknown function DUF610 YibQ [Yersinia
           pseudotuberculosis YPIII]
 gi|186696430|gb|ACC87059.1| protein of unknown function DUF610 YibQ [Yersinia
           pseudotuberculosis PB1/+]
          Length = 336

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 47/232 (20%), Positives = 95/232 (40%), Gaps = 4/232 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G       + I  +P  I++A   N         +A  +G+E 
Sbjct: 17  IASTAQAGKLSIVIDDFGYRPQNENK-ILQMPLPISVAILPNAPYAREMATKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R +        G+ N+ G+ + ++  
Sbjct: 76  LIHLPMAPQSKQPLERD--TLQPSMSSEEIQRIIRQAANNVPYAKGMNNHMGSAMTASLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQKVMQALGSYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKIFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
              +AR  G AI +      +I+V+ Q L Q    D+ +V  S L      S
Sbjct: 194 AVALARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLNEPVQS 244


>gi|291327262|ref|ZP_06127547.2| polysaccharide deacetylase family protein [Providencia rettgeri DSM
           1131]
 gi|291311023|gb|EFE51476.1| polysaccharide deacetylase family protein [Providencia rettgeri DSM
           1131]
          Length = 338

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 46/230 (20%), Positives = 100/230 (43%), Gaps = 4/230 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            C   S A++AIV+   G  +      I  L   +T+A   +        ++A ++G++ 
Sbjct: 2   MCLPVSAAKLAIVIDDFGY-RVKEDNQILALSPAVTIAILPSSPHGREVAEKAHQQGRDI 60

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E D  TL  + + +++   ++ ++ R     G+ N+ G+ + SN  
Sbjct: 61  LIHMPMKPLSKQPLEKD--TLVPSMSAEEIDRIIKNAITRVPYAKGMNNHMGSEMTSNLV 118

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +  +K  L F D  +         A +  +P +   +++D+    ++ R +L  
Sbjct: 119 GMRNVMQSLSKSNLFFLDSVTIGNTQAGNAAKEYGVPSLRRHIFIDNHQSEEETRTQLNK 178

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
               AR  G A+ +      ++  + ++L Q    DV +V +S L    S
Sbjct: 179 AVAYARKHGSAVAIGHPHPSTVRALQKYLAQLPA-DVELVAVSALLSPQS 227


>gi|90020140|ref|YP_525967.1| hypothetical protein Sde_0491 [Saccharophagus degradans 2-40]
 gi|89949740|gb|ABD79755.1| protein of unknown function DUF610, YibQ [Saccharophagus degradans
           2-40]
          Length = 382

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 75/358 (20%), Positives = 141/358 (39%), Gaps = 29/358 (8%)

Query: 37  IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLK 96
           IV L+    +  +  G   E    + + +       +P    ++    +           
Sbjct: 40  IVMLACIFALFQSCNGGNQETKNNTQLTQT---SENLPAEKTERPRTEQTPPLITAKP-- 94

Query: 97  NDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE 156
                   +        T  N+P  + +++  P IE           ++AK  V    TE
Sbjct: 95  -AEPGEPSESIGHTQTHTAENEPAAAKAVEDEPAIE-----------VIAKPAVPVNITE 142

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
                    S  +  RIAI++  +G      +  I  LP  +T AF        R  + A
Sbjct: 143 --------QSTVTSPRIAIIIDDIGYRFDEGRELIE-LPYPLTFAFIPFSPYGARLAELA 193

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
           K+  +  +L  PM   +ES  E    +L  T    +L+  L   L       GV N+ G+
Sbjct: 194 KQLNKPVMLHAPMATLNESKWEA---SLNPTMARTELIASLDAMLADIPHVTGVNNHGGS 250

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
           +   ++ES + + +  A+R L F D  ++ +++ +  A ++N+P+   D++LD++ D   
Sbjct: 251 LFTQSRESMQWLSEALAERELFFVDSRTTAQSVAKEEAQRVNIPFNERDVFLDNERDLPA 310

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           I  +L  L  IA   G+A+ +   + E+++ +   L     + V VV +  L     P
Sbjct: 311 IDSQLDKLVAIALKHGEAVAIGHPYPETLQALKARLPLLAAQGVEVVGIELLLNRHRP 368


>gi|253991822|ref|YP_003043178.1| hypothetical protein PAU_04350 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783272|emb|CAQ86437.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 301

 Score =  269 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F    S +R+AIV+   G       + I  +P  I++A   +        ++A K+ +E 
Sbjct: 17  FSLQTSASRLAIVIDDFGYRPHNESK-ILQMPVAISIAILPDSPYGREMAEKAYKQRREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ T + +++   ++ ++++     G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQRLEPD--TLQPTMSSEEIDRIIQQAIQKVPYAVGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + +    ++  L F D  +   +     A    +  +  +++LDD     + R +L  
Sbjct: 134 GMQKVMHSLSRYRLYFLDSVTIGNSQATKAAKGTPVRVIRRNVFLDDVQSEAETRYQLNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              IAR  G AI +      +I  + + L      D+ +V  S L 
Sbjct: 194 AISIARKNGSAIAIGHPHPTTIRALQKMLPTLPA-DIELVSPSMLL 238


>gi|157373053|ref|YP_001481042.1| hypothetical protein Spro_4821 [Serratia proteamaculans 568]
 gi|157324817|gb|ABV43914.1| protein of unknown function DUF610 YibQ [Serratia proteamaculans
           568]
          Length = 318

 Score =  269 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 98/229 (42%), Gaps = 4/229 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDVGY-RPHEEGAVLQMPTAISVAVLPNAPHAHLMATRAHSQGREVLIHM 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  + + 
Sbjct: 80  PMAPLSKQPLERD--TLQPSMSSEEIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPAMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +   +     A   ++  +   ++LDD  +   IR +     E+
Sbjct: 138 VMQALDSYQLYFLDSMTIGNSQATRAAAGTHVKVIKRKVFLDDTANEADIRRQFNRAVEL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           AR  G AI +      ++ V+ Q L      D+ +V  S L      SS
Sbjct: 198 ARRNGSAIAIGHPRPATVRVLQQMLPTLPA-DIVLVKPSSLLNEPQGSS 245


>gi|318603800|emb|CBY25298.1| putative divergent polysaccharide deacetylase [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 334

 Score =  269 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 95/227 (41%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + +   +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANTSLAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAKEMAIKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   I ++   
Sbjct: 134 GMQKVMQTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIHQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVKASALLN 239


>gi|212712560|ref|ZP_03320688.1| hypothetical protein PROVALCAL_03655 [Providencia alcalifaciens DSM
           30120]
 gi|212684776|gb|EEB44304.1| hypothetical protein PROVALCAL_03655 [Providencia alcalifaciens DSM
           30120]
          Length = 357

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 99/226 (43%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
            S A++AIV+   G  +      I  LP  I++A   N          A ++G++ ++ +
Sbjct: 22  VSAAKLAIVIDDFGY-RVKEDNQILALPVAISIAILPNSPHGAEVAATAYQQGRDILIHM 80

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+   +   E D  TL  + + +++   ++ ++ R     G+ N+ G+ + S+      
Sbjct: 81  PMKPLSKQPLEKD--TLAPSMSAEEVDRIIKNAISRVPHAKGMNNHMGSEMTSSLSGMRN 138

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  ++  L F D  +         A +  +P    ++++D+    ++ R +L      
Sbjct: 139 VMRSLSQSNLFFLDSVTIGNTQAVNAAKEFGVPSAKRNIFIDNHQSEEETRTQLNKAIAY 198

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AR  G A+ +      ++  + +++ Q    D+ +VP+S L    S
Sbjct: 199 ARKHGSAVAIGHPHPSTVRALQKFIPQVPA-DIELVPVSTLVNHQS 243


>gi|238783976|ref|ZP_04627992.1| hypothetical protein yberc0001_4960 [Yersinia bercovieri ATCC
           43970]
 gi|238715084|gb|EEQ07080.1| hypothetical protein yberc0001_4960 [Yersinia bercovieri ATCC
           43970]
          Length = 342

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   +++IV+   G       + +  +P  I++A   N         +A  +G+E 
Sbjct: 17  IANAAQAGKLSIVIDDFGYRPQNENKVLQ-MPLPISVAILPNAPYAREMAVKAHNQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLERD--TLQPSMSSEEIQRIIRQAVNNVPYAKGMNNHMGSAMTSSLP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR++   
Sbjct: 134 GMQRVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L  
Sbjct: 194 AVELARRNGSAIAIGHPHPATIKVLQQMLPQLPS-DIVLVKPSALLN 239


>gi|146291148|ref|YP_001181572.1| hypothetical protein Sputcn32_0037 [Shewanella putrefaciens CN-32]
 gi|145562838|gb|ABP73773.1| protein of unknown function DUF610, YibQ [Shewanella putrefaciens
           CN-32]
 gi|319428503|gb|ADV56577.1| protein of unknown function DUF610 YibQ [Shewanella putrefaciens
           200]
          Length = 247

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + + +   +IA+++  +G  Q  T  A+  LP  +TL+   +    +   K   +KG E 
Sbjct: 13  YVAPSYATKIALIIDDIGYRQ--TDEAVLSLPHTVTLSVLPHTPLGENLAKVGHRKGHEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +          L       ++   +  ++       G  N+ G++L     
Sbjct: 71  MLHLPMQAINGKAL--GPGGLTKGMDEAEIRANVSSAIANIPFAKGANNHMGSLLTQLDS 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  L F D  ++P +     A +L +P +   L+LD+ V +  + ++   
Sbjct: 129 HMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLGIPSLKRQLFLDNNVSKKALEKQFNL 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           +   A   G  + +A  + E+I  +   L       + +VP+S L  +
Sbjct: 189 MISNAHMQGSLVVIAHPYPETIRFLQANLPLLEAEGIDLVPVSDLLPI 236


>gi|71278442|ref|YP_271042.1| hypothetical protein CPS_4393 [Colwellia psychrerythraea 34H]
 gi|71144182|gb|AAZ24655.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 259

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 90/230 (39%), Gaps = 4/230 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +  S A   ++AIV+  +G     T +    LP  IT AF  +     +   +A     +
Sbjct: 23  SVQSIAQANQVAIVIDDMGYRY--TDKHALTLPGAITYAFLPHTTYGKKLAMQANSTNHD 80

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ IPM++ +          L      Q     L  S        G+ N+ G+ L    
Sbjct: 81  VLIHIPMESENRKKL--GPGALTSNMDEQAFSQSLTKSFAEIPFAIGINNHMGSYLTQLY 138

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           +          +  L F D  +SP +  +  A    +P     ++LD+++    I ++ K
Sbjct: 139 QPMAWTMTFLKQHDLFFLDSKTSPHSQAQQAAIDFGVPVKARHIFLDNELTEKYISQQFK 198

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            L   A+    AI +A    E++  +++ +    +  + +VPLS L   S
Sbjct: 199 QLIHFAQKHQTAIAIAHPHPETVATLNKLIPTLKLHGIELVPLSRLYPTS 248


>gi|296100521|ref|YP_003610667.1| hypothetical protein ECL_00150 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295054980|gb|ADF59718.1| hypothetical protein ECL_00150 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 310

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 91/232 (39%), Gaps = 4/232 (1%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
           A      +     ++AIV+   G       + +  +PA I++A   N         +A  
Sbjct: 12  ASALALVAPVYAGKLAIVIDDFGYRPHYENQVLA-MPAAISVAVLPNAPHAREMATKAHN 70

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
            G + ++ +PM    +   E D  TL+   +  ++   +R +  +     G+ N+ G+ +
Sbjct: 71  SGHQVLIHLPMAPISKQPLEKD--TLRPEMSSDEIDRIIRDAYNKVPYAVGLNNHMGSAM 128

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            S+      + +   +  L F D  +   +     A    +  +   ++LDD  +   IR
Sbjct: 129 TSSLYGMLKVMQALERYNLYFLDSMTIGNSQAMRAAQGTGVKVIKRKVFLDDTQNEADIR 188

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            +     ++AR  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 189 VQFNRAVQLARRNGSAIAIGHPHPSTVRVLQQMLPTLPS-DITLVRPSDLLN 239


>gi|282600473|ref|ZP_05974435.2| YibQ protein [Providencia rustigianii DSM 4541]
 gi|282565189|gb|EFB70724.1| YibQ protein [Providencia rustigianii DSM 4541]
          Length = 364

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 102/227 (44%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            CS AS A++AIV+   G  +      I  +PA I++A   N         +A ++G++ 
Sbjct: 35  ICSQASAAKLAIVIDDFGY-RAKEDNQILAMPAAISIAILPNSPHGIEVATQAYQQGRDI 93

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E D  TL  + + + +   ++ ++ R     G+ N+ G+ + S+  
Sbjct: 94  LIHMPMKPLSKQPLEKD--TLTPSMSAEDVDRIIKNAISRVPHAKGMNNHMGSEMTSSLS 151

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +  ++  L F D  +      +  A +  +P    ++++D+    ++ R +L  
Sbjct: 152 GMRNVMRSLSQSNLFFLDSVTIGNTQAQNAAKEFGVPSTKRNIFIDNHQSEEETRAQLNK 211

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               AR  G A+ +      ++  + +++      DV +VP+S L  
Sbjct: 212 AISYARKHGSAVAIGHPHPSTVRALQKFIP-LIPADVELVPVSTLVN 257


>gi|120600823|ref|YP_965397.1| hypothetical protein Sputw3181_4041 [Shewanella sp. W3-18-1]
 gi|120560916|gb|ABM26843.1| protein of unknown function DUF610, YibQ [Shewanella sp. W3-18-1]
          Length = 247

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + + +  A+IA+++  +G  Q  T  A+  LP  +TL+   +    +   K    KG E 
Sbjct: 13  YVAPSYAAKIALIIDDIGYRQ--TDEAVLSLPHTVTLSVLPHTPLGENLAKVGHSKGHEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +          L       ++   +  ++       G  N+ G++L     
Sbjct: 71  MLHLPMQAINGKAL--GPGGLTKGMDEAEIRANVSSAIANIPFAKGANNHMGSLLTQLDS 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  L F D  ++P +     A +L +P +   L+LD+ V +  + ++   
Sbjct: 129 HMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLGIPSLKRQLFLDNNVSKKALEKQFNL 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           +   A   G  + +A  + E+I  +   L       + +VP+S L  +
Sbjct: 189 MISNAHMQGSLVVIAHPYPETIRFLQANLPLLEAEGIDLVPVSDLLPI 236


>gi|26250262|ref|NP_756302.1| hypothetical protein c4440 [Escherichia coli CFT073]
 gi|91213132|ref|YP_543118.1| hypothetical protein UTI89_C4159 [Escherichia coli UTI89]
 gi|218560689|ref|YP_002393602.1| polysaccharide deacetylase [Escherichia coli S88]
 gi|227883784|ref|ZP_04001589.1| divergent polysaccharide deacetylase [Escherichia coli 83972]
 gi|237703387|ref|ZP_04533868.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300984983|ref|ZP_07177235.1| divergent polysaccharide deacetylase [Escherichia coli MS 45-1]
 gi|301047406|ref|ZP_07194486.1| divergent polysaccharide deacetylase [Escherichia coli MS 185-1]
 gi|26110691|gb|AAN82876.1|AE016768_294 Hypothetical protein yibQ precursor [Escherichia coli CFT073]
 gi|91074706|gb|ABE09587.1| hypothetical protein YibQ precursor [Escherichia coli UTI89]
 gi|218367458|emb|CAR05240.1| putative polysaccharide deacetylase [Escherichia coli S88]
 gi|226902651|gb|EEH88910.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227839062|gb|EEJ49528.1| divergent polysaccharide deacetylase [Escherichia coli 83972]
 gi|294494032|gb|ADE92788.1| polysaccharide deacetylase family protein [Escherichia coli
           IHE3034]
 gi|300300680|gb|EFJ57065.1| divergent polysaccharide deacetylase [Escherichia coli MS 185-1]
 gi|300408263|gb|EFJ91801.1| divergent polysaccharide deacetylase [Escherichia coli MS 45-1]
 gi|307555716|gb|ADN48491.1| hypothetical protein YibQ precursor [Escherichia coli ABU 83972]
 gi|307628691|gb|ADN72995.1| putative polysaccharide deacetylase [Escherichia coli UM146]
 gi|315285352|gb|EFU44797.1| divergent polysaccharide deacetylase [Escherichia coli MS 110-3]
 gi|315292992|gb|EFU52344.1| divergent polysaccharide deacetylase [Escherichia coli MS 153-1]
 gi|323949856|gb|EGB45740.1| divergent polysaccharide deacetylase [Escherichia coli H252]
 gi|323954843|gb|EGB50623.1| divergent polysaccharide deacetylase [Escherichia coli H263]
          Length = 319

 Score =  268 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRMQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|322835022|ref|YP_004215049.1| hypothetical protein Rahaq_4336 [Rahnella sp. Y9602]
 gi|321170223|gb|ADW75922.1| protein of unknown function DUF610 YibQ [Rahnella sp. Y9602]
          Length = 309

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 97/227 (42%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F      A+++I++   G  Q   +  +  +P  +++A   N       M +A ++G+E 
Sbjct: 17  FACQVQAAKLSILIDDFGYRQ-HEENQVLQMPKAVSVAIFPNAPDSQMMMNKAHQQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL  + +  ++   +  ++       G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLEKD--TLTPSMSAAEVKRIVDQAIINIPYAIGINNHMGSAMTSSLT 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             E + +      L F D  +     +   A    +  +  +++LDD  +  +IR + + 
Sbjct: 134 GMENVMQAMNAHNLFFLDSMTIGNTQSVKAAQGTRVKVIKRNVFLDDVQNEAEIRRQFER 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             ++AR  G AI +      +++V+ Q L      D+ +V  S L  
Sbjct: 194 AIQLARKNGYAIAIGHPHPTTVKVLQQMLPNLPS-DIVLVRPSDLLN 239


>gi|300939215|ref|ZP_07153896.1| divergent polysaccharide deacetylase [Escherichia coli MS 21-1]
 gi|300455896|gb|EFK19389.1| divergent polysaccharide deacetylase [Escherichia coli MS 21-1]
          Length = 319

