BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780558|ref|YP_003064971.1| hypothetical protein
CLIBASIA_02225 [Candidatus Liberibacter asiaticus str. psy62]
         (396 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780558|ref|YP_003064971.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040235|gb|ACT57031.1| hypothetical protein CLIBASIA_02225 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 396

 Score =  343 bits (881), Expect = 2e-92,   Method: Composition-based stats.
 Identities = 396/396 (100%), Positives = 396/396 (100%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY
Sbjct: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
           SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT
Sbjct: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
           RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL
Sbjct: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD
Sbjct: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
           SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF
Sbjct: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA
Sbjct: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS
Sbjct: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396


>gi|15966920|ref|NP_387273.1| hypothetical protein SMc03784 [Sinorhizobium meliloti 1021]
 gi|307301692|ref|ZP_07581451.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           BL225C]
 gi|15076193|emb|CAC47746.1| Hypothetical transmembrane protein [Sinorhizobium meliloti 1021]
 gi|306903390|gb|EFN33979.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           BL225C]
          Length = 400

 Score =  309 bits (792), Expect = 4e-82,   Method: Composition-based stats.
 Identities = 137/411 (33%), Positives = 203/411 (49%), Gaps = 29/411 (7%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIIS--RLGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           M+ DLN PL +   +  +    +    R     L    ++G+S +  +S           
Sbjct: 1   MATDLNAPLGQNRKESPARKRDLGRVLRYCGLGLGALAVIGISAWSALS----------- 49

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVV 116
           P    R  A +P      +  + +PS          L    +     +++ ++  G TV 
Sbjct: 50  PGHQTRSPA-MPAATEATLATEPAPSSEGQGNGPGALHRSGALSGAHVEDVLTDDGATVR 108

Query: 117 NKPTRSTSIDSLPTIE-------ERLILGLSKKELLAKNKVGREDTEVPAMDKN------ 163
               RS        I+       +  +  L  + LL     GR     P   +       
Sbjct: 109 KYTPRSRETGGPALIDVEATRGQDPRMAALPNESLLEDRPEGRLPVIGPDGLRPMEQYAR 168

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E 
Sbjct: 169 PWSGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEI 228

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQ+PM+ FD + N+   + L+V+    + L  L  S+ + T Y GVMNY G   LSN +
Sbjct: 229 LLQVPMEPFDYATNDPGPHALRVSSDAGKNLAELHRSMGQITNYTGVMNYLGGRFLSNAD 288

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E + ++  KRGLLF DDG+S ++L+  LA    +P+  ADL LD ++ R+ +  +L  
Sbjct: 289 ALEPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFEVPHGFADLVLDGELSRNAVLRRLDE 348

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           LE IAR  G AIGVA AFDES+  I++W ++   R + VV ++ L K    
Sbjct: 349 LERIARRNGTAIGVASAFDESVAAIAEWFEEAGGRGIEVVGVAALVKDPKQ 399


>gi|307316285|ref|ZP_07595729.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           AK83]
 gi|306898125|gb|EFN28867.1| protein of unknown function DUF610 YibQ [Sinorhizobium meliloti
           AK83]
          Length = 400

 Score =  309 bits (791), Expect = 5e-82,   Method: Composition-based stats.
 Identities = 137/411 (33%), Positives = 204/411 (49%), Gaps = 29/411 (7%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIIS--RLGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           M+ DLN PL +   +  +    +    R     L    ++G+S +  +S           
Sbjct: 1   MATDLNAPLGQNRKESPARKRDLGRVLRYCGLGLGALAVIGISAWSALS----------- 49

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVV 116
           P    R  A +P      +  + +PS          L    +     +++ ++  G TV 
Sbjct: 50  PGHQTRSPA-MPAATEATLATEPAPSSEGQGNGPGALHRSGALSGAHVEDVLTDDGATVR 108

Query: 117 NKPTRSTSIDSLPTIE-------ERLILGLSKKELLAKNKVGREDTEVPAMDKN------ 163
               RS        I+       +  +  L  + LL     GR     P   +       
Sbjct: 109 KYTPRSRETGGPALIDVEATRGQDPRMAALPNESLLEDRPEGRLPVIGPDGLRPMEQYAR 168

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E 
Sbjct: 169 PWSGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEI 228

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQ+PM+ FD + N+   + L+V+    + L  L  S+ + T Y GVMNY G   LSN +
Sbjct: 229 LLQVPMEPFDYATNDPGPHALRVSSDAGKNLAELHRSMGQITNYTGVMNYLGGRFLSNAD 288

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E + ++  KRGLLF DDG+S ++L+  LA    +P+  ADL LD ++ R+ +  +L+ 
Sbjct: 289 ALEPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFEVPHGFADLVLDGELSRNAVLRRLEE 348

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           LE IAR  G AIGVA AFDES+  I++W ++   R + VV ++ L K    
Sbjct: 349 LERIARRNGTAIGVASAFDESVAAIAEWFEEAGGRGIEVVGVAALVKDPKQ 399


>gi|85713722|ref|ZP_01044712.1| hypothetical protein NB311A_04259 [Nitrobacter sp. Nb-311A]
 gi|85699626|gb|EAQ37493.1| hypothetical protein NB311A_04259 [Nitrobacter sp. Nb-311A]
          Length = 400

 Score =  309 bits (791), Expect = 6e-82,   Method: Composition-based stats.
 Identities = 110/405 (27%), Positives = 184/405 (45%), Gaps = 23/405 (5%)

Query: 2   SIDLNHPLRKKT-PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           + DL+ PL + + P+R+  +   + +   FLL    +V L  ++  +H  +G     +  
Sbjct: 5   TEDLSMPLGQNSAPRRRLRFPFTLPQAAGFLLGSILVVFL-GFVFFNHDPLGGE--PVAR 61

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
            VIR                  P+ +  ++     ++ + Q    I +  SG        
Sbjct: 62  VVIRHTPVSDEKSAA-----TRPASQQPDSAAVATRSATGQKTITIIDGSSGSRQDVVVA 116

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG---------- 170
              S  +    E         + LL K++ G          K F + A G          
Sbjct: 117 GPDSDAADARSEAAATGIH--QRLLEKSRYGMIPVVAADGLKAFKAYAMGTEADRAKAAT 174

Query: 171 -ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
              +AIVVSGLGI  T T  AI  LP+ +TLAF    +   + +++A+ +  E +LQ+PM
Sbjct: 175 MPVVAIVVSGLGIGTTKTIDAIMKLPSAVTLAFTPYSSDPGKLVEQARAQHHEVLLQLPM 234

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +  D   N+    TL  T    Q ++RL + L R  GY G+ N+ GA  ++   + + I 
Sbjct: 235 EPHDYPDNDPGPQTLLTTLGTDQNIDRLHWQLSRFQGYVGLTNFMGARFVTAVAAMQPII 294

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +E AKRGL + DDG++P ++   LA    +P++ ADL +D      +I + L  LEE+A+
Sbjct: 295 REAAKRGLGYLDDGTAPTSVAGQLAKGQAMPFIKADLTIDAVPTSVEIDKTLARLEELAK 354

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
             G A+G+  A   SI+ +  W++    R V +VPL + + K  S
Sbjct: 355 GRGTAVGMTSALPVSIDRVGAWIKGLESRGVMLVPLTTAMLKSKS 399


>gi|209551457|ref|YP_002283374.1| hypothetical protein Rleg2_3886 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209537213|gb|ACI57148.1| protein of unknown function DUF610 YibQ [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 397

 Score =  308 bits (789), Expect = 8e-82,   Method: Composition-based stats.
 Identities = 129/402 (32%), Positives = 187/402 (46%), Gaps = 26/402 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M  DL+ PL +           +        L    I G S+Y                 
Sbjct: 1   MGTDLHAPLGRNRKAGSRRPGVLRLGRIAASLCLFAIGGFSLYTAFRGD----------- 49

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNK 118
             +    P          +   P     N   + +     +    ++  ++G    V   
Sbjct: 50  -GLERTKPPAEQAATPPSNTPQPPTTTANQAADGMPRAEPRSGANVEQMVTGDGSVVTKY 108

Query: 119 PTRSTSIDSLPTIEE------RLILGLSKKELLAKNKVGREDTEVPAMDKN------FCS 166
             R         ++         +     + LL     GR     P   +         S
Sbjct: 109 SPRPRDGSGPVLVDAMQIGQDPRMAAQPNEALLEDTPFGRLPIVGPDGRRPMDQYARPSS 168

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A G RIAIVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +LQ
Sbjct: 169 GARGVRIAIVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEILLQ 228

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +P++ FD   N+    TL  T+ V + +  L  ++   T Y GVMNY G   LS+  + E
Sbjct: 229 VPLEPFDYPANDPGPETLLTTKPVARNIENLHKAMGEITNYTGVMNYLGGRFLSDSTAME 288

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + ++  KRGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  LE 
Sbjct: 289 PVMRDIGKRGLLFLDDGTSAQSKTADVAKGTELPYAFADLQLDGQLDINAVLKKLDELER 348

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IAR  GQAIGVA AFDES++ I++W ++  +R + +V ++ L
Sbjct: 349 IARKNGQAIGVASAFDESVDAIAKWSEEAAMRGIEIVGVAAL 390


>gi|241206894|ref|YP_002977990.1| hypothetical protein Rleg_4210 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860784|gb|ACS58451.1| protein of unknown function DUF610 YibQ [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 398