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 89/226 (39%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|320193877|gb|EFW68510.1| putative divergent polysaccharide deacetylase [Escherichia coli
           WV_060327]
          Length = 319

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRMQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|218707251|ref|YP_002414770.1| putative polysaccharide deacetylase [Escherichia coli UMN026]
 gi|293407240|ref|ZP_06651164.1| yibQ protein [Escherichia coli FVEC1412]
 gi|298382986|ref|ZP_06992581.1| yibQ protein [Escherichia coli FVEC1302]
 gi|300898550|ref|ZP_07116882.1| divergent polysaccharide deacetylase [Escherichia coli MS 198-1]
 gi|218434348|emb|CAR15272.1| putative polysaccharide deacetylase [Escherichia coli UMN026]
 gi|284923650|emb|CBG36747.1| putative polysaccharide deacetylase [Escherichia coli 042]
 gi|291426051|gb|EFE99085.1| yibQ protein [Escherichia coli FVEC1412]
 gi|298276822|gb|EFI18340.1| yibQ protein [Escherichia coli FVEC1302]
 gi|300357770|gb|EFJ73640.1| divergent polysaccharide deacetylase [Escherichia coli MS 198-1]
          Length = 319

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|331685279|ref|ZP_08385865.1| YibQ protein product [Escherichia coli H299]
 gi|331077650|gb|EGI48862.1| YibQ protein product [Escherichia coli H299]
          Length = 319

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|293413051|ref|ZP_06655719.1| yibQ protein [Escherichia coli B354]
 gi|331675098|ref|ZP_08375855.1| YibQ protein product [Escherichia coli TA280]
 gi|291468698|gb|EFF11191.1| yibQ protein [Escherichia coli B354]
 gi|331068007|gb|EGI39405.1| YibQ protein product [Escherichia coli TA280]
          Length = 319

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|256021379|ref|ZP_05435244.1| putative polysaccharide deacetylase [Shigella sp. D9]
 gi|332282613|ref|ZP_08395026.1| polysaccharide deacetylase [Shigella sp. D9]
 gi|332104965|gb|EGJ08311.1| polysaccharide deacetylase [Shigella sp. D9]
          Length = 319

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|332996160|gb|EGK15787.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri VA-6]
          Length = 319

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|323166902|gb|EFZ52641.1| divergent polysaccharide deacetylase family protein [Shigella
           sonnei 53G]
          Length = 319

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPNNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|320644962|gb|EFX13992.1| putative polysaccharide deacetylase [Escherichia coli O157:H- str.
           493-89]
 gi|320650229|gb|EFX18718.1| putative polysaccharide deacetylase [Escherichia coli O157:H- str.
           H 2687]
          Length = 319

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|323173207|gb|EFZ58836.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli LT-68]
          Length = 319

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E
Sbjct: 16  ALSSPVLAGKLAIVIDDFGY-RPHNENQVLEMPSAISVAVLPDSPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|297519266|ref|ZP_06937652.1| putative polysaccharide deacetylase [Escherichia coli OP50]
          Length = 319

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 89/226 (39%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A   ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPALAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|331659937|ref|ZP_08360875.1| YibQ protein product [Escherichia coli TA206]
 gi|331053152|gb|EGI25185.1| YibQ protein product [Escherichia coli TA206]
          Length = 319

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 88/228 (38%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S     ++AIV+   G       + +  +P+ I++A   +         +A   G E
Sbjct: 16  ALSSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|168766036|ref|ZP_02791043.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|189364563|gb|EDU82982.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4486]
          Length = 319

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|188493391|ref|ZP_03000661.1| divergent polysaccharide deacetylase [Escherichia coli 53638]
 gi|218697338|ref|YP_002405005.1| putative polysaccharide deacetylase [Escherichia coli 55989]
 gi|293417079|ref|ZP_06659706.1| hypothetical protein ECDG_04229 [Escherichia coli B185]
 gi|293463941|ref|ZP_06664355.1| hypothetical protein ECCG_04022 [Escherichia coli B088]
 gi|309784406|ref|ZP_07679045.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 1617]
 gi|188488590|gb|EDU63693.1| divergent polysaccharide deacetylase [Escherichia coli 53638]
 gi|218354070|emb|CAV00606.1| putative polysaccharide deacetylase [Escherichia coli 55989]
 gi|291321573|gb|EFE61009.1| hypothetical protein ECCG_04022 [Escherichia coli B088]
 gi|291431110|gb|EFF04103.1| hypothetical protein ECDG_04229 [Escherichia coli B185]
 gi|308927913|gb|EFP73381.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 1617]
 gi|320201358|gb|EFW75939.1| putative divergent polysaccharide deacetylase [Escherichia coli
           EC4100B]
 gi|323934840|gb|EGB31222.1| divergent polysaccharide deacetylase [Escherichia coli E1520]
 gi|324116044|gb|EGC09970.1| divergent polysaccharide deacetylase [Escherichia coli E1167]
          Length = 319

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|270265206|ref|ZP_06193468.1| hypothetical protein SOD_l00560 [Serratia odorifera 4Rx13]
 gi|270040840|gb|EFA13942.1| hypothetical protein SOD_l00560 [Serratia odorifera 4Rx13]
          Length = 321

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 97/229 (42%), Gaps = 4/229 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDVGY-RPHEEGAVLQMPTAISVAVLPNAPHARLMATRAHSQGREVLIHM 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+ + + +++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSKQPLERD--TLQPSMSSEEIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +   +     A    +  +   ++LDD  +   IR +     ++
Sbjct: 138 VMQALESYRLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDDTANEADIRRQFNRAVDL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           AR  G AI +      +++V+ Q L      D+ +V  S L      +S
Sbjct: 198 ARRNGSAIAIGHPRPATVKVLQQMLPTLPA-DIVLVKPSSLLNEPQSNS 245


>gi|331006625|ref|ZP_08329910.1| hypothetical protein IMCC1989_515 [gamma proteobacterium IMCC1989]
 gi|330419564|gb|EGG93945.1| hypothetical protein IMCC1989_515 [gamma proteobacterium IMCC1989]
          Length = 349

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 55/223 (24%), Positives = 100/223 (44%), Gaps = 3/223 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AI++  LG +     +A+  LP  IT A   +      + +EA+K  +E +L  PM   
Sbjct: 111 VAIIIDDLGYNYEQGLKAMQ-LPGAITYAIIPHSPKAQFFAQEAQKHNKEIMLHAPMSTI 169

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           +          L            L  SL       G+ N+ G++L    +    + +  
Sbjct: 170 NHKPL--GKNGLTGLMEEADFKQVLNQSLLSLPSVKGMNNHMGSLLTQKSQPMSWVMQSL 227

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +R L F D  +S +++   +A +  +P +  D++LD + +   I ++ K L   A+  G
Sbjct: 228 KQRQLYFIDSRTSAQSVAWDIAQQYGIPSLKRDVFLDHEPNEAFIDKQFKLLISTAKHQG 287

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            A+ +A    E++  +S  L + H   +S+VP S LAK  SP+
Sbjct: 288 YAVAIAHPHPETVAYLSLNLSRLHDAGISLVPASELAKRFSPN 330


>gi|110643858|ref|YP_671588.1| hypothetical protein ECP_3715 [Escherichia coli 536]
 gi|191170375|ref|ZP_03031928.1| polysaccharide deacetylase family protein [Escherichia coli F11]
 gi|215488894|ref|YP_002331325.1| predicted polysaccharide deacetylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218691901|ref|YP_002400113.1| putative polysaccharide deacetylase [Escherichia coli ED1a]
 gi|218702383|ref|YP_002410012.1| putative polysaccharide deacetylase [Escherichia coli IAI39]
 gi|301018946|ref|ZP_07183169.1| divergent polysaccharide deacetylase [Escherichia coli MS 69-1]
 gi|306816035|ref|ZP_07450173.1| putative polysaccharide deacetylase [Escherichia coli NC101]
 gi|312968044|ref|ZP_07782255.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 2362-75]
 gi|331649432|ref|ZP_08350518.1| YibQ protein product [Escherichia coli M605]
 gi|331665242|ref|ZP_08366143.1| YibQ protein product [Escherichia coli TA143]
 gi|110345450|gb|ABG71687.1| hypothetical protein YibQ precursor [Escherichia coli 536]
 gi|190909183|gb|EDV68769.1| polysaccharide deacetylase family protein [Escherichia coli F11]
 gi|215266966|emb|CAS11411.1| predicted polysaccharide deacetylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218372369|emb|CAR20243.1| putative polysaccharide deacetylase [Escherichia coli IAI39]
 gi|218429465|emb|CAR10430.2| putative polysaccharide deacetylase [Escherichia coli ED1a]
 gi|222035325|emb|CAP78070.1| Uncharacterized protein yibQ [Escherichia coli LF82]
 gi|300399440|gb|EFJ82978.1| divergent polysaccharide deacetylase [Escherichia coli MS 69-1]
 gi|305850431|gb|EFM50888.1| putative polysaccharide deacetylase [Escherichia coli NC101]
 gi|312287303|gb|EFR15212.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 2362-75]
 gi|312948178|gb|ADR29005.1| putative polysaccharide deacetylase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315297051|gb|EFU56331.1| divergent polysaccharide deacetylase [Escherichia coli MS 16-3]
 gi|323189343|gb|EFZ74625.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli RN587/1]
 gi|324008122|gb|EGB77341.1| divergent polysaccharide deacetylase [Escherichia coli MS 57-2]
 gi|324012623|gb|EGB81842.1| divergent polysaccharide deacetylase [Escherichia coli MS 60-1]
 gi|330909679|gb|EGH38193.1| putative divergent polysaccharide deacetylase [Escherichia coli
           AA86]
 gi|331041930|gb|EGI14074.1| YibQ protein product [Escherichia coli M605]
 gi|331057752|gb|EGI29738.1| YibQ protein product [Escherichia coli TA143]
          Length = 319

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|170683133|ref|YP_001745916.1| polysaccharide deacetylase family protein [Escherichia coli
           SMS-3-5]
 gi|170520851|gb|ACB19029.1| polysaccharide deacetylase family protein [Escherichia coli
           SMS-3-5]
          Length = 319

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|194431299|ref|ZP_03063592.1| polysaccharide deacetylase family protein [Shigella dysenteriae
           1012]
 gi|194420754|gb|EDX36830.1| polysaccharide deacetylase family protein [Shigella dysenteriae
           1012]
 gi|320179953|gb|EFW54895.1| putative divergent polysaccharide deacetylase [Shigella boydii ATCC
           9905]
 gi|332084497|gb|EGI89692.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 155-74]
 gi|332084797|gb|EGI89980.1| divergent polysaccharide deacetylase family protein [Shigella
           boydii 5216-82]
          Length = 319

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 89/226 (39%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +  A+  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|260870347|ref|YP_003236749.1| putative polysaccharide deacetylase [Escherichia coli O111:H- str.
           11128]
 gi|257766703|dbj|BAI38198.1| predicted polysaccharide deacetylase [Escherichia coli O111:H- str.
           11128]
          Length = 319

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|294638294|ref|ZP_06716547.1| YibQ protein [Edwardsiella tarda ATCC 23685]
 gi|291088547|gb|EFE21108.1| YibQ protein [Edwardsiella tarda ATCC 23685]
          Length = 294

 Score =  266 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 48/230 (20%), Positives = 94/230 (40%), Gaps = 5/230 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A   ++AIV+   G  +   ++ +  LP  IT+A   N          A  +G+E 
Sbjct: 1   MAAPAQAGKLAIVIDDFGY-RPHEEKQVLALPLPITIAVLPNAPHAREMALRAHAQGREI 59

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+ T +  ++   +  ++       G+ N+ G+ + SN  
Sbjct: 60  LIHLPMAPLSKQPLER--NTLQPTMSEAEIQRIIHQAVDNVPYAVGMNNHMGSAMTSNLA 117

Query: 284 SAEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             + + +   +   L F D  +   +     A    +  +   ++LDD  +   IR +L 
Sbjct: 118 GMQKVMRALEQYHFLYFLDSVTIAHSQVSNAAQGTGVKVIKRKVFLDDAQNESAIRAQLN 177

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
              ++AR  G AI +      ++ V+ Q L      D+ +V  S L   S
Sbjct: 178 RAIQLARRNGSAIAIGHPHPTTVRVLQQMLPNLPA-DIVLVKPSALLNES 226


>gi|194435962|ref|ZP_03068065.1| polysaccharide deacetylase family protein [Escherichia coli 101-1]
 gi|194425505|gb|EDX41489.1| polysaccharide deacetylase family protein [Escherichia coli 101-1]
          Length = 319

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL    +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLCPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|320176324|gb|EFW51384.1| putative divergent polysaccharide deacetylase [Shigella dysenteriae
           CDC 74-1112]
 gi|320186843|gb|EFW61563.1| putative divergent polysaccharide deacetylase [Shigella flexneri
           CDC 796-83]
 gi|332089546|gb|EGI94650.1| divergent polysaccharide deacetylase family protein [Shigella
           boydii 3594-74]
          Length = 319

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPLTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|218556179|ref|YP_002389092.1| putative polysaccharide deacetylase [Escherichia coli IAI1]
 gi|218362947|emb|CAR00584.1| putative polysaccharide deacetylase [Escherichia coli IAI1]
          Length = 319

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRRAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGYTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|261341775|ref|ZP_05969633.1| hypothetical protein ENTCAN_08255 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316144|gb|EFC55082.1| YibQ protein product [Enterobacter cancerogenus ATCC 35316]
          Length = 304

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 89/224 (39%), Gaps = 4/224 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G       + +  +P+ I++A   N         +A   G + ++ 
Sbjct: 14  PVYAGKLAIVIDDFGYRPHYENQVLA-MPSAISVAVLPNAPHAREMATKAHNSGHQVLIH 72

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E D  TL+   +  ++   +R +  +     G+ N+ G+ + S+     
Sbjct: 73  LPMAPLSKQPLEKD--TLRPEMSSDEIDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYGML 130

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +   +  L F D  +   +     A    +  +   ++LDD  +   IR +     +
Sbjct: 131 KVMQSLERYNLYFLDSMTIGNSQAMRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQ 190

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           +AR  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 191 LARRNGSAIAIGHPHPSTVRVLQQMLPTLPA-DITLVRPSDLLN 233