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 128/402 (31%), Positives = 187/402 (46%), Gaps = 25/402 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M  DL+ PL +     +     +        L    I G S+Y       +         
Sbjct: 1   MGTDLHTPLGRNRKTGRKRPGFLRLGRIAASLCLFAIGGFSLYTAFRGDGLE-------- 52

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNK 118
              R   P          +   P         + +     +    ++  ++G    V   
Sbjct: 53  ---RTKPPAAEQAAPPPANTPQPPTATTGQTADGMPRADPRSGANVEQMVTGDGSVVTKY 109

Query: 119 PTRSTSIDSLPTIEE------RLILGLSKKELLAKNKVGREDTEVPAMDKN------FCS 166
             R         ++         +       LL +   GR     P   +         S
Sbjct: 110 SPRPRDGGGPVLVDAMQIGQDPRMAAQPNDALLEETPFGRLPIVGPDGRRPMDQYARPSS 169

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A G RIAIVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +LQ
Sbjct: 170 GARGVRIAIVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEILLQ 229

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +P++ FD   N+    TL  T+   + +  L  ++   T Y GVMNY G   LS+  + E
Sbjct: 230 VPLEPFDYPANDPGPETLLTTKPAARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAME 289

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + ++  KRGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  LE 
Sbjct: 290 PVMRDIGKRGLLFLDDGTSAQSKTAAIAKGTELPYAFADLQLDGQLDINAVLKKLDELER 349

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IAR  GQAIGVA AFDES++ I++W ++  +R + +V ++ L
Sbjct: 350 IARKNGQAIGVASAFDESVDAIAKWSEEAAMRGIEIVGVAAL 391


>gi|92116147|ref|YP_575876.1| protein of unknown function DUF610, YibQ [Nitrobacter hamburgensis
           X14]
 gi|91799041|gb|ABE61416.1| protein of unknown function DUF610, YibQ [Nitrobacter hamburgensis
           X14]
          Length = 401

 Score =  306 bits (783), Expect = 4e-81,   Method: Composition-based stats.
 Identities = 111/405 (27%), Positives = 182/405 (44%), Gaps = 22/405 (5%)

Query: 2   SIDLNHPLRKKT-PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           + DL+ PL +   PKR+      + +    LL    +V +  ++L +H  +G        
Sbjct: 5   TDDLSTPLGQNPAPKRRFRLPFTLPQAAAVLLGSILVVFV-GFVLFNHDPLGGE--PAAR 61

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
             IR+                 P+ +  +      + ++ +    I +  SG        
Sbjct: 62  IAIRQTVAPEDKSAAV-----PPASQPTSAAAVTAQPEAGRKTITIIDGSSGSRQDVVVA 116

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG---------- 170
            + S  +        + G+    LL K++ G          K F + A+G          
Sbjct: 117 GADSDTAGGGAAPVTMAGI-DPRLLEKSRYGMIPAVAADGLKPFKAYATGTDADRAKAAT 175

Query: 171 -ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
              IAIVV GLG+    T  AI  LP  +TLAF   G+   + +++A+ +  E +LQ+PM
Sbjct: 176 MPVIAIVVGGLGVGAAKTADAIMKLPPAVTLAFTPYGSDPGKLVEQARAQRHEILLQVPM 235

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           + +D   N+    TL  T   +Q ++RL + L R  GY G+ N+ GA  ++     + I 
Sbjct: 236 EPYDYPDNDPGPQTLLTTLGTEQNIDRLHWHLSRFQGYVGLANFMGARFVAAATVMQPII 295

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +E AKRGL + DDGS+PR++   LA    +P+  ADL +D      +I + L  LE++A+
Sbjct: 296 REAAKRGLGYLDDGSTPRSVAGQLAEGQAMPFAKADLTIDAVPTSVEIDKALARLEDLAK 355

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
             G AIG+A A   S+E I  W +    R V +VPL + + K  S
Sbjct: 356 ERGAAIGMASALPVSVERIGAWAKGLESRGVMLVPLTTEMLKSKS 400


>gi|222087889|ref|YP_002546427.1| hypothetical protein Arad_4893 [Agrobacterium radiobacter K84]
 gi|221725337|gb|ACM28493.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 400

 Score =  305 bits (781), Expect = 8e-81,   Method: Composition-based stats.
 Identities = 135/402 (33%), Positives = 198/402 (49%), Gaps = 26/402 (6%)

Query: 1   MSIDLNHPLRKKT-PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           M  DL+ PL +   P RK         L  F L    I   S+Y  +    +      + 
Sbjct: 1   MGTDLHAPLGQNRGPDRKRRRPPFGRILAGFCL--IAIASFSLYSALLRDTLQKTPPPVE 58

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
            +      P   T P    D+ S ++ D  +  N  +               G  V    
Sbjct: 59  TAEKTAPTPPADTRPAA-ADQPSLTEVDPQSGANTSR----------IVTSDGSVVTMFS 107

Query: 120 TRSTSIDSLPT------IEERLILGLSKKELLAKNKVGREDTEVPAMDK------NFCSN 167
             +               ++  +     + LL  +  G+     P+  +         S 
Sbjct: 108 PTARDGSGPVLINANQIGQDPRMAATPNESLLEDSPFGKLPITAPSGLRSMDQYARPWSG 167

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A G R+AIVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E ++Q+
Sbjct: 168 ARGTRVAIVVSGLGLSQTGTQRAIEKLPEEITLAFAASGNSLQRWMQEARRGGHEILIQV 227

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           P + FD   N     TL  +Q+  + ++ L  ++ + T Y GVMNY G   LSN ++ + 
Sbjct: 228 PFEPFDYPSNNPGPETLLTSQSAAKNIDNLHKAMGKITNYTGVMNYLGGRFLSNTDALQP 287

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + ++  KRGLLF DDGSS ++ +  +A  L  P+  AD+ LD ++ +D I +KL  LE I
Sbjct: 288 VMRDIGKRGLLFLDDGSSAQSKSGTVAKALETPHAFADMQLDGELQQDAILKKLDELERI 347

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           AR  G AIGVA AFDESI+ IS+W Q+  +R + +V +S LA
Sbjct: 348 ARRNGTAIGVASAFDESIDAISKWSQEAAMRGIEIVAVSALA 389


>gi|90421691|ref|YP_530061.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB18]
 gi|90103705|gb|ABD85742.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB18]
          Length = 412

 Score =  302 bits (773), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 112/409 (27%), Positives = 176/409 (43%), Gaps = 19/409 (4%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           M+ D L+ PL +K P+++ F         +  L    ++  + + L +    G     + 
Sbjct: 1   MTTDELSAPLGQKRPRKRKFRLPFSGTQAIATLLGLVLLAFAGFALFNDNPQGGE--PMV 58

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKND----SSQHDGQIQNDISGKTV 115
              IR             +        D     +  K        Q    I +  SG   
Sbjct: 59  RMAIRPQPAADKPAAPETDKAAKAESHDGAAGGSHDKAAHVEVPGQKTVTIIDGSSGARQ 118

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVP----------AMDKNFC 165
                      +   +   + +G+  ++LL K++ G                 A + +  
Sbjct: 119 QVVVPGGGGDTAASDVAPAITVGI-DQKLLEKSRYGMIPMVADGVKPFNAYATAGEADRA 177

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
             A    IAIVV GLG+    T  AI  LPA +TLAF   G+   + ++ A+ +  E +L
Sbjct: 178 KAARMPSIAIVVGGLGVGAAKTNDAIMKLPAAVTLAFTPYGSDPAKLVERARAQRHEVLL 237

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           QIPM+ FD   N+    TL  T   +Q ++RL + L R  GY G+ N+ G   ++ + + 
Sbjct: 238 QIPMEPFDYPDNDPGPQTLLTTLPSEQNIDRLYWHLSRFQGYIGITNFMGGRFVTTEPAL 297

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + I +E AKRGL + DDG SPR +  +LA    LP+  ADL +D      +I   L  LE
Sbjct: 298 QPIVREAAKRGLGYLDDGQSPRGVAALLATTQTLPFGKADLSIDVVPTALEIDRALYRLE 357

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
            +AR  G AIG+A A   SIE I+ W +    R + +VPL + + K  S
Sbjct: 358 SLARDNGNAIGMASALPISIERIATWSRSLEGRGLLLVPLTTAMLKSKS 406


>gi|239832921|ref|ZP_04681250.1| protein of unknown function DUF610 YibQ [Ochrobactrum intermedium
           LMG 3301]
 gi|239825188|gb|EEQ96756.1| protein of unknown function DUF610 YibQ [Ochrobactrum intermedium
           LMG 3301]
          Length = 406

 Score =  301 bits (772), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 115/408 (28%), Positives = 179/408 (43%), Gaps = 26/408 (6%)

Query: 4   DLNHPLR--KKTPKRKSFYSQIIS--RLGLFLLFCTFIVGLSIYILISHAFVG---TISE 56
           DLN PL   KK  KR    S+        L ++    + G +++ +      G   T + 
Sbjct: 3   DLNSPLGLDKKPQKRGGLRSRAFRSSMKALAVVAGLCLAGGAVFAIWQTNQAGFRKTETA 62

Query: 57  MIPYSVIREIA------PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDI 110
            +  +     A      P     P      +    +    +     +  +          
Sbjct: 63  AVEPAQPEAPAVKPVMKPATGNTPPPGSALRGVGGQPGPAIIKVTPDMPTGMPNVAAGTA 122