>gi|38704183|ref|NP_312519.2| hypothetical protein ECs4492 [Escherichia coli O157:H7 str. Sakai]
 gi|157157521|ref|YP_001465097.1| polysaccharide deacetylase family protein [Escherichia coli
           E24377A]
 gi|157163098|ref|YP_001460416.1| polysaccharide deacetylase family protein [Escherichia coli HS]
 gi|168746834|ref|ZP_02771856.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|168753440|ref|ZP_02778447.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|168759714|ref|ZP_02784721.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|168772418|ref|ZP_02797425.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|168779772|ref|ZP_02804779.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|168785494|ref|ZP_02810501.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|168797460|ref|ZP_02822467.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|170018153|ref|YP_001723107.1| protein of unknown function DUF610 YibQ [Escherichia coli ATCC
           8739]
 gi|191168137|ref|ZP_03029934.1| polysaccharide deacetylase family protein [Escherichia coli B7A]
 gi|193068550|ref|ZP_03049512.1| polysaccharide deacetylase family protein [Escherichia coli
           E110019]
 gi|208807566|ref|ZP_03249903.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208814455|ref|ZP_03255784.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208820448|ref|ZP_03260768.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209399753|ref|YP_002273096.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209921088|ref|YP_002295172.1| hypothetical protein ECSE_3897 [Escherichia coli SE11]
 gi|217325442|ref|ZP_03441526.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|253771543|ref|YP_003034374.1| hypothetical protein ECBD_0111 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163544|ref|YP_003046652.1| putative polysaccharide deacetylase [Escherichia coli B str.
           REL606]
 gi|254795572|ref|YP_003080409.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224201|ref|ZP_05938482.1| predicted polysaccharide deacetylase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254812|ref|ZP_05947345.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284988|ref|YP_003501806.1| hypothetical protein G2583_4353 [Escherichia coli O55:H7 str.
           CB9615]
 gi|300815145|ref|ZP_07095370.1| divergent polysaccharide deacetylase [Escherichia coli MS 107-1]
 gi|300822387|ref|ZP_07102527.1| divergent polysaccharide deacetylase [Escherichia coli MS 119-7]
 gi|300907658|ref|ZP_07125286.1| divergent polysaccharide deacetylase [Escherichia coli MS 84-1]
 gi|300919816|ref|ZP_07136291.1| divergent polysaccharide deacetylase [Escherichia coli MS 115-1]
 gi|300923401|ref|ZP_07139442.1| divergent polysaccharide deacetylase [Escherichia coli MS 182-1]
 gi|300927953|ref|ZP_07143512.1| divergent polysaccharide deacetylase [Escherichia coli MS 187-1]
 gi|300948053|ref|ZP_07162192.1| divergent polysaccharide deacetylase [Escherichia coli MS 116-1]
 gi|300954492|ref|ZP_07166941.1| divergent polysaccharide deacetylase [Escherichia coli MS 175-1]
 gi|301303850|ref|ZP_07209969.1| divergent polysaccharide deacetylase [Escherichia coli MS 124-1]
 gi|301325299|ref|ZP_07218806.1| divergent polysaccharide deacetylase [Escherichia coli MS 78-1]
 gi|301644280|ref|ZP_07244283.1| divergent polysaccharide deacetylase [Escherichia coli MS 146-1]
 gi|307140313|ref|ZP_07499669.1| putative polysaccharide deacetylase [Escherichia coli H736]
 gi|307314298|ref|ZP_07593906.1| protein of unknown function DUF610 YibQ [Escherichia coli W]
 gi|309797485|ref|ZP_07691876.1| divergent polysaccharide deacetylase [Escherichia coli MS 145-7]
 gi|312972100|ref|ZP_07786274.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1827-70]
 gi|331644333|ref|ZP_08345462.1| YibQ protein product [Escherichia coli H736]
 gi|331655247|ref|ZP_08356246.1| YibQ protein product [Escherichia coli M718]
 gi|331670458|ref|ZP_08371297.1| YibQ protein product [Escherichia coli TA271]
 gi|331679708|ref|ZP_08380378.1| YibQ protein product [Escherichia coli H591]
 gi|157068778|gb|ABV08033.1| polysaccharide deacetylase family protein [Escherichia coli HS]
 gi|157079551|gb|ABV19259.1| polysaccharide deacetylase family protein [Escherichia coli
           E24377A]
 gi|169753081|gb|ACA75780.1| protein of unknown function DUF610 YibQ [Escherichia coli ATCC
           8739]
 gi|187771729|gb|EDU35573.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|188018304|gb|EDU56426.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|189002373|gb|EDU71359.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|189358842|gb|EDU77261.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|189369563|gb|EDU87979.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|189374594|gb|EDU93010.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|189380099|gb|EDU98515.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|190901806|gb|EDV61558.1| polysaccharide deacetylase family protein [Escherichia coli B7A]
 gi|192958201|gb|EDV88642.1| polysaccharide deacetylase family protein [Escherichia coli
           E110019]
 gi|208727367|gb|EDZ76968.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208735732|gb|EDZ84419.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208740571|gb|EDZ88253.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209161153|gb|ACI38586.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209914347|dbj|BAG79421.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|217321663|gb|EEC30087.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|242379138|emb|CAQ33940.1| putative nucleoside (IDP) diphosphatase [Escherichia coli
           BL21(DE3)]
 gi|253322587|gb|ACT27189.1| protein of unknown function DUF610 YibQ [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975445|gb|ACT41116.1| predicted polysaccharide deacetylase [Escherichia coli B str.
           REL606]
 gi|253979601|gb|ACT45271.1| predicted polysaccharide deacetylase [Escherichia coli BL21(DE3)]
 gi|254594972|gb|ACT74333.1| predicted polysaccharide deacetylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|281602976|gb|ADA75960.1| Polysaccharide deacetylase family protein [Shigella flexneri
           2002017]
 gi|290764861|gb|ADD58822.1| Uncharacterized protein conserved in bacteria [Escherichia coli
           O55:H7 str. CB9615]
 gi|300318525|gb|EFJ68309.1| divergent polysaccharide deacetylase [Escherichia coli MS 175-1]
 gi|300400594|gb|EFJ84132.1| divergent polysaccharide deacetylase [Escherichia coli MS 84-1]
 gi|300413169|gb|EFJ96479.1| divergent polysaccharide deacetylase [Escherichia coli MS 115-1]
 gi|300420311|gb|EFK03622.1| divergent polysaccharide deacetylase [Escherichia coli MS 182-1]
 gi|300452394|gb|EFK16014.1| divergent polysaccharide deacetylase [Escherichia coli MS 116-1]
 gi|300464045|gb|EFK27538.1| divergent polysaccharide deacetylase [Escherichia coli MS 187-1]
 gi|300525034|gb|EFK46103.1| divergent polysaccharide deacetylase [Escherichia coli MS 119-7]
 gi|300532037|gb|EFK53099.1| divergent polysaccharide deacetylase [Escherichia coli MS 107-1]
 gi|300840813|gb|EFK68573.1| divergent polysaccharide deacetylase [Escherichia coli MS 124-1]
 gi|300847826|gb|EFK75586.1| divergent polysaccharide deacetylase [Escherichia coli MS 78-1]
 gi|301077380|gb|EFK92186.1| divergent polysaccharide deacetylase [Escherichia coli MS 146-1]
 gi|306906121|gb|EFN36640.1| protein of unknown function DUF610 YibQ [Escherichia coli W]
 gi|308118921|gb|EFO56183.1| divergent polysaccharide deacetylase [Escherichia coli MS 145-7]
 gi|310334477|gb|EFQ00682.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1827-70]
 gi|315062905|gb|ADT77232.1| predicted polysaccharide deacetylase [Escherichia coli W]
 gi|315254003|gb|EFU33971.1| divergent polysaccharide deacetylase [Escherichia coli MS 85-1]
 gi|320191332|gb|EFW65982.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. EC1212]
 gi|320639523|gb|EFX09131.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           G5101]
 gi|320655581|gb|EFX23509.1| putative polysaccharide deacetylase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661315|gb|EFX28739.1| putative polysaccharide deacetylase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666329|gb|EFX33328.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323376502|gb|ADX48770.1| protein of unknown function DUF610 YibQ [Escherichia coli KO11]
 gi|323939624|gb|EGB35830.1| divergent polysaccharide deacetylase [Escherichia coli E482]
 gi|323944070|gb|EGB40150.1| divergent polysaccharide deacetylase [Escherichia coli H120]
 gi|323959865|gb|EGB55513.1| divergent polysaccharide deacetylase [Escherichia coli H489]
 gi|323971259|gb|EGB66504.1| divergent polysaccharide deacetylase [Escherichia coli TA007]
 gi|324019726|gb|EGB88945.1| divergent polysaccharide deacetylase [Escherichia coli MS 117-3]
 gi|326337384|gb|EGD61219.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. 1044]
 gi|326339909|gb|EGD63716.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. 1125]
 gi|331036627|gb|EGI08853.1| YibQ protein product [Escherichia coli H736]
 gi|331047262|gb|EGI19340.1| YibQ protein product [Escherichia coli M718]
 gi|331062520|gb|EGI34440.1| YibQ protein product [Escherichia coli TA271]
 gi|331072880|gb|EGI44205.1| YibQ protein product [Escherichia coli H591]
 gi|332749934|gb|EGJ80346.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-671]
 gi|332750094|gb|EGJ80505.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 4343-70]
 gi|332751254|gb|EGJ81657.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2747-71]
 gi|332764186|gb|EGJ94423.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2930-71]
 gi|332997354|gb|EGK16970.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-218]
 gi|333012897|gb|EGK32274.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-304]
          Length = 319

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|323965881|gb|EGB61329.1| divergent polysaccharide deacetylase [Escherichia coli M863]
 gi|327250739|gb|EGE62441.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli STEC_7v]
          Length = 319

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|89110397|ref|AP_004177.1| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. W3110]
 gi|90111621|ref|NP_418071.4| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|170083122|ref|YP_001732442.1| polysaccharide deacetylase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238902705|ref|YP_002928501.1| putative polysaccharide deacetylase [Escherichia coli BW2952]
 gi|254038815|ref|ZP_04872867.1| polysaccharide deacetylase [Escherichia sp. 1_1_43]
 gi|18545478|sp|P37691|YIBQ_ECOLI RecName: Full=Uncharacterized protein yibQ; Flags: Precursor
 gi|85676428|dbj|BAE77678.1| predicted polysaccharide deacetylase [Escherichia coli str. K12
           substr. W3110]
 gi|87082298|gb|AAC76638.2| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|169890957|gb|ACB04664.1| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|226838780|gb|EEH70807.1| polysaccharide deacetylase [Escherichia sp. 1_1_43]
 gi|238862835|gb|ACR64833.1| predicted polysaccharide deacetylase [Escherichia coli BW2952]
 gi|260447367|gb|ACX37789.1| protein of unknown function DUF610 YibQ [Escherichia coli DH1]
 gi|309704018|emb|CBJ03364.1| putative polysaccharide deacetylase [Escherichia coli ETEC H10407]
 gi|315138196|dbj|BAJ45355.1| putative polysaccharide deacetylase [Escherichia coli DH1]
          Length = 319

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPATVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|187731969|ref|YP_001882314.1| polysaccharide deacetylase family protein [Shigella boydii CDC
           3083-94]
 gi|187428961|gb|ACD08235.1| polysaccharide deacetylase family protein [Shigella boydii CDC
           3083-94]
          Length = 319

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPLTVRVLQQMVYNLPP-DITLVKASRLLN 239


>gi|260857988|ref|YP_003231879.1| putative polysaccharide deacetylase [Escherichia coli O26:H11 str.
           11368]
 gi|257756637|dbj|BAI28139.1| predicted polysaccharide deacetylase [Escherichia coli O26:H11 str.
           11368]
 gi|323155268|gb|EFZ41451.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli EPECa14]
          Length = 319

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMRALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|193066089|ref|ZP_03047145.1| polysaccharide deacetylase family protein [Escherichia coli E22]
 gi|260846618|ref|YP_003224396.1| putative polysaccharide deacetylase [Escherichia coli O103:H2 str.
           12009]
 gi|192926251|gb|EDV80889.1| polysaccharide deacetylase family protein [Escherichia coli E22]
 gi|257761765|dbj|BAI33262.1| predicted polysaccharide deacetylase [Escherichia coli O103:H2 str.
           12009]
 gi|323182645|gb|EFZ68048.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1357]
          Length = 319

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 88/228 (38%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S     ++AIV+   G       + +  +P+ I++A   +         +A   G E
Sbjct: 16  ALSSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|323975163|gb|EGB70268.1| divergent polysaccharide deacetylase [Escherichia coli TW10509]
          Length = 319

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 89/226 (39%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +  A+  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|194427407|ref|ZP_03059956.1| polysaccharide deacetylase family protein [Escherichia coli B171]
 gi|194414447|gb|EDX30720.1| polysaccharide deacetylase family protein [Escherichia coli B171]
 gi|323160707|gb|EFZ46644.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli E128010]
          Length = 319

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 88/228 (38%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S     ++AIV+   G       + +  +P+ I++A   +         +A   G E
Sbjct: 16  ALSSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +   +  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|256025655|ref|ZP_05439520.1| predicted polysaccharide deacetylase [Escherichia sp. 4_1_40B]
          Length = 319

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|294143080|ref|YP_003559058.1| hypothetical protein SVI_4309 [Shewanella violacea DSS12]
 gi|293329549|dbj|BAJ04280.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 256

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S  + A++AI++  +G     +  A+  LP NITL+   +          A ++G E 
Sbjct: 13  ASSYVNAAQVAIIIDDIGYR--HSDEAVLSLPDNITLSVLPHTPLGRSVAHTAHQRGYEV 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +         T     +   +   ++          GV N+ G++L    E
Sbjct: 71  MLHLPMQALNGKKLGPGGIT--NDMSEIDVKRIIQQDFESIPFAKGVNNHMGSLLTQLDE 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   ++ + F D  ++  +     A KL +P +   ++LD+ +    + ++ + 
Sbjct: 129 PMRWVMESLKQKQVYFVDSMTTRFSKAGSTAEKLGIPQLKRQIFLDNDLSPAALNQQFER 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           L  +A   GQ + +A  + E+IE +   L +     VS+V  S L 
Sbjct: 189 LIALAHRQGQVVAIAHPYPETIEYLKLNLPRLQQAGVSLVKTSDLL 234


>gi|332345585|gb|AEE58919.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 319

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPATVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|324111944|gb|EGC05924.1| divergent polysaccharide deacetylase [Escherichia fergusonii B253]
          Length = 318

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|254429372|ref|ZP_05043079.1| Divergent polysaccharide deacetylase superfamily [Alcanivorax sp.
           DG881]
 gi|196195541|gb|EDX90500.1| Divergent polysaccharide deacetylase superfamily [Alcanivorax sp.
           DG881]
          Length = 258

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 62/225 (27%), Positives = 107/225 (47%), Gaps = 5/225 (2%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            RIAI++  LG S+   Q AI  LPA +T A         R  + A   G+E ++ +PM 
Sbjct: 25  PRIAIIIDDLGYSRQHGQ-AIVDLPAPVTCAVIPFSPHARRLAERASLAGKEVLVHMPMA 83

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A      +     L+      QLL+ +R +L +     G+ N+ G+ L   ++    +  
Sbjct: 84  AQRHQTLDQGG--LRDGMDEPQLLDAVRQALSQIPQARGLNNHMGSALTEQQQPMGWLMT 141

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E     L F D  +S  ++ + +A ++ L +   D++LD++ +   I E+   L  +AR 
Sbjct: 142 ELKAHQLFFVDSRTSSHSVAQQMARQVGLSHAGRDVFLDNERNLVSINEQFNRLIRLARQ 201

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            GQAI +   + E++  + Q L       + VVP+S L  LS+P+
Sbjct: 202 RGQAIAIGHPYPETVHYLQQVLPLMQDAGIEVVPVSTL--LSTPA 244


>gi|301028373|ref|ZP_07191620.1| divergent polysaccharide deacetylase [Escherichia coli MS 196-1]
 gi|299878575|gb|EFI86786.1| divergent polysaccharide deacetylase [Escherichia coli MS 196-1]
          Length = 319

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKGIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|238921665|ref|YP_002935180.1| hypothetical protein NT01EI_3821 [Edwardsiella ictaluri 93-146]
 gi|238871234|gb|ACR70945.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 312

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 94/229 (41%), Gaps = 5/229 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   ++AIV+   G  +   +  +  +P  +T+A   N        + A  +G+E
Sbjct: 16  ALTAPAQAGKLAIVIDDFGY-RPREENKVLEMPLPVTIAVLPNAPHAREMAQRAHAQGRE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+ T +  ++   +R ++       G+ N+ G+ + S+ 
Sbjct: 75  ILIHLPMAPLSKQPLERD--TLQPTMSEAEIQRIIRQAVGNVPYAVGMNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
              + + +   +   L F D  +   +     A    +  +   ++LDD      IR +L
Sbjct: 133 TGMQKVMRALEQYHFLYFLDSMTISHSQVSNAAQGTGIRVIKRKVFLDDTQSESAIRTQL 192

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
                +AR  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 193 NRAITLARRNGSAIAIGHPHPATVRVLQQMLHTLPP-DITLVRPSTLLN 240


>gi|110835138|ref|YP_693997.1| hypothetical protein ABO_2277 [Alcanivorax borkumensis SK2]
 gi|110648249|emb|CAL17725.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 259

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 61/233 (26%), Positives = 105/233 (45%), Gaps = 5/233 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +  S  +  RIAI++  LG S+   Q AI  LPA +  A         R  + A   G+E
Sbjct: 18  SSVSGLAAPRIAIIIDDLGYSRQQGQ-AIIDLPAPVACAVIPFSPHGRRLAERASLAGKE 76

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM        +     L+      QLL  +R +L +     G+ N+ G+ L    
Sbjct: 77  VLVHMPMATQGHQKLDRGG--LQNGMDEPQLLEAVRQALGQIPQARGLNNHMGSALTEQP 134

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           ++   +  E     L F D  +S   + + +A ++ LP    D++LD+  +   I ++  
Sbjct: 135 QTMGWLMAELKAHQLFFVDSRTSSHTVAQQVAQQVGLPNARRDVFLDNNRNPVSINQQFN 194

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            L  +AR  GQAI +   + E++  + Q L       + VVP+S L  LS+P+
Sbjct: 195 RLIRLARQHGQAIAIGHPYPETVHYLQQVLPLMEEAGIDVVPVSSL--LSTPA 245


>gi|119475541|ref|ZP_01615894.1| hypothetical protein GP2143_17016 [marine gamma proteobacterium
           HTCC2143]
 gi|119451744|gb|EAW32977.1| hypothetical protein GP2143_17016 [marine gamma proteobacterium
           HTCC2143]
          Length = 282

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 55/224 (24%), Positives = 97/224 (43%), Gaps = 3/224 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F    + A I ++V  +G S    QRAIN LP  I  AF             A ++ +E 
Sbjct: 31  FGQEKTVANIVLIVDDMGNSLELGQRAIN-LPGAINYAFLPYSPHRVSLANIAFRQRKEV 89

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L  PM              L    + QQ L  L  +L       GV N+ G+++   ++
Sbjct: 90  MLHAPMSNLHSHPVGQGG--LTPNMSQQQFLQTLNTNLNSVPHVRGVNNHMGSLMTQLRQ 147

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               +     ++ L F D  ++P  + +  A KL +P +  D++LD++   D I  + + 
Sbjct: 148 PMGWLMAALKQQNLYFVDSRTTPLTVAKSTATKLGVPSLRRDIFLDNERQHDAIAMQFER 207

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           L  +A+ TG A+G+     E+++ + + L     R + +V  S 
Sbjct: 208 LIALAKKTGIAVGIGHPHPETLKYLEKTLPTLEQRGIKLVLASQ 251


>gi|281180660|dbj|BAI56990.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 319

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQLVYNLPP-DITLVKASSLLN 239


>gi|227328077|ref|ZP_03832101.1| hypothetical protein PcarcW_12385 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 315

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 46/223 (20%), Positives = 98/223 (43%), Gaps = 4/223 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM 
Sbjct: 24  GKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMA 82

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
              +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + + +
Sbjct: 83  PMSKQPLERD--TLRPDMSSDEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQKVMQ 140

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
             +   L F D  +   + +   A   N+  +   ++LDD  +  +IR++     +IAR 
Sbjct: 141 ALSAYQLYFLDSMTIGSSQSSQAAAGTNVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARR 200

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +G AI +      +I V+ Q L      D+ +V  S L    +
Sbjct: 201 SGSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPT 242


>gi|37528651|ref|NP_931996.1| hypothetical protein plu4842 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36788090|emb|CAE17214.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 271

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 47/221 (21%), Positives = 94/221 (42%), Gaps = 4/221 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
             AR+AIV+   G       + I  +P  I++A   +        ++A K+G+E ++ +P
Sbjct: 28  GAARLAIVIDDFGYRPHNENK-ILQMPVAISIAILPDSPHGREMAEKAYKQGREILIHLP 86

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M    +   E D  TL+ T + + +   ++ ++++     G+ N+ G+ + S+    + +
Sbjct: 87  MAPLSKQLLEPD--TLQPTMSSEDIDRIIQRAIQKVPYAVGINNHMGSAMTSSLPGMQKV 144

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +  +   L F D  +         A    +  +  +++LDD     + R +L     IA
Sbjct: 145 MRSLSGYNLYFLDSVTIGNTQATKAAQGTPVRVIRRNVFLDDVQSEAETRHQLNRAISIA 204

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           R  G AI +      +I  + Q L      D+ +V  S L 
Sbjct: 205 RKNGSAIAIGHPHSTTIRALQQMLPTLPA-DIELVSPSRLL 244


>gi|304398998|ref|ZP_07380867.1| protein of unknown function DUF610 YibQ [Pantoea sp. aB]
 gi|304353458|gb|EFM17836.1| protein of unknown function DUF610 YibQ [Pantoea sp. aB]
          Length = 300

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 49/241 (20%), Positives = 99/241 (41%), Gaps = 4/241 (1%)

Query: 152 REDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
           R    V      FCS A   +++IV+  +G       + +  +P  I++A   N      
Sbjct: 4   RRKLPVLMSALLFCSAAQAGKLSIVIDDVGYRPAEENKVLQ-MPQAISVAVLPNAPHARE 62