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN------F 164
            G  VV + T  +  D       + +  L +  L+ ++  G          +        
Sbjct: 123 DGNVVVVQNTHQSGQD-------QRVAHLPEPALVEQSSTGPLPVRGADGLRPMDAYAVG 175

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A GARIA+V+ GLG+SQTG+  AI+ LP  +TL FA  GNSL RWM+ A++ G E +
Sbjct: 176 WSGARGARIALVIGGLGLSQTGSMEAIDKLPQEVTLGFAPQGNSLQRWMQAARQNGHELV 235

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQ+PM+ FD         TL V    ++    L ++L R T Y GVMNY GA   S  E 
Sbjct: 236 LQLPMEPFDYPRVNPGRNTLTVGDGAKKNEASLLWALSRMTNYAGVMNYMGARFTSETEV 295

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +RGL + DDG+S R+    +A    +P+  AD+ +D   +R  I ++L  L
Sbjct: 296 FSPVLGEIGRRGLYYLDDGTSARSEADRIASSDAVPFAAADVLIDAAQERGAILDRLDEL 355

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           E IAR  G AIG   AF  +++ ++ W  +   R + +VP+S L +  
Sbjct: 356 ERIARANGSAIGTGSAFAVTVDAVAAWANEVKKRGIEIVPVSALVRDP 403


>gi|299135455|ref|ZP_07028645.1| protein of unknown function DUF610 YibQ [Afipia sp. 1NLS2]
 gi|298589863|gb|EFI50068.1| protein of unknown function DUF610 YibQ [Afipia sp. 1NLS2]
          Length = 392

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 109/406 (26%), Positives = 175/406 (43%), Gaps = 25/406 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M+ DL+ PL + TP+++ F     +   +  +   F++    + +     +G        
Sbjct: 1   MTDDLSAPLGQTTPRKRRFRLPFTAPQAIATVCGLFLLAFLGFAIFGRDPMGGEP---VV 57

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
               + A +P             S   +          S Q    I +  SG+    K  
Sbjct: 58  VAKYDPAKLPGAD---------HSAIPSAAPVAPAAAPSGQKTVTIIDGSSGERREMKVG 108

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG---------- 170
              +   L      ++ G+  + LL  ++ G          K +   ASG          
Sbjct: 109 DDGTPAGLDADTPAMMSGI-NQRLLENSRYGMVPI-AADGLKPWRVYASGTDLQRARAAT 166

Query: 171 -ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
              I+IV+ GLG+    T  AI  LPA +TLAF   G+   + ++ A+ +  E +LQ+PM
Sbjct: 167 TPTISIVIGGLGVGAAKTNDAIVKLPAAVTLAFTPYGSDPGKLVERARARKHEVLLQLPM 226

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           + +D   N+    TL  T   +Q ++RL + + R  GY G+ N+ G+  L    + + I 
Sbjct: 227 EPYDYPDNDPGPQTLLATAGPEQNVDRLMWLMSRFQGYVGLTNFMGSRFLVTDSAMQPII 286

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           ++ AKRGL + DDGS PR+L   LA    +P   AD  LD      +I + L  LE +AR
Sbjct: 287 QQAAKRGLAWLDDGSVPRSLAGQLAGAQGVPTATADAVLDQVPTAAEIDKSLMKLETLAR 346

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             G A+G+A A   SIE I  W Q+   R + +VPL+     S  S
Sbjct: 347 ERGSAVGMASALPISIERIGAWAQRLESRGILLVPLTTTLMKSKSS 392


>gi|75674648|ref|YP_317069.1| hypothetical protein Nwi_0450 [Nitrobacter winogradskyi Nb-255]
 gi|74419518|gb|ABA03717.1| Protein of unknown function [Nitrobacter winogradskyi Nb-255]
          Length = 400

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 109/407 (26%), Positives = 183/407 (44%), Gaps = 23/407 (5%)

Query: 2   SIDLNHPLRKKT-PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           + DL+ PL +   P+R+      + +    LL    +V L  ++  +H  +G   +    
Sbjct: 5   TDDLSTPLGQNPAPRRRLRLPFSLPQATGLLLGSILVVFL-GFVFFNHDPLGGEPKARVA 63

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
                 AP+    P  I        +  ++      + + Q    I +  SG       +
Sbjct: 64  IRQ---APVSDDKPTAIRPPP----QQPDSAAVTAPSANGQKTITIIDGSSGSRQDVVVS 116

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG---------- 170
                D+      + ++G+  + LL K++ G          K F + A+G          
Sbjct: 117 G-PGPDAADAGSAKAVVGV-DQRLLEKSRHGMIPVAAADGLKPFKAYAAGTEADRAKAAK 174

Query: 171 -ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
              +AIVV GLG+  T T  AI  LP  +TLAF   G+   R + +A+ +  E +LQ+PM
Sbjct: 175 MPVVAIVVGGLGVGATKTTDAIMKLPPAVTLAFTPYGSDPGRLVAQARAQRHEVLLQVPM 234

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           + +D   N+    TL  T   +Q ++RL + L R  GY G+ N+ GA  ++     +   
Sbjct: 235 EPYDYPDNDPGPQTLLTTLGAEQNIDRLHWQLSRFQGYVGLTNFMGARFVAAAAVMQPFM 294

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            E A+RGL + DDG++P ++   LA    +P+  ADL +D      +I + L  LE++A 
Sbjct: 295 HEAARRGLGYLDDGAAPLSVAGRLAEGQAMPFARADLIVDAVPTSVEIDKALARLEDLAM 354

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
             G AIG+  A   S++ I  W++    R V +VPL+  A L S S+
Sbjct: 355 KRGVAIGMTSALPVSVDRIGVWIKSLESRGVMLVPLTT-AMLKSKST 400


>gi|153008397|ref|YP_001369612.1| hypothetical protein Oant_1063 [Ochrobactrum anthropi ATCC 49188]
 gi|151560285|gb|ABS13783.1| protein of unknown function DUF610 YibQ [Ochrobactrum anthropi ATCC
           49188]
          Length = 407

 Score =  300 bits (769), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 120/409 (29%), Positives = 183/409 (44%), Gaps = 27/409 (6%)

Query: 4   DLNHPLR--KKTPKRKSFYSQIISRL--GLFLLFCTFIVGLSIYILISHA---FVGTISE 56
           DLN PL   KK  KR    S+       GL +L    + G +++ +  +    F  T + 
Sbjct: 3   DLNSPLGLDKKPQKRGGSRSRAFRSFMTGLVILGGLCLAGGAVFAIWQNNQAAFRKTETA 62

Query: 57  M-------IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                    P +   E  P+    P      +  S +    +     +      G     
Sbjct: 63  AVDPTQIEAPVANKTEAKPVTGNTPPPGSALRGASGQPGPAIIKVTPDMPPGMPGAATGM 122

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN------ 163
             G  VV + T  +  D         +  L ++ L+ ++  G          +       
Sbjct: 123 AEGNVVVVQNTHQSGQDK-------RVAHLPEQALVEQSPTGPLPVRGADGLRPMDAYAA 175

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A GARIAIV+ GLG+SQTG+  A++ LP  +TL FA  GNSL RWM+ A++ G E 
Sbjct: 176 GWSGARGARIAIVIGGLGLSQTGSMEAVDKLPPEVTLGFAPQGNSLQRWMQAARQNGHEL 235

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQ+PM+ FD         TL V     +    L ++L R T Y GVMNY GA   S  E
Sbjct: 236 VLQLPMEPFDYPRINPGRNTLTVDDGASKNQAFLLWALSRMTNYAGVMNYMGARFTSETE 295

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   +  E  KRGL + DDG+S R+    +A    +P+  AD+ +D   +R  I ++L  
Sbjct: 296 AFSPVLGEIGKRGLYYLDDGTSARSQADRIAGSDAVPFAAADILIDAAQERGAILDRLDE 355

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           LE  AR  G AIG   AF  +++ +++W  +   R + +VP+S L +  
Sbjct: 356 LERTARANGSAIGTGSAFAVTVDAVAEWANEVKKRGIEIVPVSALVRDP 404


>gi|227823692|ref|YP_002827665.1| hypothetical protein NGR_c31780 [Sinorhizobium fredii NGR234]
 gi|227342694|gb|ACP26912.1| hypothetical protein NGR_c31780 [Sinorhizobium fredii NGR234]
          Length = 401

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 133/411 (32%), Positives = 195/411 (47%), Gaps = 28/411 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLL--FCTFIVGLSIYILISHAFVGTISEMI 58
           M  DLN PL +   KR           G   L  F   I GLS +               
Sbjct: 1   MGTDLNAPLGQGLKKRPPRKRNPRRMFGYAFLGVFSLAIAGLSGWAAF-----------A 49

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS--GKTVV 116
           P S++R  AP           ++  S          L+   ++    ++  ++  G TV 
Sbjct: 50  PDSLLRTEAPGTSVETPQASTERPASPTKPKVAGGSLRQSGARSGAHVEEMLTDDGATVT 109

Query: 117 NKPTRSTSIDSLPT-------IEERLILGLSKKELLAKNKVGREDTEVPAMDKN------ 163
               RS   D            ++  +  L  ++L+     GR     P   +       
Sbjct: 110 KYTPRSRDGDGPALISAGPMRGQDPRMAALPNEDLIEDTPQGRLPIVGPDGLRPMDQYAR 169

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A G RI +VV GLG+SQTGTQRAI  L   +TLAFA+ GNSL RWM++A++ G E 
Sbjct: 170 PWSGARGTRIGLVVGGLGLSQTGTQRAIRDLAPEVTLAFAAAGNSLQRWMQDARRDGHEI 229