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
              +A + G E ++ +PM    +   E D  TL    + +++   +R ++       G+ 
Sbjct: 63  MAIKAHQGGHEVLIHLPMAPLSKQPLEKD--TLTPEMSSEEVARIMRNAVNNVPYAVGLN 120

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+ + S+    + + +      L F D  +   +     A    +  +   ++LDD 
Sbjct: 121 NHMGSRMTSSLPGMQKVMQALNHYNLYFLDSMTIANSQAIPAAQGTQVKVLKRRVFLDDS 180

Query: 332 VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            D + IR++     ++A+  G AI +      ++ V+ Q L      D+++V  S L   
Sbjct: 181 QDINAIRQQFSRAVKLAQRDGYAIAIGHPHPNTVRVLQQMLPTLPA-DITLVRPSELLNE 239

Query: 392 S 392
           S
Sbjct: 240 S 240


>gi|308188636|ref|YP_003932767.1| hypothetical protein Pvag_3176 [Pantoea vagans C9-1]
 gi|308059146|gb|ADO11318.1| Uncharacterized protein yibQ precursor [Pantoea vagans C9-1]
          Length = 300

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 95/229 (41%), Gaps = 4/229 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++AIV+  +G       + +  +P  I++A   N         +A + G E 
Sbjct: 16  FSYAAQAGKLAIVIDDVGYRPAEENKVLQ-MPQAISVAVLPNAPHAHEMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL    + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLEKD--TLTPEMSSEEVTRIMRNAVNNVPYAVGLNNHMGSRMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  D + IR++   
Sbjct: 133 GMQKVMQALNHYNLYFLDSMTIANSQAIPAAQGTQVKVLKRRVFLDDSQDINAIRQQFSR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             ++A+  G AI +      ++ V+ Q L      D+++V  S L   S
Sbjct: 193 AVKLAQRDGYAIAIGHPHPTTVRVLQQMLPTLPA-DITLVRPSQLLNES 240


>gi|77359329|ref|YP_338904.1| hypothetical protein PSHAa0363 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874240|emb|CAI85461.1| conserved protein of unknown function ; putative signal peptide
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 246

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 53/229 (23%), Positives = 99/229 (43%), Gaps = 4/229 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
              NA   +IAIV+  +G  Q   +  +  LP  ++ +   +      +   A K  +E 
Sbjct: 14  ASLNAKAKQIAIVIDDIGYHQRDLE--LLTLPGQVSYSILPHTPYAQAFATLASKTNKEL 71

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L IPMQA +    E     L +    +Q+   L  +L       GV N+ G+ L    +
Sbjct: 72  LLHIPMQALNGK--ELGPGALTLNMNKEQIQQILGTALASLPQVKGVNNHMGSALTQQSQ 129

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   I +   KR L F D  ++  +  +  A  L +  +   ++LD+    ++++ +L  
Sbjct: 130 AMRWIMEVLKKRHLYFLDSRTTELSQAQNAANFLGVENIGRHIFLDNITTPEQLQLRLDE 189

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           L++ A     AI +A  + E+I  +   L Q   +   +VP+S L +  
Sbjct: 190 LKQHATEHKFAIAIAHPYPETIAFLRHVLPQLSKQGFELVPVSKLVERK 238


>gi|332997808|gb|EGK17419.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-272]
 gi|333013340|gb|EGK32712.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-227]
          Length = 319

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARHNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|91795046|ref|YP_564697.1| protein of unknown function DUF610, YibQ [Shewanella denitrificans
           OS217]
 gi|91717048|gb|ABE56974.1| protein of unknown function DUF610, YibQ [Shewanella denitrificans
           OS217]
          Length = 245

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 95/226 (42%), Gaps = 4/226 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F     GA++AI++  +G  Q  T  A+  LP  ITL+   +     +  ++  KKG E 
Sbjct: 2   FIQPVFGAKLAIIIDDIGYRQ--TDEAVLSLPNTITLSVLPHTPLGQKLAQDGHKKGHEI 59

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +    E     L    T  Q+  +L  ++       G  N+ G++L   ++
Sbjct: 60  MLHLPMQALNGK--ELGPGGLTNVMTEGQIKQQLHSAVSSIPFAKGANNHMGSLLTQMQD 117

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  L F D  ++        A  L +P +   ++LD+ +    ++ +   
Sbjct: 118 PMRWVMESLKQNNLYFVDSMTTRFTKATASAQSLGVPTLKRQIFLDNDISEAALQRQFNL 177

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           +   A+   Q I +A    E+I  +   L +     + +V  S L 
Sbjct: 178 IMVKAKQEQQVIAIAHPHPETIRFLKANLARLEQAGIELVHTSHLL 223


>gi|218550892|ref|YP_002384683.1| polysaccharide deacetylase [Escherichia fergusonii ATCC 35469]
 gi|218358433|emb|CAQ91080.1| putative polysaccharide deacetylase [Escherichia fergusonii ATCC
           35469]
 gi|325499163|gb|EGC97022.1| polysaccharide deacetylase [Escherichia fergusonii ECD227]
          Length = 318

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 40/221 (18%), Positives = 87/221 (39%), Gaps = 4/221 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++AIV+   G       + +  +P+ I++A   +         +A   G E ++ +PM
Sbjct: 23  AGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN    + + 
Sbjct: 82  APLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   +  L F D  +         A    +  +   ++LDD  +   IR +     ++AR
Sbjct: 140 QALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 200 RNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|89094931|ref|ZP_01167862.1| hypothetical protein MED92_00710 [Oceanospirillum sp. MED92]
 gi|89080797|gb|EAR60038.1| hypothetical protein MED92_00710 [Oceanospirillum sp. MED92]
          Length = 277

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 55/228 (24%), Positives = 103/228 (45%), Gaps = 3/228 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           +    +AIV+  +G ++     AI  LP  IT AF  +        K A   G+E IL  
Sbjct: 25  SHQPVMAIVIDDIGDNRKKGLAAIE-LPGAITYAFLPHTPHSFELAKTAHFLGKEVILHA 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+  +++        L       +L + L   L       G+ N+ G++L  ++E    
Sbjct: 84  PME--NKAGLRLGPGALTHRHNTAELQHILGDGLDSIPYAVGMNNHMGSLLTEDREKMRD 141

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           I +   +R + F D  ++ + +   +A +  +PY+V D++LD++ +   I  + K    +
Sbjct: 142 IMRVVKQRNMFFLDSMTTSKTVAWKVAHEYGIPYLVRDVFLDNRQEWGYIHNQFKQAVSL 201

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           A T G A+ +   + E++E +S+ L       + +V  S L  + S S
Sbjct: 202 AVTQGHAVVIGHPYPETVEYLSEALPILEQLGIRLVTASELLAIRSRS 249


>gi|56459342|ref|YP_154623.1| hypothetical protein IL0231 [Idiomarina loihiensis L2TR]
 gi|56178352|gb|AAV81074.1| Conserved protein [Idiomarina loihiensis L2TR]
          Length = 251

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 51/228 (22%), Positives = 106/228 (46%), Gaps = 4/228 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A  ++IAIV+  +G ++   + A+  LP NI+ A          +      + ++ +L
Sbjct: 16  TPAYASKIAIVIDDIGNNKNDLKAAL--LPGNISFAVLPYTPYARAFALRGHHQKKQILL 73

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+A +   N      +       Q+  +L  +L       GV N+ G+ L       
Sbjct: 74  HMPMEAVEN--NRPGPGVVTADMNNAQIKLQLVDALDSIPYVTGVNNHMGSKLTQLHMPM 131

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + +  A R L F D  +S  ++   +A +  +      ++LD+QVD   ++++ + L 
Sbjct: 132 QAVMETLASRKLFFIDSRTSEFSVAEQMAGEFGVRTSHRHVFLDNQVDEPYLQQQFEQLL 191

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            IA+  GQAIG+   + E++  + + L Q   + + +V +S L  +++
Sbjct: 192 SIAKRQGQAIGIGHPYPETLSFLQKQLPQLQEQGIELVFVSELTTVAN 239


>gi|304392603|ref|ZP_07374543.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303295233|gb|EFL89593.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 408

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 124/407 (30%), Positives = 190/407 (46%), Gaps = 17/407 (4%)

Query: 3   IDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGT----ISEMI 58
            DL+ P+    PK KS     +      ++    +VG   ++ +     G+    ++E  
Sbjct: 2   SDLHKPIGVD-PKSKSGGIGAVPVSIWLMVAALILVGSFTWLYLEGRDDGSQVVAVNEAG 60

Query: 59  PYSVIREIAPIPL-TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ----NDISGK 113
             S     AP    + P +      P +   +   N + + S            ++  G 
Sbjct: 61  QTSQTTAPAPATDQSTPSDNGGDDVPVEPKFDADGNIIIDLSKTKRLSPLEPLPDEPDGT 120

Query: 114 TVVNKPTRSTSIDSLPTIEE-RLILGLSKKELLAKNKVGR-----EDTEVPAMDKNFCSN 167
           +   KP  +      P I+  R    +   + L  ++ GR      D   P    +  S 
Sbjct: 121 STPAKPQIAFQPRQNPAIQSARRNPWMPVPDNLEPSEFGRLPKVSGDGTRPLDIHSASSG 180

Query: 168 ASGA-RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           A GA RIA+V+ GLG+SQTGTQ AI  LP  ITLAF+  GNSL RWM+ A+++G E  LQ
Sbjct: 181 AVGANRIALVLGGLGLSQTGTQEAIKRLPEGITLAFSPQGNSLQRWMQAARREGHEVALQ 240

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+            TL    +    L  LR+SL R T Y  V+NY GA +LSN+ + E
Sbjct: 241 LPMEPLGYPTVNPGPQTLNSKVSKGANLKSLRWSLGRMTNYPVVINYLGAGMLSNRPALE 300

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            I +E   RGL   DDG+   +     A ++ LP   A + +D   D D+IR +L+ LE 
Sbjct: 301 PILQELRARGLGIVDDGTVQSSNLVTYANEMRLPNAKASIIIDRVRDADRIRAQLQTLEA 360

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +AR  G  I  A AF +++E++ +W +  + R + +VPLS L +  S
Sbjct: 361 VARQQGNVIATATAFPQTVEIVEEWAKTLNQRGILLVPLSNLVRDYS 407


>gi|163792328|ref|ZP_02186305.1| hypothetical protein BAL199_15813 [alpha proteobacterium BAL199]
 gi|159182033|gb|EDP66542.1| hypothetical protein BAL199_15813 [alpha proteobacterium BAL199]
          Length = 418

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 89/389 (22%), Positives = 167/389 (42%), Gaps = 9/389 (2%)

Query: 8   PLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIA 67
           PL     KR +  S    R+G  L+     V     I  + A VG +      +  R++ 
Sbjct: 26  PLDDAPAKRPAAASDG--RIGRLLIGIATGVLAVAVIGGTGALVGWLLVNAETTESRQVL 83

Query: 68  PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDS 127
             P      + + ++P+   ++          ++ DG   +  +        T + +   
Sbjct: 84  RRPQLTVPVLAEGETPTANSSDGGQPVTAGPHTEKDGHAGSAATNSPAPTGDTAAPAPVP 143

Query: 128 LPTIEERLILGLSKKELLA-----KNKVGREDTEVP--AMDKNFCSNASGARIAIVVSGL 180
                + + L      LL      K  +   D   P     + F  + S  R+AIV+ G+
Sbjct: 144 EVVSVDGVRLAAVDPTLLETKDSAKLPIIGPDGRQPWSTYARPFNLDDSRPRVAIVMIGV 203

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           G  +  T++A  LLP  I+L+F+    +++  M  A++ G E ++ +PM+  D   ++  
Sbjct: 204 GFGKDITEKATTLLPGAISLSFSPYVRNIEALMARARQAGHETLIDLPMEPLDFPRDDPG 263

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  + ++   LNRL + L R  GY GV  + G+   + +++   + +   +RGL+F 
Sbjct: 264 PSTLLTSLSLVDNLNRLEWVLGRAPGYVGVTTWMGSQFTTVEDALMPVLQGLRQRGLMFV 323

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           D  +S R++   LA  + LP    + ++D       I   L  LE  AR    A+G+A  
Sbjct: 324 DSRASSRSIATELASSIQLPRAFNNTFIDQTPSAGTIDRALASLEATARQQRYAVGIARP 383

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              +IE +S+W      + +++ P+S +A
Sbjct: 384 LPVTIERLSRWAGTLEGKGIALAPISAIA 412


>gi|170767013|ref|ZP_02901466.1| polysaccharide deacetylase family protein [Escherichia albertii
           TW07627]
 gi|170124451|gb|EDS93382.1| polysaccharide deacetylase family protein [Escherichia albertii
           TW07627]
          Length = 319

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              +     ++AIV+   G       + +  +P+ I++A   +         +A   G E
Sbjct: 16  ALSTPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN 
Sbjct: 75  VLIHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +  A+  L F D  +         A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR  G  I +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|311277460|ref|YP_003939691.1| hypothetical protein Entcl_0129 [Enterobacter cloacae SCF1]
 gi|308746655|gb|ADO46407.1| protein of unknown function DUF610 YibQ [Enterobacter cloacae SCF1]
          Length = 313

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 97/228 (42%), Gaps = 4/228 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   ++AIV+  +G       + +  LP NI++A   N         +A   G+E
Sbjct: 16  AVSAPAWAGKLAIVIDDVGYRPQQENQVLA-LPVNISVAVLPNAPHAREMATKAHNGGRE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E D  TL+   +  ++   +R ++ +     G+ N+ G+ + SN 
Sbjct: 75  VLIHMPMAPLSKQPLEKD--TLRPDMSSDEIERIIRDAVSKVPYAVGMNNHMGSAMTSNL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +  ++  L F D  +   +     A    +  +   ++LDD  +   IR +  
Sbjct: 133 FGMQKVMQALSRYNLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDDTQNEADIRFQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              ++AR TG AI +      ++ V+ Q +      D+++V  S L  
Sbjct: 193 RAIQLARRTGSAIAIGHPHPSTVRVLQQMVYNLPP-DITLVRPSSLLN 239


>gi|77919271|ref|YP_357086.1| hypothetical protein Pcar_1672 [Pelobacter carbinolicus DSM 2380]
 gi|77545354|gb|ABA88916.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 395

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 71/402 (17%), Positives = 155/402 (38%), Gaps = 18/402 (4%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M+       RK+ P++K         L    L    +V L +   +    +   +  +  
Sbjct: 1   MATKKKTVRRKRQPRKKQPDRTFKVLLASLFLVGFLVVSLVLLTFVQRPPLPNRTPEVSP 60

Query: 61  SVIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT 114
            V ++      T        + IE +++  ++  +     +  D       + +   G+ 
Sbjct: 61  PVAKQPPDSADTRDQVLRTSVQIEIERALWRQGISFTGMDVVTDDHVMHYHLPSVYPGQA 120

Query: 115 -----VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                V     +S+ +          ++ +S   + +     +     PA  +       
Sbjct: 121 WYDGLVRALEKQSSRLKFAFADAPAPLVRVSVNGIPSFALHFKRSRSKPAKVRP------ 174

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            ARIAIVV  L        R +  +  ++T+A         +  + A + G+E ++ +PM
Sbjct: 175 KARIAIVVDDL-GRDLRMLRRLLAIDLDLTMAVMPEEPHTLQSAELAHRAGREVLVHMPM 233

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +      N      L + Q   ++  R+           G  N+ G+      E  +++F
Sbjct: 234 EPESYPRNNPGPGALLLGQDRLEIERRVTRMFENVPHAVGGNNHMGSRFTQYAEGLQIVF 293

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   K GL F D  +SP ++  + A +  +P +  D++LD+  + D I  +++   ++AR
Sbjct: 294 EVMKKNGLFFVDSRTSPGSVAFLEARRARIPAVSRDIFLDNSQNVDAIARQIREAVKMAR 353

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           + G+ + +   + +++E + Q       +DV VVP+S L + 
Sbjct: 354 SRGKVVAICHPYPQTVEALQQEAAFLRQQDVEVVPVSRLLRH 395


>gi|253690446|ref|YP_003019636.1| hypothetical protein PC1_4085 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251757024|gb|ACT15100.1| protein of unknown function DUF610 YibQ [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 315

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 45/222 (20%), Positives = 97/222 (43%), Gaps = 4/222 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLERD--TLRPDMSSDEIQRIIRQSVNNVPHAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           G AI +      +I V+ Q L      D+ +V  S L    +
Sbjct: 202 GSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPT 242


>gi|288959172|ref|YP_003449513.1| hypothetical protein AZL_023310 [Azospirillum sp. B510]
 gi|288911480|dbj|BAI72969.1| hypothetical protein AZL_023310 [Azospirillum sp. B510]
          Length = 391

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 88/375 (23%), Positives = 149/375 (39%), Gaps = 22/375 (5%)

Query: 18  SFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNI 77
                    L    L      GL  ++ ++             S    IAP+P       
Sbjct: 38  PRKPPSKPLLAAVALVAAIYAGLGGWLALNGDATREAWRASIPSTTVAIAPLPPPPAPEP 97

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLIL 137
           +           T    L    +                     + ++  +P     L+ 
Sbjct: 98  KAAAPAVPPPLPTDAAPLPLPGA--------------------PAAAVTLVPAPVPGLVE 137

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPAN 197
                 L    + GR+  +V A  + F +     R+AIV+S LG+S   T  A+  LP  
Sbjct: 138 DSRNGPLPRIAQDGRKPWQVYA--RPFPATDKRPRVAIVMSDLGLSGVTTGNALAKLPPG 195

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           ITLAF      LD W++ A+ KG E +L +PM+      ++     L       + + RL
Sbjct: 196 ITLAFLPYAERLDDWVERARTKGHEVMLSLPMEPLTYPRDDPGPNALLTMLGPDRNIERL 255

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
            +SL +  GY GV +  G    +N  + + +      RGLL  D   +P+++   LA   
Sbjct: 256 EWSLGKAVGYVGVTSTTGGKFTANPTAMQPVIDALKARGLLLVDSRVNPKSVAGPLAMLA 315

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
            +P  + D  +D  + R  I ++L+ LEE+ART G A+G A  +  +IE ++ WL     
Sbjct: 316 GVPRALGDRVIDRDLSRGAIDDQLRELEELARTNGAAVGFASPYPTTIERLNLWLTALAD 375