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +LQIPM+ FD   N    + L V++   + L  L  S+ + T Y G+MNY G   LS  +
Sbjct: 230 LLQIPMEPFDYPDNAPGPHALLVSRGATKNLAELHRSMGQITNYTGIMNYLGGRFLSEAD 289

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + E + ++  KRGLLF DDG+S ++L+  L+    +P+  ADL LD ++ R+ I  KL  
Sbjct: 290 ALEPLMRDLGKRGLLFLDDGTSAQSLSGTLSGAFGVPHGFADLVLDSELSRNAILRKLDE 349

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           LE +AR  G AIGVA AFDES+  I++W+++   R +  V +S +      
Sbjct: 350 LERVARRNGTAIGVASAFDESVATIAEWMEEAGGRGIEFVGISAVVNDPQQ 400


>gi|192288598|ref|YP_001989203.1| hypothetical protein Rpal_0165 [Rhodopseudomonas palustris TIE-1]
 gi|192282347|gb|ACE98727.1| protein of unknown function DUF610 YibQ [Rhodopseudomonas palustris
           TIE-1]
          Length = 412

 Score =  299 bits (765), Expect = 5e-79,   Method: Composition-based stats.
 Identities = 104/413 (25%), Positives = 169/413 (40%), Gaps = 21/413 (5%)

Query: 2   SIDLNHPLRKKTPK----RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           + +L+ PL +K  +    R        ++ G+  L   F++    + L  +   G    +
Sbjct: 3   ADELSTPLGQKRNRWQRLRHYRLPFNATQ-GIAALLGLFVLTFLGFALFGNDPFGGEPVV 61

Query: 58  IPYSVIREIAPIPLTIPLNI----EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
                                   + + + +           +  + Q    I +   G 
Sbjct: 62  RVEIKASPDEAKQAAAEAGKDQGGKPENAAAAGAEKKDAEPKEAAAGQKTITIIDGSKGT 121

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM----------DKN 163
                   + S D                +LL +++ G        +          D +
Sbjct: 122 RQDVVV-GTDSPDKAEPPAGPTTSDGINPKLLEQSRYGMIPVMAGGLKPFSAYAMTTDAD 180

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                    + IVV GLGI    T  A+  LPA + LAF   G+   +   EA+ K  E 
Sbjct: 181 RAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAAVALAFTPYGSDPGKLATEARAKRHEV 240

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ILQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + 
Sbjct: 241 ILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEP 300

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + I ++ AKRGL + DDG++PR++   LA  L +P+  ADL +D       I + L  
Sbjct: 301 AMQAIIRDAAKRGLGYLDDGTAPRSVAGTLAKSLAIPFARADLTIDQVPAGADIDKSLAR 360

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           LE IA+  G A+G+A A   +IE I  W +    R + + PL+  A L S SS
Sbjct: 361 LESIAKERGSAVGMASALPVTIERIVNWSKSLESRGILLAPLTT-AMLKSKSS 412


>gi|86747385|ref|YP_483881.1| hypothetical protein RPB_0259 [Rhodopseudomonas palustris HaA2]
 gi|86570413|gb|ABD04970.1| Protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris HaA2]
          Length = 405

 Score =  297 bits (761), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 113/408 (27%), Positives = 175/408 (42%), Gaps = 15/408 (3%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           MS D L+ PL +K  + + F         +  L   F++    + L +   +G     I 
Sbjct: 1   MSADELSTPLGQKRSRLRRFRLPFTVTQAIATLLGLFLLAFVGFALFNDDPLGGE--PIA 58

Query: 60  YSVIREIAPIPLTIPLNIEDKQ-SPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNK 118
           +  ++   P          DK              +      Q    I +   G      
Sbjct: 59  HITLKPPTPDEAKEAAAAADKANGAKTEKTERAAAKDAALPGQKTITIIDGSKGTRQDVV 118

Query: 119 PTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM----------DKNFCSNA 168
            +      +     E  + G     LL +++ G       A+          D       
Sbjct: 119 VSAGNDDKADTPPAEPAMAGGINPRLLEQSRYGMIPVMAGALKPFSAYAMSTDAERAKAD 178

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               IAIVV+GLG+    T  A+  LP  +TLAF   G    + +++A+ K  E +LQIP
Sbjct: 179 RMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGADPGKLVEQARAKQHEVLLQIP 238

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + + + I
Sbjct: 239 MEPFDYPDNDPGPQTLLTSGAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEAAMQPI 298

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +E AKRGL + DDGS+PR++   LA  L +P+  ADL +D      +I + L  LE +A
Sbjct: 299 IREAAKRGLGYLDDGSAPRSVAPALAKSLAMPFARADLAIDSVPTGGEIDKALARLEGLA 358

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +  G AIG A A   SIE I  W +    R + +VPL+  A L S S+
Sbjct: 359 KERGLAIGTASALPLSIERIVSWSKSLESRGILLVPLTT-AMLKSKST 405


>gi|316931861|ref|YP_004106843.1| hypothetical protein Rpdx1_0469 [Rhodopseudomonas palustris DX-1]
 gi|315599575|gb|ADU42110.1| protein of unknown function DUF610 YibQ [Rhodopseudomonas palustris
           DX-1]
          Length = 412

 Score =  297 bits (760), Expect = 2e-78,   Method: Composition-based stats.
 Identities = 110/412 (26%), Positives = 167/412 (40%), Gaps = 19/412 (4%)

Query: 2   SIDLNHPLRKKTPK----RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           + +L+ PL +K  +    R        ++    LL    +  L  + + SH  +G    +
Sbjct: 3   ADELSTPLGQKRSRWQRLRHYRLPFNATQAIATLLGVFVLAFL-GFAIFSHDPLGGEPVV 61

Query: 58  IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVC--NQLKNDSSQHDGQIQNDISGKTV 115
                    AP                             +    Q    I +   G   
Sbjct: 62  RLEIPPAADAPKQAAAAPAKAPDGKAENAPAAGPDQHGGKQAAPGQKTITIIDGSKGTRQ 121

Query: 116 VNKP-TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVP----------AMDKNF 164
                  +      P     +       +LL +++ G                 A D   
Sbjct: 122 DVVVGADTADKSEPPGGASAVAADGINPKLLEQSRYGMIPVMAGGLKPFNAYAMATDAER 181

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                   + IVV GLGI    T  A+  LPA +TLAF   G+   +   EA+ K  E I
Sbjct: 182 AKAERMPTVTIVVGGLGIGAARTNDAVMKLPAPVTLAFTPYGSDPGKLATEARAKRHEII 241

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ + +
Sbjct: 242 LQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVATEPA 301

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + I ++ AKRGL + DDG++PR++   LA  L +P+  ADL +D       I + L  L
Sbjct: 302 MQAIIRDAAKRGLGYLDDGTAPRSVAGTLANSLAIPFARADLTIDQVPAGADIDKALTRL 361

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           E IA+  G AIG+A A   +IE I  W +    R + +VPL+  A L S SS
Sbjct: 362 ESIAKERGSAIGMASALPVTIERIVNWSKSLESRGIVLVPLTT-AMLKSKSS 412


>gi|39933247|ref|NP_945523.1| hypothetical protein RPA0170 [Rhodopseudomonas palustris CGA009]
 gi|39652872|emb|CAE25614.1| conserved hypothetical protein [Rhodopseudomonas palustris CGA009]
          Length = 412

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 105/415 (25%), Positives = 170/415 (40%), Gaps = 22/415 (5%)

Query: 1   MSID-LNHPLRKKTPK----RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTIS 55
           M+ D L+ PL +K  +    R        ++ G+  L   F++    + L  +   G   
Sbjct: 1   MAADELSTPLGQKRNRWQRLRHYRLPFNATQ-GIAALLGLFVLTFLGFALFGNDPFGGEP 59

Query: 56  EMIPYSVIREIAPIPLTIP----LNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
            +                        + + + +              + Q    I +   
Sbjct: 60  VVRVEIKAGPEEAKQAAAEAGKDQGGKPENAAAAGAEKKDAEPKDAAAGQKTITIIDGSK 119

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM----------D 161
           G         + S D                +LL +++ G        +          D
Sbjct: 120 GTRQDVVV-GTDSPDKAEPPAGPTTSDGINPKLLEQSRYGMIPVMAGGLKPFSAYAMTTD 178

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
            +         + IVV GLGI    T  A+  LPA + LAF   G+   +   EA+ K  
Sbjct: 179 ADRAKAERMPTVTIVVGGLGIGAARTNDAVMKLPAAVALAFTPYGSDPGKLATEARAKRH 238

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E ILQIPM+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++ 
Sbjct: 239 EVILQIPMEPFDYPDNDPGPQTLLTSSAPEQNLDRLNWHLSRIQGYVGLSNFMGARFVAT 298

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           + + + + ++ AKRGL + DDG++PR++   LA  L +P++ ADL +D       I + L
Sbjct: 299 EPAMQAVIRDAAKRGLGYLDDGTAPRSVAGTLAKSLAIPFVRADLTIDQVPAGADIDKSL 358

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
             LE IA+  G A+G+A A   +IE I  W +    R + + PL+  A L S SS
Sbjct: 359 ARLESIAKERGSAVGMASALPVTIERIVNWSKSLESRGILLAPLTT-AMLKSKSS 412