Query: 378 RDVSVVPLSCLAKLS 392
           R +++ P+S +  + 
Sbjct: 376 RGIALAPVSAVVNIQ 390


>gi|227114297|ref|ZP_03827953.1| hypothetical protein PcarbP_15088 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 315

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 100/226 (44%), Gaps = 4/226 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM 
Sbjct: 24  GKLSIVIDDFGY-RPHNENQILAMPTAISIAVLPNAPYAREMATKAHQQGREVLIHLPMA 82

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
              +   E D  TL+   + +++   +R S+       G+ N+ G+ + ++    + + +
Sbjct: 83  PMSKQPLERD--TLRPDMSSEEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQKVMQ 140

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
             +   L F D  +   + +   A   N+  +   ++LDD  +  +IR++     +IAR 
Sbjct: 141 ALSAYQLYFLDSMTIGSSQSSQAAAGTNVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARR 200

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +G AI +      +I V+ Q L      D+ +V  S L    +  S
Sbjct: 201 SGSAIAIGHPHPSTIRVLQQMLPTLDT-DIVLVRPSQLLNEPTRQS 245


>gi|217971260|ref|YP_002356011.1| hypothetical protein Sbal223_0044 [Shewanella baltica OS223]
 gi|217496395|gb|ACK44588.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS223]
          Length = 251

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 95/226 (42%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    E  
Sbjct: 73  HLPMQALNGKALGLGG--LTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDEPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+      +  +   + 
Sbjct: 131 LWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDTSTKALERQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A T G  + +A  + E++  +   LQ+     + +VP S L  +
Sbjct: 191 SQAHTQGSLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPI 236


>gi|315618682|gb|EFU99268.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 3431]
          Length = 319

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 87/226 (38%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G       + +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGYRPHNENQVLA-MPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLEK--NTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++AR     I +      ++ V+ Q +      D+++V  S L  
Sbjct: 195 IDLARRNSSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLN 239


>gi|258406280|ref|YP_003199022.1| hypothetical protein Dret_2160 [Desulfohalobium retbaense DSM 5692]
 gi|257798507|gb|ACV69444.1| protein of unknown function DUF610 YibQ [Desulfohalobium retbaense
           DSM 5692]
          Length = 403

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 60/230 (26%), Positives = 106/230 (46%), Gaps = 2/230 (0%)

Query: 160 MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
            DK   +  S AR+AIV+  LG      +R I      +T A   +          A + 
Sbjct: 172 QDKAEQNTKSQARLAIVIDDLGEDVRKARRLIQTG-LPLTFAVLPSCTHTRDIASLAHEH 230

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
             E +L  PM+       +  +  L V     Q+   L+ +L +     G+ N+ G+   
Sbjct: 231 NLELLLHQPMEPLSYPATDPGTGALFVGMNASQIRKTLKDNLAQIQHAVGLNNHMGSRFT 290

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           S+       F+  A R L F D  +SP ++ R  A + ++PY+  +++LD+  +R+ I  
Sbjct: 291 SSSAGMRTTFRNIANRQLFFLDSLTSPDSVARETAKRTHVPYLRRNIFLDNTQNREAILY 350

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           +L+  E +A + G AI +   ++ ++E I++W  Q   R V ++PLS L 
Sbjct: 351 QLQKAERLALSRGSAIAIGHPYEATLEAIAKWKTQRDPR-VRLIPLSTLL 399


>gi|50119129|ref|YP_048296.1| hypothetical protein ECA0169 [Pectobacterium atrosepticum SCRI1043]
 gi|49609655|emb|CAG73088.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 315

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 98/228 (42%), Gaps = 4/228 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +
Sbjct: 21  ALAGKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + 
Sbjct: 80  PMAPMSKQPLERD--TLRPDMSSDEIQLIIRQSVSNVPYAVGLNNHMGSAMTASLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +I
Sbjct: 138 VMQALSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQI 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           AR +G AI +      +I V+ Q L      D+ +V  S L    +  
Sbjct: 198 ARRSGSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPTQH 244


>gi|330720619|gb|EGG98878.1| putative divergent polysaccharide deacetylase [gamma
           proteobacterium IMCC2047]
          Length = 305

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 97/230 (42%), Gaps = 3/230 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + +S  +I I++  LG +    QRAI  LP  +T +         +  K+A ++ +E 
Sbjct: 20  IQAASSSPQITIIIDDLGNNLRNGQRAIA-LPGAVTYSVLPFTPFGKQLAKQAHQQDKEV 78

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PM              L   Q       +L  ++       G+ N+ G+ L ++ E
Sbjct: 79  MLHMPMDNSHGHPL--GPGGLTFKQDRPLFEQQLAAAITATPFVSGINNHMGSGLTTSSE 136

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +S  ++    A  L +P +  D++LD +     I ++ K 
Sbjct: 137 RMQWLMQSLKNYPLYFVDSRTSANSVAGRTALALKIPTLKRDIFLDHETTPAFIDKQFKR 196

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           L + A + G A+ +   +  +++ + + L Q     V +VP S L  L  
Sbjct: 197 LLKKAHSKGHAVAIGHPYPSTLDYLEKALPQLDKLGVELVPPSQLLALKR 246


>gi|218782460|ref|YP_002433778.1| hypothetical protein Dalk_4632 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763844|gb|ACL06310.1| protein of unknown function DUF610 YibQ [Desulfatibacillum
           alkenivorans AK-01]
          Length = 359

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 56/222 (25%), Positives = 98/222 (44%), Gaps = 2/222 (0%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             R+AI++  +G    G Q     LP  IT +   +          A  KG++ +L +PM
Sbjct: 138 RPRVAIIIDDMGYGN-GIQHKFLDLPYVITYSILPHSPDQIEIANLAHDKGRQVLLHLPM 196

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +       +    TL  + T   +++ L+  L       GV N+ G+ L     +   IF
Sbjct: 197 EPMQYPEVDPGPGTLLASMTTDTMMDILKEDLAAVPYIAGVNNHMGSRLTMESGALYPIF 256

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
               K+GL F D  ++  ++ R  A    LP+   D++LD       + ++LK L  +A+
Sbjct: 257 TVLKKQGLFFVDSRTTRHSVCRPSARLFQLPFAQRDVFLDHVRTEAFVEKQLKLLVSVAK 316

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             GQAIG+   +  + +V++  L       V +VP S L ++
Sbjct: 317 KRGQAIGIGHPYKVTYKVLAARLPAVDAE-VRLVPASDLVRV 357


>gi|170729198|ref|YP_001763224.1| hypothetical protein Swoo_4880 [Shewanella woodyi ATCC 51908]
 gi|169814545|gb|ACA89129.1| protein of unknown function DUF610 YibQ [Shewanella woodyi ATCC
           51908]
          Length = 251

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 102/233 (43%), Gaps = 6/233 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S    A++AI++  +G  Q+    A+  LP NITL+   +          A ++G E 
Sbjct: 12  ISSFTHAAQVAIIIDDIGYRQS--DEAVLTLPENITLSVLPHTPLGHSVASAAHERGHEI 69

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQA +         T  + ++  +L   ++ +        G  N+ G++L   +E
Sbjct: 70  MVHLPMQALNGKALGPGGLTNTMGES--ELKKSIQSAFLSVPFAKGANNHMGSLLTQLEE 127

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   ++ L F D  ++        A +L +P +  +L+LD+ +    +  +   
Sbjct: 128 PMLWVMESLKQQDLYFVDSMTTRFTKAGTTADQLGIPQLKRELFLDNDISAAALDRQFSK 187

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA--KLSSP 394
           L  +A   GQ + +A  + E+IE +   L +     + +V  S L   +L+S 
Sbjct: 188 LITLAHNQGQIVAIAHPYPETIEFLKLNLPRLQKAGIKLVKTSELLPYRLASK 240


>gi|304412443|ref|ZP_07394050.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS183]
 gi|307305787|ref|ZP_07585533.1| protein of unknown function DUF610 YibQ [Shewanella baltica BA175]
 gi|304349278|gb|EFM13689.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS183]
 gi|306911280|gb|EFN41706.1| protein of unknown function DUF610 YibQ [Shewanella baltica BA175]
          Length = 251

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 96/226 (42%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGLGG--LTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  +   + 
Sbjct: 131 LWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALERQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A T G  + +A  + E++  +   LQ+     + +VP S L  +
Sbjct: 191 SQAHTQGSLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPI 236


>gi|113968388|ref|YP_732181.1| hypothetical protein Shewmr4_0042 [Shewanella sp. MR-4]
 gi|113883072|gb|ABI37124.1| protein of unknown function DUF610, YibQ [Shewanella sp. MR-4]
          Length = 251

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 100/226 (44%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           ++++ A+IA+++  +G     T  A+  LP+ +TL+   +    ++  K A  KG E +L
Sbjct: 15  ASSNAAQIALIIDDIGYR--HTDEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L    +  Q+ + +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGVGG--LTNNMSEAQIRSSVLAAIASVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A  L++P +   L+LD+ V    + ++   + 
Sbjct: 131 LWVMETLKQKQLYFVDSMTTKFTKAGDKADSLSVPLLRRQLFLDNDVSAAALEKQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A + G  + +A  + E+I  +   L +     + +VP S L  +
Sbjct: 191 SQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSLLPI 236


>gi|95928784|ref|ZP_01311530.1| protein of unknown function DUF610, YibQ [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135129|gb|EAT16782.1| protein of unknown function DUF610, YibQ [Desulfuromonas
           acetoxidans DSM 684]
          Length = 328

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 56/243 (23%), Positives = 99/243 (40%), Gaps = 4/243 (1%)

Query: 154 DTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
           D   P             ++AI++  +GI++     A+  L   + LA           M
Sbjct: 79  DKPQPPQITP---PDHVPKVAIIMDDIGINRAAALDALQ-LQMPLALAIIPGEAHSTEIM 134

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
             A ++  E ++ IPM+      N      L V Q+  Q+  R+   +       G  N+
Sbjct: 135 NLAYQQHSEILIHIPMEPVSYPKNNPGPLGLFVHQSDSQIKRRIDDIITALPYAIGGNNH 194

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+    + +    +     + GL F D  +S  ++    A KL L   + D++LD+   
Sbjct: 195 MGSEFTQHADKLRPVLLALKQSGLFFVDSLTSKDSVAYQQAQKLGLSCALRDVFLDNVRQ 254

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            + I  +L  L  +A   G AI +   + ++IE + Q++      DV +VP+S L     
Sbjct: 255 VEPILFQLDRLVTLAHRHGSAIAICHPYPQTIEALQQFIADPQRFDVEIVPISQLVHPPV 314

Query: 394 PSS 396
           PSS
Sbjct: 315 PSS 317


>gi|114045553|ref|YP_736103.1| hypothetical protein Shewmr7_0040 [Shewanella sp. MR-7]
 gi|113886995|gb|ABI41046.1| protein of unknown function DUF610, YibQ [Shewanella sp. MR-7]
          Length = 251

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 98/226 (43%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + ++ A+IA+++  +G     T  A+  LP+ +TL+   +    ++  K A  KG E +L
Sbjct: 15  APSNAAQIALIIDDIGYR--HTDEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L    +  Q+ + +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGVGG--LTNNMSETQIRSSVLAAIASVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A  L +P +   L+LD+ V    + ++   + 
Sbjct: 131 LWVMETLKQKQLYFVDSMTTKFTKAGDKADSLGVPLLRRQLFLDNDVSAAALEKQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A + G  + +A  + E+I  +   L +     + +VP S L  +
Sbjct: 191 SQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSLLPI 236


>gi|170742352|ref|YP_001771007.1| hypothetical protein M446_4224 [Methylobacterium sp. 4-46]
 gi|168196626|gb|ACA18573.1| protein of unknown function DUF610 YibQ [Methylobacterium sp. 4-46]
          Length = 396

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 105/395 (26%), Positives = 168/395 (42%), Gaps = 12/395 (3%)

Query: 5   LNHPL--RKKTPKRKSFYSQIISRLGLF-LLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
           L  PL  R +TP R +     I    +        +  ++ ++ ++   +G     +   
Sbjct: 8   LTRPLGMRDETPSRLARLRAAIPLRAILSAAAAVLVGAVAGFVALTEDPLGGEPHALVTI 67

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
             RE  P P +       +        +   ++++  S     + +      +VV +   
Sbjct: 68  TRREAPPGPPS------PRPPAPAEAGSRSASEVERASGVAVLRPEGSAVPDSVVIRVPG 121

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF---CSNASGARIAIVVS 178
            T I   P  +  L        L      G    +V A  +        A   RIA+VV+
Sbjct: 122 PTEIRLAPAPDPALSEKGRYGLLPRLGPDGARAVDVYARPEAPALPSGAAPAGRIALVVT 181

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
           GLGI    TQ A+  LP  +TLAFA  G  + R    A++ G E ++Q PM+ FD   N+
Sbjct: 182 GLGIGAAVTQDAVTRLPPAVTLAFAPYGADVGRQAARAREAGHEVMVQAPMEPFDYPDND 241

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
               TL       +  +RL + L R  G  GV+NY GA L +   + + I +E   RGL 
Sbjct: 242 PGPQTLLAGAKPAENADRLGFVLSRIPGAIGVVNYMGARLTAEAGALDPILREIGARGLG 301

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F DDG+SPR+L   +  +   P   AD+ +D     D +  +L  LEE AR  G A+G A
Sbjct: 302 FVDDGTSPRSLALDIGRRARAPVARADVVVDAAPLPDAVDRELARLEETARRKGFAMGSA 361

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +A   +I+ I++W +    R + +VP S   +   
Sbjct: 362 MALPLTIDRIARWSRDLEARGILLVPASRALRARR 396


>gi|118589439|ref|ZP_01546845.1| hypothetical protein SIAM614_07838 [Stappia aggregata IAM 12614]
 gi|118438139|gb|EAV44774.1| hypothetical protein SIAM614_07838 [Stappia aggregata IAM 12614]
          Length = 370

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 105/377 (27%), Positives = 175/377 (46%), Gaps = 14/377 (3%)

Query: 13  TPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT 72
             +R       +  +G+       +    ++I +    +G     +        A +   
Sbjct: 2   GKRRLVRLPFGLIGVGIL---SVIVTSTLVWITVVDDPLGGEPVAVLPL----DAIVEGV 54

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVVNKPTRSTSIDSLPT 130
              +IE  +     D +   N     S    G   + +        N P  S SI+    
Sbjct: 55  TSQDIEVVEIRPGIDGDLGPNLRPESSKDLLGPRYDMVMRPDGLGPNAPVTSLSINPDSR 114

Query: 131 IEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRA 190
           + ER   G   K  ++   V   D     + + F S     +IA++V+GLG+S+TGTQ A
Sbjct: 115 VSERSDFGFLPK--ISDAGVRPLDAYSRPVVREFTSI---PKIAVIVTGLGLSETGTQNA 169

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           I  LPA+ T A A  G  LD WM++A+ KG E +LQ+P++ FD   N+   +TL V+   
Sbjct: 170 ITRLPADTTFALAPYGGDLDVWMQQARTKGHELLLQLPLEPFDFPDNDPGPHTLLVSLRP 229

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++++RL + L R T Y GV+   GA   + K S E + ++   RGL+F D+G+S R++ 
Sbjct: 230 NEMMDRLGFLLTRATNYVGVIPEMGARFTATKPSMEFLLEKLKARGLMFADNGTSSRSIA 289

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
             +A +  +P+   D+ LD+    D I  KL  LE +AR  G A+  A A   ++  + +
Sbjct: 290 DEVAKEKRIPFSGVDVVLDEVPREDDIDAKLLQLESVARARGVAVATASALPVTVRQLEK 349

Query: 371 WLQQEHVRDVSVVPLSC 387
           W+Q    R + +VP+S 
Sbjct: 350 WVQDLEERGLQLVPVSA 366


>gi|126176516|ref|YP_001052665.1| hypothetical protein Sbal_4335 [Shewanella baltica OS155]
 gi|125999721|gb|ABN63796.1| protein of unknown function DUF610, YibQ [Shewanella baltica OS155]
          Length = 251

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 49/226 (21%), Positives = 96/226 (42%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +    +       KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGEELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGLGG--LTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             I +   ++ L F D  ++        A +L +P +   L+LD+      +  +   + 
Sbjct: 131 LWIMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDTSAKALERQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A T G  + +A  + E++  +   LQ+     + +VP S L  +
Sbjct: 191 SQAHTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPI 236


>gi|117918507|ref|YP_867699.1| hypothetical protein Shewana3_0048 [Shewanella sp. ANA-3]
 gi|117610839|gb|ABK46293.1| protein of unknown function DUF610, YibQ [Shewanella sp. ANA-3]
          Length = 251

 Score =  260 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + ++ A+IA+++  +G     T  A+  LP+ +TL+   +    ++  K A  KG E +L
Sbjct: 15  APSNAAQIALIIDDIGYR--HTDEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L    +  Q+ + +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGVGG--LTNNMSEAQIRSSVLAAIASVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             +     ++ L F D  ++        A  L +P +   L+LD+ V    + ++   + 
Sbjct: 131 LWVMDTLKQKQLYFVDSMTTKFTKAGDKADSLGVPLLRRKLFLDNDVSAAALEKQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A + G  + +A  + E+I  +   L +     + +VP S L  +
Sbjct: 191 SQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSLLPI 236


>gi|320539186|ref|ZP_08038857.1| putative polysaccharide deacetylase [Serratia symbiotica str.
           Tucson]
 gi|320030824|gb|EFW12832.1| putative polysaccharide deacetylase [Serratia symbiotica str.
           Tucson]
          Length = 278

 Score =  260 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 92/229 (40%), Gaps = 4/229 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
               +++IV+  +G      + A+  +P  +++A   N          A  + +E ++ +
Sbjct: 21  VQAGKLSIVIDDVGY-HPHEENAVLQMPEAVSVAVLPNAPYARLMATRAHSQNREVLIHM 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM  F +   E D  TL+   + + +   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPFSKQPLEQD--TLQPDMSSENIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +   +     A    +  +   ++LDD  +   IR +      +
Sbjct: 138 VMQALTSYRLYFLDSLTISNSQATRAAIGTGVKVIKRKVFLDDTANEADIRHQFNRAVAL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           AR  G AI +      +++V+ Q L      D+ +V  S L      SS
Sbjct: 198 ARRNGSAIAIGHPRPATVKVLQQMLPVLPA-DIVLVKPSSLLNEPQGSS 245