>gi|27375546|ref|NP_767075.1| hypothetical protein blr0435 [Bradyrhizobium japonicum USDA 110]
 gi|27348683|dbj|BAC45700.1| blr0435 [Bradyrhizobium japonicum USDA 110]
          Length = 407

 Score =  296 bits (757), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 111/407 (27%), Positives = 175/407 (42%), Gaps = 16/407 (3%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISR-LGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           + DL+ PL +   +RK       +    L +L   F+V  + + + +   +G     +  
Sbjct: 5   ADDLSAPLGQDKLRRKRRLRLPFTAMQALAMLLGLFLVTFAGFAIFNKDPLGGE--PMTR 62

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS-QHDGQIQNDISGKT--VVN 117
             IRE          +   + S  +  + T     +     Q    + +  +G    VV 
Sbjct: 63  IAIREPKATDEKPAASGHGQDSKQESKHETREAPKQAAPGEQKTVTMIDGSTGARHDVVI 122

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN--------FCSNAS 169
               +       +    ++ G+   +LL K++ G                        A 
Sbjct: 123 GAGEADDKGEAASAPPPVMAGI-DPKLLEKSRYGMIPVVADGSKPFNVYAADADRAKAAK 181

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
              +AIV+ GLG+    T  AI  LPA +TLAF   G+   +  + A+ +  E  LQIPM
Sbjct: 182 MPVVAIVIGGLGVGAAKTTDAIMKLPAAVTLAFTPYGSDPGKIAERARTQRHEIFLQIPM 241

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           + +D   N+    TL  + +  Q ++RL + L R  GY G+ N+ GA  ++   + + I 
Sbjct: 242 EPYDFPDNDPGPQTLLTSLSADQNMDRLYWHLSRMQGYAGITNFMGARFVATDAAMQPII 301

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +E AKRGL FFDDGSSPR++    A    +P+   D+ +D      +I   L  LE  AR
Sbjct: 302 REAAKRGLGFFDDGSSPRSIAPQAAASQAMPFGKGDIAIDVVPTPAEIDRALNKLESAAR 361

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
             G AIG A A   SIE I  W +    R + +VPL+  A L S SS
Sbjct: 362 ERGTAIGTASALPVSIERIGAWTKTLGDRGILLVPLTT-AMLKSKSS 407


>gi|163761381|ref|ZP_02168455.1| hypothetical protein HPDFL43_17685 [Hoeflea phototrophica DFL-43]
 gi|162281376|gb|EDQ31673.1| hypothetical protein HPDFL43_17685 [Hoeflea phototrophica DFL-43]
          Length = 418

 Score =  296 bits (757), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 120/411 (29%), Positives = 195/411 (47%), Gaps = 24/411 (5%)

Query: 1   MSIDLNHPLR---KKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           M  D++ PL    + + +R++  +   +      L    I+G + +I  S + +  +   
Sbjct: 1   MGNDIHKPLGTNTRPSAQRQARPASAWASRLAIGLVLLAILGSAGWIAFSSSQIERLGTS 60

Query: 58  IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVC------NQLKNDSSQHDGQI--QND 109
           +  S      P       + ++++  S    +         + L++   Q   ++    D
Sbjct: 61  VTASGPGSDTPPDTVDVASAQNQKEDSVSGQSGSGISGTSDDPLQSLHGQSGAEVVKTLD 120

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEER-------LILGLSKKELLAKNKVGREDTEVPAMDK 162
             G  +V         +    +           +  L    +L +  +G         ++
Sbjct: 121 DDGNEIVTITPLQRPDNRPVLLTPPGRVGQNPRLAHLPDPSVLEEAGIGDLPVRGENGER 180

Query: 163 N------FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
                    S A GAR+ I+V GLG+SQTGTQ AI  LP +ITLAFA+NGNSL RWM+EA
Sbjct: 181 PFDIYGRPWSGARGARVVIIVGGLGLSQTGTQHAIAALPEDITLAFAANGNSLQRWMQEA 240

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
           +++G E +LQIP + FD   N+    TL V    +  L+ L  S+ R T Y G+ N+ G 
Sbjct: 241 RREGHEILLQIPFEPFDYPANDPGPRTLTVEAGAEANLDNLHASMARITNYTGITNFMGG 300

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
             LS+ ++ E + ++ A RGL+F DDG+S ++LT   +  L +P+  AD+ LD   +R  
Sbjct: 301 RFLSDADALEPVMRDIADRGLMFLDDGTSAQSLTEPFSKTLGIPFAAADMVLDATQERGY 360

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           I  KL  LE  AR  G AIGVA AF+ S++ I+ W  +   R + +V  S 
Sbjct: 361 ILAKLDDLERSARRNGIAIGVASAFEVSVDAIASWANEAKARGIEIVSASA 411


>gi|150398212|ref|YP_001328679.1| hypothetical protein Smed_3017 [Sinorhizobium medicae WSM419]
 gi|150029727|gb|ABR61844.1| protein of unknown function DUF610 YibQ [Sinorhizobium medicae
           WSM419]
          Length = 399

 Score =  295 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 136/408 (33%), Positives = 199/408 (48%), Gaps = 26/408 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISR--LGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           M+ DLN PL +   +R++    +          L    I+GLS +  +            
Sbjct: 1   MATDLNAPLGQNRKERRAHKRDLRRLLRYSGLSLAAVAIMGLSAWSAL-----------F 49

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNK 118
           P  + R  A   +     + +  S      +    +     S  D +      G TV   
Sbjct: 50  PVPLTRSPAAPTVAEANPVAEASSSGAPVTSPSPLKRSGALSGADVEEVLTDHGATVRKY 109

Query: 119 PTRSTSIDSLPTIE-------ERLILGLSKKELLAKNKVGREDTEVPAMDKN------FC 165
             R         I+       +  +  L  + LL     GR     P   +         
Sbjct: 110 TPRPRETGGPAFIDVGSTRGQDPRMAALPNESLLEDRPEGRLPIIGPDGLRPMEQYARPW 169

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S A G RIAIVV GLG+SQTGTQRAI  LP  +TLAFA+ GNSL RWM+EA++ G E +L
Sbjct: 170 SGARGTRIAIVVGGLGLSQTGTQRAIRDLPPEVTLAFAAAGNSLQRWMQEARRDGHEILL 229

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           Q+PM+ FD   N+     L+V+   ++ L +L  S+ + T Y GVMNY G   LSN ++ 
Sbjct: 230 QVPMEPFDAPDNDPGPPALRVSADARENLAQLHRSMGQITNYTGVMNYLGGRFLSNADAL 289

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           E + ++  KRGLLF DDG+S ++L+  LA   ++P+  AD+ LD ++ R  I  +L  LE
Sbjct: 290 EPVMRDLGKRGLLFLDDGTSAQSLSGTLAGAFDVPHGFADVVLDSELSRSTILRRLDDLE 349

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            IAR  G AIGVA AFDES+  I++W+++   R + VV ++ L K   
Sbjct: 350 RIARKGGTAIGVASAFDESVTSIAEWIEEAGGRGIEVVGVAALVKDPK 397


>gi|116254417|ref|YP_770255.1| polysaccharide deacetylase protein [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115259065|emb|CAK10176.1| putative polysaccharide deacetylase protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 388

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 123/394 (31%), Positives = 184/394 (46%), Gaps = 27/394 (6%)

Query: 9   LRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAP 68
           + +           +        L    I G S+Y       +             E   
Sbjct: 1   MGRNRKTGSRRPGILRLGRIAASLCLFAIGGFSLYTAFRGDEL-------------ERTK 47

Query: 69  IPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNKPTRSTSID 126
            P           +P         + +     +    ++  ++G    V     R+    
Sbjct: 48  PPTGEQAATPPANTPQPPTAGQAADGMPRADPRSGANVEQMVTGDGSVVTKYSPRTRDGG 107

Query: 127 SLPTIEE------RLILGLSKKELLAKNKVGREDTEVPAMDKN------FCSNASGARIA 174
               ++         +     + LL +   GR     P   +         S A G RIA
Sbjct: 108 GPVLVDAMQIGQDPRMAAQPNEALLEETPFGRLPIVGPDGRRPMDQYARPSSGARGVRIA 167

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IVVSGLG+SQTGTQRAI  LP  IT AFA++GNSL RWM+EA++ G E +LQ+P++ FD 
Sbjct: 168 IVVSGLGLSQTGTQRAIAELPEEITFAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDY 227

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
             N+    TL  T++  + +  L  ++   T Y GVMNY G   LS+  + E + ++  K
Sbjct: 228 PANDPGPETLLTTKSAARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGK 287

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + + +KL  LE IAR  GQA
Sbjct: 288 RGLLFLDDGTSAQSKTAAIAKGTELPYAFADLQLDGQLDINAVLKKLDELERIARKNGQA 347

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IGVA AFDES++ I++W ++  +R + +V ++ L
Sbjct: 348 IGVASAFDESVDAIAKWSEEAAMRGIEIVGVAAL 381


>gi|190893932|ref|YP_001980474.1| hypothetical protein RHECIAT_CH0004369 [Rhizobium etli CIAT 652]
 gi|190699211|gb|ACE93296.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 388

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 127/394 (32%), Positives = 185/394 (46%), Gaps = 27/394 (6%)

Query: 9   LRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAP 68
           + +           +        L    I G S+Y       +             E A 
Sbjct: 1   MGRNRKTGSRRPGVLRLGRIAASLCLFAIGGFSLYTAFRGEGL-------------ERAK 47