>gi|227354766|ref|ZP_03839183.1| protein of hypothetical function DUF610, YibQ [Proteus mirabilis
           ATCC 29906]
 gi|227165084|gb|EEI49915.1| protein of hypothetical function DUF610, YibQ [Proteus mirabilis
           ATCC 29906]
          Length = 304

 Score =  260 bits (665), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 51/233 (21%), Positives = 99/233 (42%), Gaps = 5/233 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F + A  A++AIV+   G  +      I  LP  +++A   N         +A  +G+E 
Sbjct: 7   FSAPAFSAKLAIVIDDFGY-RKKEDNQILQLPTAVSIAILPNSPHGKEMATKAHAQGREI 65

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TLK +    ++   ++ ++ R     G+ N+ G+ + S+++
Sbjct: 66  LIHMPMAPISKQPLEKD--TLKPSMDQAEINRIIQNAINRVPYAVGMNNHMGSAMTSDRQ 123

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + K      L F D  +         A    +P +   ++LD+     + R++L  
Sbjct: 124 AMDRVIKALNHSDLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLNR 183

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
              +AR  G AI +      ++  + Q L      D+ +V  S L    SP S
Sbjct: 184 AINLARKNGFAIAIGHPHPSTVRALQQQLPLLPA-DIQLVAPSGLLT-PSPDS 234


>gi|261823559|ref|YP_003261665.1| hypothetical protein Pecwa_4366 [Pectobacterium wasabiae WPP163]
 gi|261607572|gb|ACX90058.1| protein of unknown function DUF610 YibQ [Pectobacterium wasabiae
           WPP163]
          Length = 313

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 98/226 (43%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +
Sbjct: 21  ALAGKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E D  TL+   +  ++   +R S+       G+ N+ G+ + ++    + 
Sbjct: 80  PMAPMSKQPLERD--TLRPDMSSDEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +I
Sbjct: 138 VMQALSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFARAVQI 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AR +G AI +      +I V+ Q L      D+ +V  S L    +
Sbjct: 198 ARRSGSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPT 242


>gi|317050088|ref|YP_004117736.1| hypothetical protein Pat9b_3890 [Pantoea sp. At-9b]
 gi|316951705|gb|ADU71180.1| protein of unknown function DUF610 YibQ [Pantoea sp. At-9b]
          Length = 301

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 94/226 (41%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
             +A   +++IV+   G  +   +  +  +PA I++A   N         +A + G E +
Sbjct: 17  SLSAHAGKLSIVIDDFGY-RPVEENKVLQMPAAISVAVLPNATYAREMATKAHQSGHEVL 75

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E D  TL    +  ++   +  ++ +     G+ N+ G+ + S+   
Sbjct: 76  IHLPMAPLSKQPLEKD--TLTPEMSSAEIERIIHDAVGKVPYAVGLNNHMGSKMTSSLPG 133

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +        F D  +   + +   A   ++  +   ++LDD  +   IR++    
Sbjct: 134 MQKVMQVLNHYNFYFLDSMTIGNSQSVPAAQGTHVKVLKRRVFLDDSQNDAAIRQQFTRA 193

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++A+  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 194 VKLAQRDGYAIAIGHPHPNTVRVLQQMLPTLPA-DITLVRPSQLLN 238


>gi|114706555|ref|ZP_01439456.1| hypothetical protein FP2506_12424 [Fulvimarina pelagi HTCC2506]
 gi|114537947|gb|EAU41070.1| hypothetical protein FP2506_12424 [Fulvimarina pelagi HTCC2506]
          Length = 386

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 124/397 (31%), Positives = 184/397 (46%), Gaps = 19/397 (4%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M    + PL+      +       + LGL  +    I  LS+Y      F          
Sbjct: 1   MDAIFSQPLKANARSPRRSLRPTRADLGLGTVAVILIA-LSLYPAW---FDRIDRHPSDA 56

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKR-DNNTVCNQLKNDS----SQHDGQIQNDISGKTV 115
           S   E+A I       I   +  +K+ D +   N+               ++    G   
Sbjct: 57  SGTVELAGIDQVATGGISSVRGTAKQIDIDAALNERARRETTELPYQPANMEVRDLGDM- 115

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAI 175
                   +I      ++  I       L  +   GR   +V    +    +  G R+AI
Sbjct: 116 ------RQAISVAHMPDDAFIEDSEYGLLPVRAVDGRRPFDVY---RGASPSRMGPRVAI 166

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           VV GLGISQ+GT  AI  LP+ +TLAFA+NGNSL RWM+EA++ G E +LQ+PM+     
Sbjct: 167 VVGGLGISQSGTLSAIRNLPSEVTLAFAANGNSLARWMQEARRGGHELLLQMPMEPVGYP 226

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
            N+    T+   Q   +  + +  SL + T Y GVMNY G  L S+  +      E A+R
Sbjct: 227 TNDPGDNTVTSEQMNAEDFSSVLASLGQMTNYVGVMNYLGGQLTSDASALHPFMSELARR 286

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAI 355
           GL++ DDGSS R++   LA   ++P   ADL LDD  D  +I  +L  LE+IART G AI
Sbjct: 287 GLMYLDDGSSARSVAVDLAETTSIPAGAADLVLDDVQDAGEISRRLDQLEQIARTRGHAI 346

Query: 356 GVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           GVA AF+ +  VI  W+++   R ++V P+S + +  
Sbjct: 347 GVASAFETTTSVIGSWIREAERRGITVTPVSSVVRDP 383


>gi|291619436|ref|YP_003522178.1| YibQ [Pantoea ananatis LMG 20103]
 gi|291154466|gb|ADD79050.1| YibQ [Pantoea ananatis LMG 20103]
          Length = 303

 Score =  259 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 95/223 (42%), Gaps = 4/223 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           +  A++AIV+   G   T   + +  +P  I++A   +     +   +A + G+E ++ +
Sbjct: 21  SQAAKLAIVIDDFGYRPTEENKVLQ-MPQAISVAVLPDAPYARQMAIKAHQGGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E    TL    +  ++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSKQPLEK--NTLTPEMSRAEIDRIIRSAVNNVPYAVGLNNHMGSKMTSSLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +   +  L F D  +   + +   A   ++  +   ++LDD  D + IR++      +
Sbjct: 138 VMQALNQYNLYFLDSMTIGNSQSLQAAQGTHVRVLKRRVFLDDSQDINAIRQQFNRAVTL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           A+  G AI +      ++ V+ Q L      D+++V    L  
Sbjct: 198 AQRDGYAIAIGHPHPNTVRVLQQMLPSLPA-DITLVTPGQLLN 239


>gi|156936214|ref|YP_001440130.1| hypothetical protein ESA_04113 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534468|gb|ABU79294.1| hypothetical protein ESA_04113 [Cronobacter sakazakii ATCC BAA-894]
          Length = 313

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 44/216 (20%), Positives = 89/216 (41%), Gaps = 4/216 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IV+   G  + GT+  +  +PA +++A   N         +A  +G + ++ +PM    +
Sbjct: 28  IVIDDFGY-RPGTENQVLAMPAEVSVAVLPNAPHAREMATKAHNQGHDVLIHLPMAPLSK 86

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              E D  TL+   +  ++   +R ++       G+ N+ G+ + S+    + +    A 
Sbjct: 87  QPLEKD--TLRPDMSADEIARIIREAVNSVPYAIGMNNHMGSAMTSSLPGMQKVMASLAH 144

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
             L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G A
Sbjct: 145 YNLFFLDSMTIGNSQAMRAAAGTGVKVIKRKVFLDDTQNDADIRYQFNRAVALARRNGSA 204

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           I +      ++ V+ Q L      D+++V  S L  
Sbjct: 205 IAIGHPHPSTVRVLQQMLYNLPP-DITLVRASSLLN 239


>gi|284008837|emb|CBA75621.1| exported polysaccharide deacetylase [Arsenophonus nasoniae]
          Length = 319

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 100/226 (44%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
               + +++AIV+  +G  +      I  LP  I++A   +        ++A ++G+E +
Sbjct: 17  SGQVNASKLAIVIDDIGY-RKKEDNQILALPVAISIAILPDSPYGREMAEKANQQGREIL 75

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM+   +   E    TL    +  ++  ++  ++++     G+ N+ G+ + +N  +
Sbjct: 76  IHMPMKPISQQPLEK--NTLTPQMSASEIEQKIIAAIKQVPHAKGMNNHMGSAMTANLVA 133

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + +    +   L F D  +         A    LP +  +++LDD     +IR++    
Sbjct: 134 MKNVMHVLSHYDLYFLDSVTIANTKVNEAAKFFALPTLRRNVFLDDVKTEAQIRKQFAHA 193

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              AR  G +I +   +  +I+V+ Q L +    D+ +V +S L  
Sbjct: 194 ISFARKQGSSIVIGHPYPATIQVLHQTLFELPS-DIELVAVSKLLN 238


>gi|308272530|emb|CBX29134.1| hypothetical protein N47_J01150 [uncultured Desulfobacterium sp.]
          Length = 301

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 61/279 (21%), Positives = 121/279 (43%), Gaps = 5/279 (1%)

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV-PAMDKNFCSNASGARIA 174
             KP        L   E++  + L         K  +   ++ P   K+   N     +A
Sbjct: 27  EKKPLPVKIQVPLKIKEQKKKVTLKPPVFEVYPKEEKHYVKIQPIKIKSLKHNL--PDVA 84

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           I++  +G      ++ +  L A  T +        +  ++ A+KKG+E +L +PM+  + 
Sbjct: 85  IIIDDIGYHPDLEKKYLE-LDAAFTFSVLPFSPYKNITIEAARKKGREIMLHLPMEPNEY 143

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
                    L  + +  QL++++   +       GV N+ G+ + ++      IF     
Sbjct: 144 PEISPGPGALLTSMSPDQLISQINEDIDDVPFIKGVNNHMGSKMSASDVQMNQIFSVLKA 203

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGL F D  + P+   R  A    L +   D+++D + DR+ I+ ++  L +IA   G+A
Sbjct: 204 RGLYFIDSKTGPKTYGRESARLFKLTFAERDVFIDHKQDREFIKNQIYELIKIANRHGKA 263

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I +   +  + +V+S+ L     + +++VP S + K SS
Sbjct: 264 IAIMHPYPLTYQVVSEMLPYMKKK-MNIVPASAIVKDSS 301


>gi|24371646|ref|NP_715688.1| hypothetical protein SO_0046 [Shewanella oneidensis MR-1]
 gi|24345408|gb|AAN53133.1|AE015456_3 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 251

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 44/228 (19%), Positives = 94/228 (41%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + ++ A+IA+++  +G     T  A+  LP+++TL+   +     +  K A   G E +
Sbjct: 14  VAPSNAAQIALIIDDIGYR--HTDEAVLSLPSSVTLSVLPHTPLSSKLAKAAHANGHEIM 71

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PMQA +          L       Q+ + +  ++       G  N+ G++L    + 
Sbjct: 72  LHLPMQALNGKALGVGG--LTNNMNEAQIRSSVLAAMASVPFAKGANNHMGSLLTQLDDP 129

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              + +   ++   F D  ++        A +L +P +   L+LD+ V    +  +   +
Sbjct: 130 MLWVMETLKQKQFYFVDSMTTKFTKAGDRADQLGVPLLRRQLFLDNDVSTQALERQFNLM 189

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
              A   G  + +A  + E+I  +   L +     + +VP S L  + 
Sbjct: 190 ISQAHAQGSLVAIAHPYPETIHFLKANLARLKAEGIELVPTSRLLPIK 237


>gi|152998595|ref|YP_001364276.1| hypothetical protein Shew185_0040 [Shewanella baltica OS185]
 gi|151363213|gb|ABS06213.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS185]
          Length = 251

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGLGG--LTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  +   + 
Sbjct: 131 LWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALERQFSLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A+T G  + +A  + E++  +   LQ+     + +VP S L  +
Sbjct: 191 SQAQTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPI 236


>gi|78223057|ref|YP_384804.1| hypothetical protein Gmet_1850 [Geobacter metallireducens GS-15]
 gi|78194312|gb|ABB32079.1| protein of unknown function DUF610, YibQ [Geobacter metallireducens
           GS-15]
          Length = 320

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 54/275 (19%), Positives = 113/275 (41%), Gaps = 6/275 (2%)

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGRED---TEVPAMDKNF--CSNASGARIAI 175
           +       P           ++    K  V  ED   T VP   +       A    +AI
Sbjct: 47  KRPEKKPEPPKVVARHKLPPRESAAEKEPVVHEDYTATVVPPPTERHVRPRPAGSGNLAI 106

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           ++  +G      +  I+ +   +T +       + +  +EA+++G EA++ +PM+     
Sbjct: 107 IIDDMGKGMQEARSIID-IGVPVTFSIIPGLPKVRQVAQEAQRRGIEAMIHLPMEPKGYP 165

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
               +   L ++Q+  +++ R+    +      G  N+ G+    NKE   ++ +   ++
Sbjct: 166 ERRLEENGLLLSQSNDEIVVRMNGYFKEVPQAVGANNHMGSAFTENKEKMAIVLRVLKEK 225

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAI 355
           GL F D  +S  ++    A ++ L      ++LD+  D   I ++++    IAR  G AI
Sbjct: 226 GLFFVDSKTSAISVGESTAREMGLRTASRSVFLDNIQDVGYISKQIRQAASIARKRGSAI 285

Query: 356 GVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            +      +I+ ++  L +     V++VP S L  
Sbjct: 286 AICHPHPATIQALAAELPKLRDEGVTLVPASSLVH 320


>gi|271498745|ref|YP_003331770.1| hypothetical protein Dd586_0167 [Dickeya dadantii Ech586]
 gi|270342300|gb|ACZ75065.1| protein of unknown function DUF610 YibQ [Dickeya dadantii Ech586]
          Length = 309

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++A+V+   G       + +  +P  I++A   N         +A  +G+E ++ 
Sbjct: 19  PVWAGKLALVIDDFGYRPHNENQVLA-MPTAISVAVLPNAPYAREMATKAHAQGREVLIH 77

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E D  TL+   + +++   LR ++ +     G+ N+ G+ + ++    +
Sbjct: 78  LPMAPMSKQPLERD--TLRPDMSSEEIARILRDAVNKVPYAVGLNNHMGSAMTASLPGMQ 135

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +  +   L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 136 KVMQAMSAYHLYFLDSMTIGSSQASQAAAGTGIKVLKRKVFLDDTQNVADIRRQFSRAVE 195

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           IA+ +G AI +      +I+V+ Q L      D+ +V  S L     P
Sbjct: 196 IAQRSGYAIAIGHPHPTTIQVLQQMLPTLPA-DIVLVRPSQLLNEPEP 242


>gi|160873170|ref|YP_001552486.1| hypothetical protein Sbal195_0044 [Shewanella baltica OS195]
 gi|160858692|gb|ABX47226.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS195]
 gi|315265395|gb|ADT92248.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS678]
          Length = 251

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 48/226 (21%), Positives = 96/226 (42%), Gaps = 4/226 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKALGLGG--LTNTMTEVQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  +   + 
Sbjct: 131 LWVMETLKQKHLYFVDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALERQFSLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
             A T G  + +A  + E++  +   LQ+     + +VP S L  +
Sbjct: 191 SEAHTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPI 236


>gi|119773199|ref|YP_925939.1| hypothetical protein Sama_0057 [Shewanella amazonensis SB2B]
 gi|119765699|gb|ABL98269.1| protein of unknown function DUF610, YibQ [Shewanella amazonensis
           SB2B]
          Length = 250

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 96/223 (43%), Gaps = 4/223 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A GA++AI++  +G     T   +  LP +ITL+   +     +   +  ++G E +L 
Sbjct: 15  TAHGAQLAIIIDDIGYR--HTDEDVLSLPKDITLSVIPSSPLGVKLASKGHQRGHEIMLH 72

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQ+ +          L      Q++  ++  ++ R     G  N+ G+ML        
Sbjct: 73  LPMQSLNARPLGQGG--LTSDMDEQEIKRKVDDAMVRIPFAKGANNHMGSMLTQLDSHML 130

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  ++  +     A ++ +P +   ++LD+   +  + ++ K + E
Sbjct: 131 WVMERLKHNNLYFVDSLTTRYSKAGAKAEQVGVPLLKRHVFLDNDTSKRGLEKQFKLMME 190

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            A   G  + +A     +++ ++  L +     +++VP S L 
Sbjct: 191 QAHQQGFVVAIAHPHPATVKFLNANLHRLRDEGINLVPTSELL 233


>gi|159795367|pdb|2QV5|A Chain A, Crystal Structure Of Uncharacterized Protein Atu2773 From
           Agrobacterium Tumefaciens C58
 gi|159795368|pdb|2QV5|B Chain B, Crystal Structure Of Uncharacterized Protein Atu2773 From
           Agrobacterium Tumefaciens C58
          Length = 261

 Score =  258 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 104/246 (42%), Positives = 145/246 (58%)

Query: 144 LLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFA 203
           L     VG +            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA
Sbjct: 3   LGQLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFA 62

Query: 204 SNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRR 263
           ++GNSL RWM++A+++G E +LQIP++ F          TL      +  ++RL  S+ +
Sbjct: 63  ASGNSLQRWMQDARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAK 122

Query: 264 GTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMV 323
            T Y GVMNY G   L+ + + E + ++  KRGLLF DDGSS ++L+  +A  ++ P   
Sbjct: 123 ITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGF 182

Query: 324 ADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
           AD+ LD +V    I  KL  LE IAR  GQAIGVA AFDESI  IS+W ++   R + +V
Sbjct: 183 ADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIV 242

Query: 384 PLSCLA 389
            +S L 
Sbjct: 243 GVSALV 248


>gi|254504290|ref|ZP_05116441.1| Divergent polysaccharide deacetylase family [Labrenzia alexandrii
           DFL-11]
 gi|222440361|gb|EEE47040.1| Divergent polysaccharide deacetylase family [Labrenzia alexandrii
           DFL-11]
          Length = 372