Query: 69  IPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNKPTRSTSID 126
            P T     +    P     +   N +     +    ++  I+G    V     R     
Sbjct: 48  PPATEQAASQTLSKPPTATADQAANGMPRADPRSGANVEQMITGDGSVVTKYSPRPRDGS 107

Query: 127 SLPTIEE------RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA------RIA 174
               ++         +     + LL     GR     P   +     A  +      RIA
Sbjct: 108 GPVLVDAMQIGQDPRMAAQPNEALLEDTAFGRLPIVGPDGRRPMDQYARPSSGVRGIRIA 167

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD 
Sbjct: 168 IVVSGLGLSQTGTQRAIAELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDY 227

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
             N+    TL  ++ V + +  L  ++   T Y GVMNY G   LS+  + E + ++  K
Sbjct: 228 PANDPGPETLLTSKPVARNIENLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGK 287

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGLLF DDG+S ++ T  +A    LPY  ADL LD Q+D + I EKL  LE IAR  GQA
Sbjct: 288 RGLLFLDDGTSAQSKTATVAKGAELPYAFADLQLDGQLDINAILEKLDELERIARKNGQA 347

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IG+A AFDES++ I++W ++  +R + +V ++ L
Sbjct: 348 IGIASAFDESVDAIAKWSEEASMRGIEIVGVAAL 381


>gi|15890022|ref|NP_355703.1| hypothetical protein Atu2773 [Agrobacterium tumefaciens str. C58]
 gi|15157997|gb|AAK88488.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 399

 Score =  290 bits (741), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 132/405 (32%), Positives = 192/405 (47%), Gaps = 28/405 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           MS DL  PL  +  K      +    + L +L    I GLSIY  +S             
Sbjct: 1   MSSDLRKPLLGRQKKSAGINRRFSVIMLLSVLAVLSIGGLSIYTALS------------P 48

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQL--KNDSSQHDGQI--QNDISGKTVV 116
             +++ A  P   P   E     ++ D     +    +  S +    I       G  V 
Sbjct: 49  GNLQKTAAGPDGQPQLAEKAPEKAQVDVPAAGDTAGLQPQSGRSGANINRATLPDGNVVS 108

Query: 117 NKPTRSTSIDSLPT------IEERLILGLSKKELLAKNKVGREDTEVPAMDKN------F 164
               R    D           ++  +     +ELL +   G+         +        
Sbjct: 109 VYSPRPRDSDGPVLMSGQTYGQDPRMATRPNEELLEETAFGQLPVVGADGLRPMEQYARP 168

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL FA++GNSL RWM++A+++G E +
Sbjct: 169 WSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGFAASGNSLQRWMQDARREGHEIL 228

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           LQIP++ F          TL      +  ++RL  S+ + T Y GVMNY G   L+ + +
Sbjct: 229 LQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMAKITNYTGVMNYLGGRFLAEQSA 288

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            E + ++  KRGLLF DDGSS ++L+  +A  ++ P   AD+ LD +V    I  KL  L
Sbjct: 289 LEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQGFADVLLDGEVTEASILRKLDDL 348

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           E IAR  GQAIGVA AFDESI  IS+W ++   R + +V +S L 
Sbjct: 349 ERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEIVGVSALV 393


>gi|86359657|ref|YP_471549.1| hypothetical protein RHE_CH04079 [Rhizobium etli CFN 42]
 gi|86283759|gb|ABC92822.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 377

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 123/381 (32%), Positives = 186/381 (48%), Gaps = 25/381 (6%)

Query: 26  RLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSK 85
                 L    I G S+Y       +            R+  P              P++
Sbjct: 5   GRIAASLCLFAIGGFSLYTAFRGDGLE-----------RKKPPATEQAAAPSSSTPQPAQ 53

Query: 86  RDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNKPTRSTSIDSLPTIEE------RLIL 137
                  + +     +    ++  ++G    V     R         ++         + 
Sbjct: 54  TPAGQAADGMPRAEPRSGANVEQMVTGDGSVVTKYSPRPRDGSGPVLVDAMQIGQDPRMA 113

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKN------FCSNASGARIAIVVSGLGISQTGTQRAI 191
            L  + LL  +  GR     P   +         S A G R+AIVVSGLG+SQTGTQRAI
Sbjct: 114 ALPNETLLEDSAYGRLPIVGPDGRRPMDQYARPSSGARGVRVAIVVSGLGLSQTGTQRAI 173

Query: 192 NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQ 251
             LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ V 
Sbjct: 174 AELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKPVA 233

Query: 252 QLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
           + +  L  ++   T Y G++NY G   LS+  + E I ++  KRGLLF DDG+S ++ T 
Sbjct: 234 RNIENLHKAMGEITNYTGILNYLGGRFLSDPAAMEPIMRDIGKRGLLFLDDGTSAQSKTA 293

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
            +A    LPY  ADL LD Q+D + I +KL  LE +AR  GQAIG+A AFDES++ I++W
Sbjct: 294 DVAKGTELPYAFADLQLDGQLDVNAILKKLDELERVARKNGQAIGIASAFDESVDAIAKW 353

Query: 372 LQQEHVRDVSVVPLSCLAKLS 392
            ++  +R + +V ++ L+K  
Sbjct: 354 SEEASMRGIEIVGVAALSKDP 374


>gi|148252020|ref|YP_001236605.1| hypothetical protein BBta_0413 [Bradyrhizobium sp. BTAi1]
 gi|146404193|gb|ABQ32699.1| hypothetical protein BBta_0413 [Bradyrhizobium sp. BTAi1]
          Length = 407

 Score =  288 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 100/404 (24%), Positives = 168/404 (41%), Gaps = 14/404 (3%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRL-GLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           + +L+ PL +   +R+       + L  L +L   F+V  + + L     +G     I  
Sbjct: 5   ADELSAPLGQTEKRRRRRIRLPFTLLQALAVLLGLFLVVFAGFALFGDNPLGGE--PIAR 62

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
             I   A           D +  +  ++       ++   +    I +  SG        
Sbjct: 63  IAINAGAKPDDKSGAAKPDAKHGATAEHGAAAPAKQDGGDRKTVTIIDGSSGARQEVAIG 122

Query: 121 RSTSIDSLPTIEERLILGLS--KKELLAKNKVGREDTEVPAMDKNFC--------SNASG 170
              S  + P         +      LL K++ G        +               A  
Sbjct: 123 GGGSETAEPGAAAPAASQMPGVDPRLLEKSRYGMIPVMADGVKPFTAYAAEADRAKAARM 182

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             +AIV+ GLG+    T  AI  LP  +TLAF   G    +  + A+ +  E +LQ+PM+
Sbjct: 183 PAVAIVIGGLGVGAAKTVEAIMKLPPAVTLAFTPYGADPTKLAERARAQRHEILLQVPME 242

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            +D   N+    TL  T    Q ++RL + + R  GY G+ N+ GA  ++ + + + I  
Sbjct: 243 PYDYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIGNFMGARFVATEAAMQPIVN 302

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E AKRGL  FDDG++PR++   LA    +P+   D+ +D      +I   L  LE +A+ 
Sbjct: 303 EAAKRGLALFDDGAAPRSVAASLAAGRAMPFAKGDVAIDAVPTPVEIDNALAKLESLAKE 362

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
            G AIG A A   SI+ I  W++    + + +VPL + + K  S
Sbjct: 363 RGIAIGTASALPVSIDRIGAWIKGLDRKGILLVPLTTAMLKSKS 406


>gi|222150173|ref|YP_002551130.1| hypothetical protein Avi_4301 [Agrobacterium vitis S4]
 gi|221737155|gb|ACM38118.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 398

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 127/406 (31%), Positives = 192/406 (47%), Gaps = 22/406 (5%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           +S DL+  L +   KR++   +I     L       ++GLS+Y           +     
Sbjct: 3   LSADLHAALGQNRKKRRTGGPKISPFKALTASSSVALLGLSVYT----------TLTPLP 52

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
                       +   +  ++  +K    +   + +  +S    +      G  V     
Sbjct: 53  LRNPLPLATTPPVAAAVPAEEPAAKAPGPSRSMEARAPTSGATVERSTLPDGSVVTKYSP 112

Query: 121 RSTSIDSLPT------IEERLILGLSKKELLAKNKVGREDTEVPAMDKN------FCSNA 168
            S               ++  +      +LL     G+         +         S A
Sbjct: 113 ASRDGSGPALVTTPHVGQDPRVAATPNPDLLENTPEGQIPVTGRDGLRPVEQYARPWSGA 172

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
            G R+AIVVSGLG+SQTGTQRAI  LP  +TLAFA++GNSL RWM+EA++ G E +LQ+P
Sbjct: 173 HGTRVAIVVSGLGLSQTGTQRAIKHLPEQVTLAFAASGNSLSRWMQEARRGGHEILLQVP 232

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           ++      N+    TL+V +     L  L  ++   T Y G+MNY G   LS+  + + +
Sbjct: 233 LEPVGYPANDPGRGTLQVGRAATDNLRDLHRAMASMTNYTGLMNYMGGRFLSDSGAMDPV 292

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            ++ A RGLLF DDGSS R+LT   A  +N+P+ VADL LDDQ+    I ++L  LE IA
Sbjct: 293 MRDIAARGLLFLDDGSSARSLTATFAKAMNMPFSVADLQLDDQIQEQAILKRLDELERIA 352

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           R  G AIGVA AFDES+  I++W +    R + +V +S LA  +  
Sbjct: 353 RRNGSAIGVASAFDESVNAIAKWAEGAKARGIEIVGVSALAMEAQQ 398


>gi|209883750|ref|YP_002287607.1| protein of unknown function, YibQ [Oligotropha carboxidovorans OM5]
 gi|209871946|gb|ACI91742.1| protein of unknown function, YibQ [Oligotropha carboxidovorans OM5]
          Length = 390

 Score =  284 bits (726), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 100/405 (24%), Positives = 168/405 (41%), Gaps = 25/405 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M  D + PL +  P+R+ F     +   +  +   F++    + +     +G        
Sbjct: 1   MVDDFSAPLGQNAPRRRRFRLPFTAPQAIATVSGLFLLTFLGFAIFGRDPMGGE------ 54

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
                  PI        +   +                + Q    I +  SG+       
Sbjct: 55  -------PIVTATYDPAKLPGATQSAIPPAAPITAAAPNGQKTVTIIDGSSGQRREMVVG 107

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGRED----------TEVPAMDKNFCSNASG 170
              S D+    +   +     + LL  ++ G                 + D      A+ 
Sbjct: 108 AEGSTDTES--DTPALQTGINQRLLENSRYGLVPISADGLKPWRVYAASTDLQRARAATM 165

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             I++V+ GLG+    T  A+  LP  +TLAF   G+   + +  A+ +  E +LQ+PM+
Sbjct: 166 PTISLVIGGLGVGSAKTNDAVLRLPGAVTLAFTPYGSDPGKLIARARAQKHEVLLQVPME 225

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            +D   N+    TL  T + +Q ++RL + + R  GY G+ N+ G+  + +  + + I +
Sbjct: 226 PYDYPDNDPGPQTLLATASAEQNVDRLMWHMSRFQGYVGLANFMGSRFVVSDAAMQPIVQ 285

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E A+RGL +FDDGS PR+L   LA     P   ADL +D      +I + L  LE +AR 
Sbjct: 286 EAARRGLAWFDDGSVPRSLAGQLAGAQGAPSTTADLVIDQVPTSAEIDKNLAKLENLARE 345

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            G A+G+A A   SIE I  W Q+   R + +VPL+     S  S
Sbjct: 346 RGTAVGMASALPVSIERIGAWAQRLENRGILLVPLTTTLMKSKSS 390


>gi|115522300|ref|YP_779211.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisA53]
 gi|115516247|gb|ABJ04231.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisA53]
          Length = 403

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 114/406 (28%), Positives = 174/406 (42%), Gaps = 17/406 (4%)

Query: 1   MSID-LNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIP 59
           MS D L+ PL +K  +++ F     +   L   F  F+   + Y        G       
Sbjct: 1   MSTDELSTPLGRKPVRKRGFRLPFSAVQALAAAFALFLGLFAYYATFRENPTGGEPIARV 60

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
                +   +        E K  P+K ++            Q    I +  SG+      
Sbjct: 61  AI---KPEQLGGKAAAPAESKDKPAKSESAAKATPPAEAEGQRTVTIIDGTSGERKQVVV 117

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------- 170
              T+   +   E    +     +LL +++ G          K F + A+G         
Sbjct: 118 ASETAGAKIERDEAPTSVAGINPKLLEQSRYGAIPI-AADGLKPFAAYATGSDADRATAA 176

Query: 171 --ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               IAIVV GLG+    T  AI  LPA +TLAF   G+  +  +  A+ +  E +LQIP
Sbjct: 177 RLPTIAIVVGGLGVGAAKTADAIMKLPAAVTLAFTPYGSDPNGLVARARAQRHEVLLQIP 236

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ F+   N+    TL  + + +Q ++RL + L R  GY G+ N+ G   +    +   I
Sbjct: 237 MEPFEYPDNDPGPQTLLTSLSAEQNIDRLHWHLSRFQGYVGIANFMGGRFVITDTALSPI 296

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            KE AKRGL + DDG +PR+L   LA    +P+  ADL +D      +I + L  LE +A
Sbjct: 297 MKEAAKRGLGYLDDGQAPRSLASSLAAAQTVPFGKADLGIDAVPTALEIDKALSRLEALA 356

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
           R  G AIG A A   SIE I+ W +    R + +VPL + + K  S
Sbjct: 357 RENGNAIGTASALPVSIERIAAWAKSLQSRGLLLVPLTTAMLKSKS 402


>gi|83310908|ref|YP_421172.1| hypothetical protein amb1809 [Magnetospirillum magneticum AMB-1]
 gi|82945749|dbj|BAE50613.1| Uncharacterized protein conserved in bacteria [Magnetospirillum
           magneticum AMB-1]
          Length = 374

 Score =  282 bits (722), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 75/381 (19%), Positives = 151/381 (39%), Gaps = 25/381 (6%)

Query: 16  RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPL 75
           +   + +    +G+ +      VG+ + + +   + G   +  P    +E AP+ +  P 
Sbjct: 14  KVPLWERPSVLVGVMVAVLVLGVGIGLALGL---WSGKAGKAPPPGAEQEPAPVIMASPA 70

Query: 76  NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS---GKTVVNKPTRSTSIDSLPTIE 132
                   +  + +     L+    + D      +       VV          +     
Sbjct: 71  APSQPMPSAGDEPDDGRPLLQPPPPRPDPGSSEALEFGHASDVVALAPLPPPPPAPEVKL 130

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
                 +  +  L   K G +                   IAI++  LG+ +  ++R + 
Sbjct: 131 PPAGAAIWLRNALPVPKTGGKPV-----------------IAIIIDDLGVDRRRSER-MA 172

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
            L   +TL++ +    +     +A+ +G E ++ +PMQ    SY +  +  L+V  +  +
Sbjct: 173 QLKGPLTLSYMTYAEDVAHQSHDARARGHELMVHVPMQPQSASY-DPGAEVLEVGLSSDE 231

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
           +  RL + L R  GY G+ N+ G+   S+     V+  E  +RGL F D  +S R +   
Sbjct: 232 IRRRLDWGLSRFDGYVGINNHMGSRFTSDPAGMRVVMAELRRRGLAFIDSVTSERTVGAE 291

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
            A    +P+    ++LD+      +R +L   E  AR  G AI +    D +IE ++ WL
Sbjct: 292 TARHYGVPFAARHVFLDNDQGVAHVRAQLAKTEAYARKHGAAIAIGHPHDGTIEALAGWL 351

Query: 373 QQEHVRDVSVVPLSCLAKLSS 393
                R  ++VP+S + ++ +
Sbjct: 352 PGLEGRGFALVPVSTIIRMGN 372


>gi|146337569|ref|YP_001202617.1| hypothetical protein BRADO0424 [Bradyrhizobium sp. ORS278]
 gi|146190375|emb|CAL74371.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 405

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 98/402 (24%), Positives = 165/402 (41%), Gaps = 12/402 (2%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRL-GLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           + +L+ PL +   +R+       + L  L ++    +V  + + L     +G     +  
Sbjct: 5   ADELSAPLGQTETRRRRRIRLPFTALQALAMVLGLILVVFAGFALFGDNPLGGE--PVAR 62

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
             I E A          +       +  +      K D  +    I +  SG        
Sbjct: 63  VAINEGAKPGDKPDAAAKPDAKSDAKSEHGAAAAAKPDGERKTITIIDGSSGARQEVAIG 122

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------AR 172
                   P       +      LL K++ G        +       A            
Sbjct: 123 AGGRDTPEPGAAPANPMPGVDPRLLEKSRYGMIPVMTDGLKSFTAYAADADRAKAARMPA 182

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+ GLGI    T  AI  LP  +TLAF   G+   +  + A+ +  E +LQ+PM+ +
Sbjct: 183 VAIVIGGLGIGAAKTVDAIMKLPPAVTLAFTPYGSDPSKLAERARAQRHEILLQVPMEPY 242

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D   N+    TL  T    Q ++RL + + R  GY G+ N+ GA  ++ + + + I  E 
Sbjct: 243 DYPDNDPGPQTLLATLGPDQNIDRLFWHMSRLQGYVGIGNFMGARFVATETAMQPIVNEA 302

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           AKRGL  FDDG++PR++   LA    +P+   D+ +D      +I   L  LE +A+  G
Sbjct: 303 AKRGLALFDDGAAPRSVAASLATGRAVPFAKGDVAIDAVPTAVEIDNALAKLESLAKERG 362

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL-SCLAKLSS 393
            A+G A A   SI+ I  W++    + + +VPL + + K  S
Sbjct: 363 VAVGTASALPVSIDRIGTWIKGLDRKGILLVPLTTAMLKSKS 404


>gi|193084246|gb|ACF09908.1| uncharacterized protein [uncultured marine group III euryarchaeote
           KM3-28-E8]
          Length = 394

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 80/386 (20%), Positives = 140/386 (36%), Gaps = 36/386 (9%)

Query: 18  SFYSQIISRLGLFLLFCTFIVGLSIYILISHAF---VGTISEMIPYSVIR---------- 64
             +  ++    + L+       +  ++  +      +      +PY V+           
Sbjct: 26  RRFRLLVVTAFVVLVGIGLGAQIGNWLATAELPSAQIALEVREMPYQVVTRTYRRLAREY 85

Query: 65  EIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTS 124
           E+      +  N E        D         N         Q D+      +    S  
Sbjct: 86  ELTVPAKNLEPNFEPIAVARSWDFVAEVETRLNQGVGAPRHEQEDLELGMQKSTLPNSAP 145