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 102/380 (26%), Positives = 171/380 (45%), Gaps = 20/380 (5%)

Query: 13  TPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV-----IREIA 67
             +R       +   GL       +    I+IL+     G     +         I    
Sbjct: 2   GKRRLVRLPFGLIGAGLI---SVVLTTALIWILVVDDPYGGEPFAVLPLDEVVEGITSQD 58

Query: 68  PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDS 127
              + I   + D   P+ R  ++              +             P    +I+ 
Sbjct: 59  IEVVEIRPTVGDDLGPNLRQQSSGDYLGPRYE--MIIRPDGLGP-----EAPVTGLAINP 111

Query: 128 LPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGT 187
            P + ER   G     +++   V   D     +   F S     +IA+VV+GLG+S+ GT
Sbjct: 112 DPRVSERSDYGFLP--MVSDAGVRPLDAYARPIQTQFTSI---PKIAVVVTGLGLSEAGT 166

Query: 188 QRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT 247
           Q AI+ LPA++T A A  G+ LD WM++A+ KG E +LQ+P++ FD   N+   +TL V+
Sbjct: 167 QNAIDSLPADVTFALAPYGSDLDLWMQQARMKGHELLLQLPLEPFDFPDNDPGPHTLLVS 226

Query: 248 QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPR 307
               +LL+RL + L R T Y GV+   GA   S + S + + ++   RGL+F D+G++ R
Sbjct: 227 LQPTELLDRLAFLLTRATNYVGVIGEMGARFSSTRPSMQYLLEKLETRGLMFVDNGTTSR 286

Query: 308 NLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
           ++   +A +L +P+   D+ LD+      I  KL  LE +AR  G A+    A   ++  
Sbjct: 287 SIADEVAGELRMPFSGVDVVLDEVPRESNIDAKLLQLESVARARGYAVAAGSALPVTVRQ 346

Query: 368 ISQWLQQEHVRDVSVVPLSC 387
           + +W+Q    R + +VP+S 
Sbjct: 347 LQEWVQDLEQRGLQLVPVSA 366


>gi|242279092|ref|YP_002991221.1| hypothetical protein Desal_1620 [Desulfovibrio salexigens DSM 2638]
 gi|242121986|gb|ACS79682.1| protein of unknown function DUF610 YibQ [Desulfovibrio salexigens
           DSM 2638]
          Length = 418

 Score =  258 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 112/253 (44%), Gaps = 7/253 (2%)

Query: 136 ILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLP 195
           I G+   +      V ++    P          +  ++AIV+  +G       + +  L 
Sbjct: 169 INGVPTHKFSIFTPVVKKQKPAPVKLDP-----NAPKLAIVIDDMGEDLKLA-KGLAALD 222

Query: 196 ANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLN 255
           A IT +   N + + + +  AKK G E ++ +PMQ          +  L V     ++ +
Sbjct: 223 AKITFSIWPNSSHVKKTIAIAKKSGNEIMVHLPMQPKGYPKVNPGADALLVGMDADKISS 282

Query: 256 RLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAP 315
               ++ +  G  G+ N+ G+    N        K+  K+ L F D  ++P++  R  A 
Sbjct: 283 ITLAAIAKVPGATGLNNHMGSSFTENYNGMLAALKQLNKKHLFFLDSRTTPKSACRRAAS 342

Query: 316 KLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQE 375
           K  + +   +++LD+  D   I+ +L    +IAR +GQAI +     E+++ I QW+ + 
Sbjct: 343 KAGVTFYERNIFLDNVKDVGAIKYQLSKAAKIARKSGQAIAIGHPNHETLKAIRQWVAEN 402

Query: 376 HVRDVSVVPLSCL 388
             + + +VP+S L
Sbjct: 403 KGK-IRIVPVSSL 414


>gi|329296461|ref|ZP_08253797.1| hypothetical protein Pstas_07378 [Plautia stali symbiont]
          Length = 301

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 44/227 (19%), Positives = 92/227 (40%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++AIV+   G       + +  +PA I++A   N         +A + G E 
Sbjct: 16  FTFAAHAGKLAIVIDDFGYHPAEENKVLQ-MPAAISVAVLPNAPHARDMATKAHQGGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL    + +++   +R +  +     G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLEKD--TLTPKMSSEEIARIVRDASNKVPYAVGLNNHMGSKMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +        F D  +   + +   A    +  +   ++LDD  +   IR +   
Sbjct: 133 GMQKVMQVLNHYNYYFLDSMTIGNSQSVPAAQGTQVKVLKRRVFLDDSQNESAIRTQFTR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             ++A+  G AI +      ++ V+ Q L      D+++V  S L  
Sbjct: 193 AVKLAQRDGYAISIGHPHPTTVRVLQQMLPTLPG-DITLVRPSQLLN 238


>gi|261408347|ref|YP_003244588.1| hypothetical protein GYMC10_4558 [Paenibacillus sp. Y412MC10]
 gi|261284810|gb|ACX66781.1| protein of unknown function DUF610 YibQ [Paenibacillus sp.
           Y412MC10]
          Length = 293

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 101/238 (42%), Gaps = 5/238 (2%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
           +            ++A+++   G  Q GT+  +N LP  IT+A      +  +  + A +
Sbjct: 48  SDHSRSVQEKKPNKLAVIIDDFGNDQKGTEEMLN-LPVKITVAVMPFLPTSKKDAEAAHQ 106

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           +G + I+ +PM+      +      +  + T +++  R+  ++       G+ N+ G+ +
Sbjct: 107 QGHDVIIHMPMEPKQGRSSWLGPGAILSSLTDEEIRKRMEEAIDSVPYAVGINNHMGSKV 166

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
             ++    ++     +RGL F D  ++  ++   LA K  +P +  D++LDD      + 
Sbjct: 167 TGDERVMSIVLDVCRERGLFFVDSKTNYYSVVGKLAAKKGMPSISNDIFLDDVHTVQHVS 226

Query: 339 EKLKGLEEIARTTGQAIGVAV--AFDE-SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++L+   + A      I +     +   + + +   + +   + V  V +S L +  S
Sbjct: 227 KQLQTAAQHAEERTSCIAIGHVGVYGIRTAKALKGTIPELQKK-VEFVGISDLVREHS 283


>gi|311695899|gb|ADP98772.1| secreted protein containing DUF610, YibQ [marine bacterium HP15]
          Length = 271

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 48/225 (21%), Positives = 98/225 (43%), Gaps = 3/225 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             IAI++  +G S    +R +  L   +TLAF       D   + A K+ +E +L  PM 
Sbjct: 30  PTIAIIIDDMGHSLVEGER-LANLDQPLTLAFLPYRPHTDSLARLAYKQHKEIMLHAPMA 88

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
             +          L      Q +   LR +L+      GV N+ G++L    +  + + K
Sbjct: 89  --NTRNYGLGPGGLTPEMDEQSMATTLRRALQSIPHVQGVNNHMGSLLTQQLQPMDWVMK 146

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +  + F D  +   ++   +A    +P M  D++LD +   + +  + K L + A+ 
Sbjct: 147 ELFRYPVYFIDSRTIASSVAGDVAAAYRIPTMTRDVFLDHEQTEEFVDRQFKLLIKRAKE 206

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            G AIG+      +++ + + L +   + +++  +S L  + + +
Sbjct: 207 NGSAIGIGHPHKVTVDYLEKHLPKLDEQGIAIATVSGLWAMRNGN 251


>gi|158522465|ref|YP_001530335.1| protein of unknown function DUF610 YibQ [Desulfococcus oleovorans
           Hxd3]
 gi|158511291|gb|ABW68258.1| protein of unknown function DUF610 YibQ [Desulfococcus oleovorans
           Hxd3]
          Length = 315

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 58/308 (18%), Positives = 120/308 (38%), Gaps = 8/308 (2%)

Query: 90  TVCNQLKNDSSQHDGQIQNDISGKTVVNKP-TRSTSIDSLPTIEERLILGLSKKELLAK- 147
           T     K  +    G     ++G  ++      +  +  +   +        + ++ A+ 
Sbjct: 7   TPATARKASAPSTPGHYLKILAGALLLVGILGAAALVGLVFLPDTPPDRTAGQPDVPARR 66

Query: 148 NKVGREDTEVPAMDKNFCSNASGA----RIAIVVSGLGISQTGTQRAINLLPANITLAFA 203
                        D   C  A       ++AI++  +G  +    R +N L   +T +  
Sbjct: 67  PPFEVYPETDRLPDSPPCGPAHAPSARPKVAIIIDDMGYDRALAGRFVN-LGIPLTFSIL 125

Query: 204 SNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRR 263
            +        + A++KG E +L +PM+  +          L  +    +L+ R+  +L  
Sbjct: 126 PHSPRGREIARTARQKGIEIMLHLPMEPDEYPAVNPGDGVLLTSMGPDELIARMENNLND 185

Query: 264 GTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMV 323
            +   GV N+ G+ + ++      +F    K GL F D  ++P +  R  A  L +P+  
Sbjct: 186 ISHVAGVNNHMGSKMTADSARMYQVFSVLKKHGLFFVDSRTTPESQCRPAARLLQVPFAE 245

Query: 324 ADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
            D++LD+  D   I  ++  L  +A+  G+A+ +  A   +   + + L     + V +V
Sbjct: 246 RDVFLDNDSDVAAIEAQIDRLIAVAKRNGKAVAIGHAHGSTCTALEKHLAALTQQ-VELV 304

Query: 384 PLSCLAKL 391
           P S L  L
Sbjct: 305 PASHLVCL 312


>gi|329929364|ref|ZP_08283112.1| divergent polysaccharide deacetylase [Paenibacillus sp. HGF5]
 gi|328936451|gb|EGG32896.1| divergent polysaccharide deacetylase [Paenibacillus sp. HGF5]
          Length = 293

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 42/234 (17%), Positives = 100/234 (42%), Gaps = 5/234 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
                    ++A+++   G  Q GT+  +N LP  IT+A      +  +  + A ++G +
Sbjct: 52  RSAQEKKPNKLAVIIDDFGNDQKGTEEMLN-LPVKITVAVMPFLPTSKKDAEAAHQQGHD 110

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+      +      +  + T +++  R+  ++       G+ N+ G+ +  ++
Sbjct: 111 VIIHMPMEPKQGRSSWLGPGAILSSLTDEEIRKRMEEAIDSVPYAVGINNHMGSKVTGDE 170

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               ++     +RGL F D  ++  ++   LA  + +P +  D++LDD      + ++L+
Sbjct: 171 RVMSIVLDVCRERGLFFVDSKTNYYSVVGKLAASMGMPSIANDIFLDDVHTVQHVSKQLQ 230

Query: 343 GLEEIARTTGQAIGVAV--AFDE-SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
              + A      I +     +   + E +   + +   + V  V +S L +  S
Sbjct: 231 TAAQHAVERTSCIAIGHVGVYGIRTAEALKGTIPELQKK-VEFVGISDLVREHS 283


>gi|260599915|ref|YP_003212486.1| hypothetical protein CTU_41230 [Cronobacter turicensis z3032]
 gi|260219092|emb|CBA34447.1| Uncharacterized protein yibQ [Cronobacter turicensis z3032]
          Length = 286

 Score =  256 bits (655), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 42/215 (19%), Positives = 88/215 (40%), Gaps = 4/215 (1%)

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           V+   G   + T+  +  +PA +++A   N         +A  +G + ++ +PM    + 
Sbjct: 2   VIDDFGYRPS-TENQVLAMPAEVSVAVLPNAPHAREMATKAHNQGHDVLIHLPMAPLSKQ 60

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
             E D  TL+   + +++   +R ++       G+ N+ G+ + S+    + +    A  
Sbjct: 61  PLEKD--TLRPDMSSEEIARIIREAVNDVPYAIGMNNHMGSAMTSSLPGMQKVMAALAHY 118

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAI 355
            L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G AI
Sbjct: 119 NLFFLDSMTIGNSQAMRAAAGTGVKVIKRKVFLDDIQNEADIRYQFNRAVALARRNGSAI 178

Query: 356 GVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            +      ++ V+ Q L      D+++V  S L  
Sbjct: 179 AIGHPHPSTVRVLQQMLYSLPA-DITLVRASSLLN 212


>gi|116750484|ref|YP_847171.1| hypothetical protein Sfum_3062 [Syntrophobacter fumaroxidans MPOB]
 gi|116699548|gb|ABK18736.1| protein of unknown function DUF610, YibQ [Syntrophobacter
           fumaroxidans MPOB]
          Length = 430

 Score =  256 bits (655), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 66/387 (17%), Positives = 137/387 (35%), Gaps = 8/387 (2%)

Query: 14  PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTI 73
             R   +S  + R     L   + + +     + +   GT       +  +  +    ++
Sbjct: 38  ATRGKSFSAGMPRSRFLPLLTVWFLAVLALASLLYWNGGTEKPPPKPAANKATSTGQSSV 97

Query: 74  PLNIEDKQSPSKRDNNTVCNQ-LKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
           P          + +   V      +      G  +           P     I+  P   
Sbjct: 98  PKPRMADPPAKQPEAGPVAGSRTPSPKGGEPGGKEPGTREPARTTAPAGKPLIEPPPPFH 157

Query: 133 ERLILGLSKKELLAKN------KVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTG 186
            R I     KE   K        +        A        A  A++AIV+   G +   
Sbjct: 158 SRDIPIDQPKEPARKPDSITLSALRPGVPPGTAPPPPSPVPAPVAKVAIVIDDFGQNLEV 217

Query: 187 TQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKV 246
            ++ ++ +P  ++ A   N        + A    +E +L +PM+       +  S  L  
Sbjct: 218 AKKFLS-IPLPLSFAILPNQRHTAEIAELAHAHHREVLLHLPMEPQGYPKMDPGSGALLT 276

Query: 247 TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
           + +  +L   L  +L     + GV N+ G+    N  S  V+  E   R L F D  ++ 
Sbjct: 277 SMSRGRLRRTLLAALDSTPYFIGVNNHMGSKFTENTPSMRVVMSELRHRKLFFLDSATTG 336

Query: 307 RNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIE 366
            ++   LA +  +P    D++LD  +  + ++ ++  L   A+  G A+ +    + +++
Sbjct: 337 DSVGFALAREYGIPARKRDIFLDHTLTDEAVQSQVDQLIRKAKIEGTALAIGHPHEVTLK 396

Query: 367 VISQWLQQEHVRDVSVVPLSCLAKLSS 393
            + + + +    +V+VVP S L  + S
Sbjct: 397 ALIEGVDRFKEENVAVVPSSELMIVPS 423


>gi|149376054|ref|ZP_01893820.1| hypothetical protein MDG893_03710 [Marinobacter algicola DG893]
 gi|149359691|gb|EDM48149.1| hypothetical protein MDG893_03710 [Marinobacter algicola DG893]
          Length = 269

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 96/225 (42%), Gaps = 3/225 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             IAI++  +G +    +R I  L   ITLAF        R  + A +K +E +L  PM 
Sbjct: 28  PTIAIIIDDMGHNLVEGERLIA-LEQPITLAFLPYRRYTTRLAELAHRKHKEIMLHAPMA 86

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
             +          L        +   LR +L+      GV N+ G++L    +  + +  
Sbjct: 87  --NTRNIGLGPGGLNPDMDQNSIATTLRRALQSIPHVQGVNNHMGSLLTQQLQPMDWVMS 144

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E     + F D  +   ++   +A    +P +  D++LD +   + + ++ + L + A+ 
Sbjct: 145 ELDHYPVYFVDSRTIASSIAGEVAAAYRIPTLTRDVFLDHEQTEEFVDQQFELLIKRAKE 204

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            G AIG+      +++ + + L +   + +++  +S +  + + +
Sbjct: 205 NGSAIGIGHPHKVTVDYLEKRLPELDEQGIAIATVSGVWAMRNGN 249


>gi|120556079|ref|YP_960430.1| protein of unknown function DUF610, YibQ [Marinobacter aquaeolei
           VT8]
 gi|120325928|gb|ABM20243.1| protein of unknown function DUF610, YibQ [Marinobacter aquaeolei
           VT8]
          Length = 272

 Score =  256 bits (654), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 49/240 (20%), Positives = 101/240 (42%), Gaps = 6/240 (2%)

Query: 159 AMDKNFCSNASGAR---IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
           +    F S     +   IAI++  +G ++   +R +  L   +TLAF           K 
Sbjct: 16  SPVAAFASGPGEPQQPTIAIIIDDMGHNRHEGER-LARLDQPLTLAFLPYRRHTVPLAKL 74

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A  + +E +L  PM   +          L        +   LR +L+      GV N+ G
Sbjct: 75  AHAQSKEIMLHAPMA--NTRNFGLGPGGLTPDMDELAIATTLRRALQSIPFVSGVNNHMG 132

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           ++L    E  + + KE  +  + F D  +   ++   +A   N+P +  D++LD +   +
Sbjct: 133 SLLTQQLEPMDWVMKELDRYPVYFVDSRTIANSIAGSVADAYNIPSLTRDVFLDHEQTEE 192

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            + ++ K L + AR  G AIG+      +++ + + L     + +++  +S L  + + +
Sbjct: 193 FVDKQFKLLIQTAREKGTAIGIGHPHKVTVDYLEKHLPMLDEQGIAIATVSGLWAMRNGN 252


>gi|293393596|ref|ZP_06637906.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423931|gb|EFE97150.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 316

 Score =  256 bits (654), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 94/226 (41%), Gaps = 3/226 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E ++ +PM 
Sbjct: 24  GKLSIVIDDVGY-RPHEENAVLQMPLAISVAVLPNAPHAHLMATRAHSQGREVLIHMPMA 82

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
              +   E D  TL+ + +  ++   +R ++       G+ N+ G+ + S+  + + + +
Sbjct: 83  PLSKQPLERD--TLQPSMSSDEVQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPAMQKVMQ 140

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
                 L F D  +   +     A    +  +   ++LDD      IR +     E+AR 
Sbjct: 141 ALESYNLYFLDSMTIGNSQATRAAAGTGVKVIKRRVFLDDTASEADIRHQFNRAVELARR 200

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            G AI +      +++V+ Q L       V V P S L    S  S
Sbjct: 201 NGSAIAIGHPRPATVKVLRQMLATLPSDIVLVRPSSLLNAPQSGGS 246


>gi|242237635|ref|YP_002985816.1| hypothetical protein Dd703_0176 [Dickeya dadantii Ech703]
 gi|242129692|gb|ACS83994.1| protein of unknown function DUF610 YibQ [Dickeya dadantii Ech703]
          Length = 319

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 43/224 (19%), Positives = 93/224 (41%), Gaps = 4/224 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++++V+   G  +   +  +  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  PVWAGKLSLVIDDFGY-RPHNENQVLAMPVAISVAVLPNAPYARDMATKAHAQGREVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E D  TL+   + +++   LR ++ +     G+ N+ G+ + ++    +
Sbjct: 79  LPMAPMSKQPLERD--TLRPDMSSEEIARILRDAVGKVPYAVGLNNHMGSAMTASLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQAMTTYRLYFLDSMTIGSSQASRAAAGTGIRVLKRKVFLDDTQNTADIRRQFNRAVE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           +AR  G AI +      +I+V+ Q L      D+ +V  S L  
Sbjct: 197 LARRDGVAIAIGHPHPTTIQVLQQMLPTLPP-DIELVRPSQLLN 239


>gi|260892757|ref|YP_003238854.1| N-acetylmuramoyl-L-alanine amidase [Ammonifex degensii KC4]
 gi|260864898|gb|ACX52004.1| N-acetylmuramoyl-L-alanine amidase [Ammonifex degensii KC4]
          Length = 476

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 58/295 (19%), Positives = 122/295 (41%), Gaps = 9/295 (3%)

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
           +++      VV     S++ ++   ++      +++           +   +PA  K   
Sbjct: 170 LEHTCMPAVVVEMGYLSSAAEAARLLDPGYQQRIAEALCAGLEAYFAQANSLPAGGK--- 226

Query: 166 SNASGARIAIVVSGL-GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            ++  AR+AIV+    G S+    R    L   +T A   N        +EA K G E +
Sbjct: 227 LHSPRARVAIVIDDFAGPSEKKGTREFLSLNKPLTFAVLPNYPLSAPTAREAVKAGFEVL 286

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM+      +      + V    +++  R+  ++    G  G+ N+ G+   ++   
Sbjct: 287 VHLPMEPLKGDPSWLGPGAIYVHLNDEEIERRVERAIASVPGAVGMNNHMGSRATADPRV 346

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              + +   +  L F D  ++ +++   +A +L +PY    L+LD   D   I+E+L+ L
Sbjct: 347 IRAVLRVAKRHNLFFLDSKTTNKSVIPQIAKELGVPYAEDGLFLDAVNDVGHIKEQLRKL 406

Query: 345 EEIARTTGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            ++A   G AI +         ++  I + L +     + +V +S L  L  P+S
Sbjct: 407 AQLALKNGSAIAIGHVGVTGPNTVRAIKEMLPEFERLGIELVYVSTL--LKHPAS 459


>gi|302187492|ref|ZP_07264165.1| hypothetical protein Psyrps6_14148 [Pseudomonas syringae pv.
           syringae 642]
          Length = 260

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 46/225 (20%), Positives = 98/225 (43%), Gaps = 7/225 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                 A +++++  LG +     R +  LP  +TLA   +      + +EA + G+  +
Sbjct: 25  SGKPPKAYLSLIIDDLGQNPQRDSRTLA-LPGPVTLAIMPDTPHATEFAREAHRAGKTVM 83

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +
Sbjct: 84  LHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVA 137

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+  
Sbjct: 138 MTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTA 197

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            +IAR  G A+ +   +  +++V+ + L     + V  + L  + 
Sbjct: 198 IKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSMI 242


>gi|326796766|ref|YP_004314586.1| hypothetical protein Marme_3537 [Marinomonas mediterranea MMB-1]
 gi|326547530|gb|ADZ92750.1| protein of unknown function DUF610 YibQ [Marinomonas mediterranea
           MMB-1]
          Length = 344

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 55/270 (20%), Positives = 116/270 (42%), Gaps = 4/270 (1%)

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSG 179
             + +  S P     L   +       +       +EV   DK   S     RI+I++  
Sbjct: 77  EEAPADASSPVGSGSLEPFIVPFSPFYQRVRLTPPSEVIRKDK-VKSREQLPRISIIIDD 135

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
           LG ++ G + ++N LP  + LA   +     +   ++ ++ +  +L  PM+  ++   + 
Sbjct: 136 LGYNRRGMESSLN-LPVEVALAILPHTPFGKKTALKSIEQNRVTLLHAPME--NQRELKL 192

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLF 299
               L  +   ++  + LR  L    G  GV N+ G++L ++ ++   + +    R L F
Sbjct: 193 GPGGLYASMGEEEFKSVLRDDLASLPGIKGVNNHMGSLLTTDSQAMNWVMQVIGDRSLFF 252

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV 359
            D  +S  ++   +A + ++     D++LD+     KI ++   L ++A   G AI +  
Sbjct: 253 VDSVTSADSVAYTMALRHSINTTKRDVFLDNIRSEKKIEQQFLKLIQLAHQNGHAIAIGH 312

Query: 360 AFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            + E++  +S+ L       V +VP+  L 
Sbjct: 313 PYPETMAYLSKRLADLSKLSVRLVPIDELM 342


>gi|197286993|ref|YP_002152865.1| exported polysaccharide deacetylase [Proteus mirabilis HI4320]
 gi|194684480|emb|CAR46240.1| putative exported polysaccharide deacetylase [Proteus mirabilis
           HI4320]
          Length = 321

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 98/231 (42%), Gaps = 5/231 (2%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A  A++AIV+   G  +      I  LP  +++A   N         +A  +G+E ++
Sbjct: 26  APAFSAKLAIVIDDFGY-RKKEDNQILQLPTAVSIAILPNSPHGKEMATKAHAQGREILI 84

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM    +   E D  TLK +    ++   ++ ++ R     G+ N+ G+ + S++++ 
Sbjct: 85  HMPMAPISKQPLEKD--TLKPSMDQAEINRIIQNAINRVPYAVGMNNHMGSAMTSDRQAM 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + K      L F D  +         A    +P +   ++LD+     + R++L    
Sbjct: 143 DRVIKALNHSDLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLNRAI 202

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            +AR  G AI +      ++  + Q L      D+ +V  S L    SP S
Sbjct: 203 NLARKNGFAIAIGHPHPSTVRALQQQLPLLPA-DIQLVAPSGLLT-PSPDS 251


>gi|300714671|ref|YP_003739474.1| conserved uncharacterized protein YigQ [Erwinia billingiae Eb661]
 gi|299060507|emb|CAX57614.1| conserved uncharacterized protein YigQ [Erwinia billingiae Eb661]
          Length = 302

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 42/227 (18%), Positives = 93/227 (40%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
               A   +++IV+   G  +   +  +  +P NI++A   N         +A + G E 
Sbjct: 10  MACTAHAGKLSIVIDDFGY-RPKEENQVLQMPKNISVAVLPNATHAREMATKAHQLGHEV 68

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E D  TL+   +  ++   +R ++       G+ N+ G+ + S+  
Sbjct: 69  LIHLPMAPLSKQPLEKD--TLRPDMSSSEIARIIREAVADVPFAVGLNNHMGSAMTSSLP 126

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +        F D  +   + +   A   ++  +   ++LDD  +   IR++   
Sbjct: 127 GMQKVMQVLDHYNFYFLDSMTIGNSQSTRAAAGTSVKVLKRRVFLDDTQNEADIRKQFTR 186

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +A+  G AI +      ++ V+ + L      DV++V  S L  
Sbjct: 187 AVRLAQRDGSAIAIGHPHPTTVRVLQEMLPTLPA-DVTLVRPSQLLN 232


>gi|39996868|ref|NP_952819.1| hypothetical protein GSU1769 [Geobacter sulfurreducens PCA]
 gi|39983756|gb|AAR35146.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
          Length = 290

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 53/271 (19%), Positives = 114/271 (42%), Gaps = 1/271 (0%)

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSG 179
            +     + P + ER  L   + E    ++        PA  +          +A+++  
Sbjct: 21  KQPVVQQTPPPVVERHKLPPREPEQPVAHEDYTGVIHHPAEPQRAQRPTGPGTLAVIIDD 80

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
           +G       RA+  +   +T A       + R  +EA+++G E ++ +PM+         
Sbjct: 81  MGKGLP-EARALMDIGIPLTFAIIPGLPKVRRVAEEARQRGIEVMVHLPMEPKGYPERRL 139

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLF 299
           ++  L ++Q   ++  R+   L       G  N+ G+    N++   V+     +RGL F
Sbjct: 140 EANGLLLSQGDDEIAGRVNGYLNEIPQAVGANNHMGSGFTENRQKMAVVMGVLKERGLFF 199

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV 359
            D  +SP ++   +A ++ +   V +++LD+  +   I  +L+    IAR  G AI +  
Sbjct: 200 VDSKTSPVSVGDAVAREMGVRTAVRNVFLDNIQESGYITNQLRQAASIARKRGNAIAICH 259

Query: 360 AFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +I+ ++  L +     ++ V +S L +
Sbjct: 260 PHPATIQTLAVELPRLRDEGITFVTVSRLVR 290


>gi|134299434|ref|YP_001112930.1| hypothetical protein Dred_1577 [Desulfotomaculum reducens MI-1]
 gi|134052134|gb|ABO50105.1| protein of unknown function DUF610, YibQ [Desulfotomaculum reducens
           MI-1]
          Length = 271

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 54/226 (23%), Positives = 95/226 (42%), Gaps = 3/226 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             +AIV+   G + T        L   IT+A   N  +     +EA K+G E IL  PM+
Sbjct: 41  PMLAIVIDDFGGADTHGVAQFMELKQPITVAVMPNLVNSKEHSEEAHKRGHEVILHQPME 100

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                 +      +K   + +++      +L       G  N+ G+ + SNK+    + +
Sbjct: 101 PLHGKDSWLGPGAIKSDMSYEEIKKVFLDNLATVPHAEGFNNHTGSKITSNKDKVAPMLE 160

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
               +GL   D  +S ++    +A  + +P++  D++LD+   +  I   LK    IA+ 
Sbjct: 161 VAKDKGLFVLDSRTSDKSQVIKVAKSMQVPWVKRDVFLDEVKSKAVITRNLKKACAIAKK 220

Query: 351 TGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            G AI +         + E + + L       V +VPLS + KL S
Sbjct: 221 QGYAISIGHVGPGGNVTAEAVKEALPLIEKEGVKLVPLSQVVKLKS 266


>gi|298505881|gb|ADI84604.1| divergent polysaccharide deacetylase domain protein [Geobacter
           sulfurreducens KN400]
          Length = 295

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 53/271 (19%), Positives = 114/271 (42%), Gaps = 1/271 (0%)

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSG 179
            +     + P + ER  L   + E    ++        PA  +          +A+++  
Sbjct: 26  KQPVVQQTPPPVVERHKLPPREPEQPVAHEDYTGVIHHPAEPQRAQRPTGPGTLAVIIDD 85

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
           +G       RA+  +   +T A       + R  +EA+++G E ++ +PM+         
Sbjct: 86  MGKGLP-EARALMDIGIPLTFAIIPGLPKVRRVAEEARQRGIEVMVHLPMEPKGYPERRL 144

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLF 299
           ++  L ++Q   ++  R+   L       G  N+ G+    N++   V+     +RGL F
Sbjct: 145 EANGLLLSQGDDEIAGRVNGYLNEIPQAVGANNHMGSGFTENRQKMAVVMGVLKERGLFF 204

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV 359
            D  +SP ++   +A ++ +   V +++LD+  +   I  +L+    IAR  G AI +  
Sbjct: 205 VDSKTSPVSVGDAVAREMGVRTAVRNVFLDNIQESGYITNQLRQAASIARKRGNAIAICH 264

Query: 360 AFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +I+ ++  L +     ++ V +S L +
Sbjct: 265 PHPATIQTLAVELPRLRDEGITFVTVSRLVR 295


>gi|332982318|ref|YP_004463759.1| hypothetical protein Mahau_1756 [Mahella australiensis 50-1 BON]
 gi|332699996|gb|AEE96937.1| protein of unknown function DUF610 YibQ [Mahella australiensis 50-1
           BON]
          Length = 267

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 98/236 (41%), Gaps = 8/236 (3%)

Query: 164 FCSNASGAR---IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           F + A   +   IAI++   G +  GT+  +  L   +T A   N    +     A   G
Sbjct: 29  FANAAHTPKTHYIAIIIDDFGNNGDGTKEMLE-LSIPLTAAVMPNLPYTEHDANMAHDAG 87

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
            E I+  PMQ  +   +      +       ++  R+   L +     G+ N+ G+    
Sbjct: 88  LEVIMHTPMQPINGKPSWLGPKGITTDLPDDEIKARINEGLEQIKWAIGMNNHMGSKATQ 147

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +K   + + +   +R + F D   +  ++   +A  LN+P +  D++LD+  ++  I+++
Sbjct: 148 DKRVMKSVLEIAKQRNMFFVDSKVTANSVIDEVASSLNVPCVSRDIFLDNSKNQHDIQKQ 207

Query: 341 LKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           L+ L  IA   G AIG+     E    + + I   +     R +    +S +  ++
Sbjct: 208 LEKLGNIAVEKGYAIGIGHVGPEGGVVTAKAIRTEIPLLEKRGIQFTYISKVVDIA 263


>gi|328545770|ref|YP_004305879.1| Divergent polysaccharide deacetylase family [polymorphum gilvum
           SL003B-26A1]
 gi|326415510|gb|ADZ72573.1| Divergent polysaccharide deacetylase family [Polymorphum gilvum
           SL003B-26A1]
          Length = 375

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 96/377 (25%), Positives = 166/377 (44%), Gaps = 12/377 (3%)

Query: 16  RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT--- 72
           ++ F+      +G   LF   I    ++I +     G     +                 
Sbjct: 3   KRKFFRLPFGLIG-AGLFTVMITTALVWIGVVDDPFGGEPIAVIPLEKTVEGLSSRDIAV 61

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
           + L  E    P   D +    Q          + Q                 +    T +
Sbjct: 62  VELKPEFADGPLGPDASRSARQGALGPRFEGAEAQG-------EAGSGEGPGVALSTTPD 114

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
            R+        L      G    +V A  +      S  +IAIV+ G+G+S+ G++ A++
Sbjct: 115 SRVTERTDYGLLPKIGDNGLRPLDVYAK-RVTAELGSTPKIAIVIGGIGLSEAGSRNALD 173

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
            LPA++TLA A  GN ++ WM+EA++ G E +LQ+P++ FD   N+   +TL V+    +
Sbjct: 174 SLPADVTLALAPYGNEIEGWMQEARQAGHELLLQLPLEPFDFPDNDPGPHTLLVSLRGAE 233

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
            ++RL + L R T Y GV+N+ GA   S + S + + +E  +RGL++ DDGSS R++ + 
Sbjct: 234 FMDRLTWLLSRTTNYVGVVNFMGARFSSTEASMQYLLEEVTRRGLMYVDDGSSSRSVAQP 293

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           +A     P+   D+ LD     D+I  +L  LE +AR  G A+    A   ++  ++ W 
Sbjct: 294 VASAAQTPFSKVDVVLDAVPKPDEINARLLQLEALARARGIAVAAGSALPVTVRQLADWS 353

Query: 373 QQEHVRDVSVVPLSCLA 389
           +    R + +VP+S   
Sbjct: 354 RDLEQRGLMLVPISATV 370


>gi|127514737|ref|YP_001095934.1| protein of unknown function DUF610, YibQ [Shewanella loihica PV-4]
 gi|126640032|gb|ABO25675.1| protein of unknown function DUF610, YibQ [Shewanella loihica PV-4]
          Length = 251

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 51/220 (23%), Positives = 97/220 (44%), Gaps = 4/220 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            A+++I++  +G  Q  T  A+  LP++ITL+   +    +R    A  KG E +L +PM
Sbjct: 18  AAQVSIIIDDIGYRQ--TDEAVLALPSDITLSVLPHTPLGERLAAIAHDKGHEIMLHLPM 75

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           QA +    E     L    + Q L   +  + +      GV N+ G++L         + 
Sbjct: 76  QALNGK--EMGPGGLTNQMSEQALKRAVDDAFKSVPYAKGVNNHMGSLLTQLDAPMTWLM 133

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +   ++   F D  ++  +     A +L +P +   L+LD+ V    +  +   L ++A 
Sbjct: 134 ESLKQQDNYFVDSMTTRYSKASDAANRLGIPLLRRQLFLDNDVSPQGLERQFNQLIQLAN 193

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             GQ I +A  + E+I  +   L +     +++V  S L 
Sbjct: 194 KEGQLIVIAHPYPETISFLKANLSRLSDEGIALVNTSRLL 233


>gi|315127791|ref|YP_004069794.1| hypothetical protein PSM_A2729 [Pseudoalteromonas sp. SM9913]
 gi|315016305|gb|ADT69643.1| hypothetical protein PSM_A2729 [Pseudoalteromonas sp. SM9913]
          Length = 250

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 96/230 (41%), Gaps = 4/230 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S     +IAIV+  +G  Q   +     LP  ++ +   +      +   A +  +E
Sbjct: 12  ATSSAVKAKQIAIVIDDIGYHQRDLE--FLSLPGQLSYSILPHTPYSQIFATLASQSNKE 69

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +L +PMQA +          L +     QL   L  +L       GV N+ G+ L    
Sbjct: 70  LLLHVPMQALNGKKL--GPGALTLNMDKAQLQQTLGNALASLPQVKGVNNHMGSALTQQS 127

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           ++ +   +   KR L F D  ++  +  +  A  L +  +   ++LD+    ++++ +L+
Sbjct: 128 QAMKWTMEVLKKRQLYFLDSRTTELSQAQNAANFLGVENISRHVFLDNITTTEQLQLRLE 187

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            L+  A     AI +A  + E+I+ +   L Q   +   +VP+S L +  
Sbjct: 188 ELKSKATKYQFAIAIAHPYPETIDFLRHALPQLSEQGFELVPVSQLVERK 237


>gi|298530220|ref|ZP_07017622.1| protein of unknown function DUF610 YibQ [Desulfonatronospira
           thiodismutans A