Query: 125 IDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQ 184
                      + G+ +  + A                          IAIV+  LG+S 
Sbjct: 146 P------PPLRLGGMPQWMVNAVPPPI---------------TRGRPMIAIVMDDLGLSP 184

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
              +R I  LP  ITLAF     +L +  KE +  G E I+ + M+  D    +     L
Sbjct: 185 KRVRRTI-ALPGPITLAFLPYARNLRKLAKEGRAAGHELIIHMNMEPKDH-DIDPGPNAL 242

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
             +    ++  RL ++L +  GY GV N+ G+         EV+ +   +RGLL+FD  +
Sbjct: 243 LTSMDPMEIRERLLWALNQFDGYIGVSNHMGSRFTEWPNGMEVVIRALKRRGLLYFDSLT 302

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
           S +++   LA      Y   D++LD +     +  +L   E+IAR  G AI +   +D +
Sbjct: 303 STKSVGLTLARAHGTAYARRDVFLDHERFAKAVAWQLAQTEQIARRRGYAIAIGHPYDVT 362

Query: 365 IEVISQWLQQEHVRDVSVVPLSCLAK 390
            +V+  WL     R   +VPLS + +
Sbjct: 363 FDVLENWLPDAEARGFVMVPLSTIVR 388


>gi|218515367|ref|ZP_03512207.1| hypothetical protein Retl8_17560 [Rhizobium etli 8C-3]
          Length = 367

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 128/373 (34%), Positives = 183/373 (49%), Gaps = 27/373 (7%)

Query: 30  FLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNN 89
             L    IVG S+Y       +             E A  P T     +    P     +
Sbjct: 1   ASLCLFAIVGFSLYTAFRGEGL-------------ERAKPPATEQAASQTLSKPPTATAD 47

Query: 90  TVCNQLKNDSSQHDGQIQNDISGK--TVVNKPTRSTSIDSLPTIEE------RLILGLSK 141
              N +     +    ++  I+G    V     R         ++         +     
Sbjct: 48  QAANGMPRADPRSGANVEQMITGDGSVVTKYSPRPRDGSGPVLVDAMQIGQDPRMAAQPN 107

Query: 142 KELLAKNKVGREDTEVPAMDKNFCSNASGA------RIAIVVSGLGISQTGTQRAINLLP 195
           + LL     GR     P   +     A  +      RIAIVVSGLG+SQTGTQRAI  LP
Sbjct: 108 EALLEDTAFGRLPIVGPDGRRPMDQYARPSSGVRGIRIAIVVSGLGLSQTGTQRAIAELP 167

Query: 196 ANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLN 255
             ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ V + + 
Sbjct: 168 EEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKPVARNIE 227

Query: 256 RLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAP 315
            L  ++   T Y GVMNY G   LS+  + E + ++  KRGLLF DDG+S ++ T  +A 
Sbjct: 228 NLHKAMGEITNYTGVMNYLGGRFLSDPAAMEPVMRDIGKRGLLFLDDGTSAQSKTATVAK 287

Query: 316 KLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQE 375
              LPY  ADL LD Q+D + I EKL  LE IAR  GQAIG+A AFDES++ I++W ++ 
Sbjct: 288 GAELPYAFADLQLDGQLDINAILEKLDELERIARKNGQAIGIASAFDESVDAIAKWSEEA 347

Query: 376 HVRDVSVVPLSCL 388
            +R + +V ++ L
Sbjct: 348 SMRGIEIVGVAAL 360


>gi|163749815|ref|ZP_02157060.1| hypothetical protein KT99_01686 [Shewanella benthica KT99]
 gi|161330329|gb|EDQ01308.1| hypothetical protein KT99_01686 [Shewanella benthica KT99]
          Length = 256

 Score =  278 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S  + A++AI++  +G  Q  +  A+  LP NITL+   +    +     A ++G E +L
Sbjct: 15  SYVNAAQVAIIIDDIGYRQ--SDEAVLTLPDNITLSILPHTPLGNSVAHIAHERGYEVML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          +    +   +   +  +        G  N+ G++L    E  
Sbjct: 73  HLPMQALNGKK--LGPGGITNDMSETDIKQTISQAFENIPFAKGANNHMGSLLTQLDEPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + +   +  L F D  ++        A KL +P +   ++LD+ V    + ++ + L 
Sbjct: 131 QWVMESLKQHHLYFVDSMTTRYTKAGSTADKLGIPQLKRQIFLDNDVSPAGLNQQFERLI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            +A   GQ + +A    E+IE +   L +     +S+V  S L    
Sbjct: 191 ALAHRQGQVVAIAHPHPETIEYLKLNLPRLQQEGISLVKTSELLPYR 237


>gi|46201425|ref|ZP_00055095.2| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 373

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 78/389 (20%), Positives = 147/389 (37%), Gaps = 32/389 (8%)

Query: 16  RKSFYSQIISRLGLFLLFCTFIVGLSIYILI------SHAFVGTISEMIPYS--VIREIA 67
           +   + +    +GL +      VG+ + + +           G      P          
Sbjct: 6   KVPLWERPSVLVGLMIAVLVAGVGIGLVLGLWSGKSAKTQMAGAEQAPAPVISETTSPPP 65

Query: 68  PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDS 127
           P P     N E                  +  +   G   + +S      +P  S  +  
Sbjct: 66  PPPPLPSANEEADDGRPLLQPPPPRPDPGSSEALEFGHASDVVSLVPAPAQPPASPEVKL 125

Query: 128 LPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGT 187
            P      +     +  L   K G +                   IAI++  LG+ +  +
Sbjct: 126 PPAGAAVWL-----RNALPVPKTGGKPV-----------------IAIIIDDLGVDRRRS 163

Query: 188 QRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT 247
           +R +  L   +TL++ +    + R   +A+  G E ++ +PMQ    SY +  +  L+V 
Sbjct: 164 ER-MAQLKGPLTLSYMTYAEDVARQSHDARAHGHELMVHVPMQPQSASY-DPGAEVLEVG 221

Query: 248 QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPR 307
              +++  RL + L R  GY G+ N+ G+   S+     V+  E  +RGL F D  +S  
Sbjct: 222 LPPEEIRRRLDWGLSRFDGYVGINNHMGSRFTSDAAGMRVVMAELRRRGLAFIDSVTSEH 281

Query: 308 NLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
            +    A    +P+    ++LD+      +R +L   E  AR  G AI +    D +IE 
Sbjct: 282 TVGAETARHYGVPFAARHVFLDNDQGVAHVRAQLAKTEAYARKHGAAIAIGHPHDGTIEA 341

Query: 368 ISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           ++ WL     R  ++VP+S + ++ + +S
Sbjct: 342 LAGWLPGLEARGFALVPVSTIIRMGNGTS 370


>gi|77919271|ref|YP_357086.1| hypothetical protein Pcar_1672 [Pelobacter carbinolicus DSM 2380]
 gi|77545354|gb|ABA88916.1| conserved hypothetical protein [Pelobacter carbinolicus DSM 2380]
          Length = 395

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 70/393 (17%), Positives = 139/393 (35%), Gaps = 22/393 (5%)

Query: 13  TPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT 72
             KR+    Q        LL   F+VG  +  L+   FV            R     P  
Sbjct: 9   RRKRQPRKKQPDRTF-KVLLASLFLVGFLVVSLVLLTFVQRPPLPN-----RTPEVSPPV 62

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
                +   +  +    +V  +++    +                      S+       
Sbjct: 63  AKQPPDSADTRDQVLRTSVQIEIERALWRQGISFTGMDVVTDDHVMHYHLPSVYPGQAWY 122

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAM---------------DKNFCSNASGARIAIVV 177
           + L+  L K+    K         +  +                         ARIAIVV
Sbjct: 123 DGLVRALEKQSSRLKFAFADAPAPLVRVSVNGIPSFALHFKRSRSKPAKVRPKARIAIVV 182

Query: 178 SGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYN 237
             L        R +  +  ++T+A         +  + A + G+E ++ +PM+      N
Sbjct: 183 DDL-GRDLRMLRRLLAIDLDLTMAVMPEEPHTLQSAELAHRAGREVLVHMPMEPESYPRN 241

Query: 238 EDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGL 297
                 L + Q   ++  R+           G  N+ G+      E  +++F+   K GL
Sbjct: 242 NPGPGALLLGQDRLEIERRVTRMFENVPHAVGGNNHMGSRFTQYAEGLQIVFEVMKKNGL 301

Query: 298 LFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGV 357
            F D  +SP ++  + A +  +P +  D++LD+  + D I  +++   ++AR+ G+ + +
Sbjct: 302 FFVDSRTSPGSVAFLEARRARIPAVSRDIFLDNSQNVDAIARQIREAVKMARSRGKVVAI 361

Query: 358 AVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              + +++E + Q       +DV VVP+S L +
Sbjct: 362 CHPYPQTVEALQQEAAFLRQQDVEVVPVSRLLR 394


>gi|91975045|ref|YP_567704.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB5]
 gi|91681501|gb|ABE37803.1| protein of unknown function DUF610, YibQ [Rhodopseudomonas
           palustris BisB5]
          Length = 411

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 105/408 (25%), Positives = 177/408 (43%), Gaps = 14/408 (3%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
           + +L+ PL +K  + + F         +  L   F++G   + L ++  +G    +    
Sbjct: 5   ADELSTPLGQKRGRLRRFRLPFTITQAIATLLGVFLLGFLGFALFNNDPLGGEPTVQVMI 64

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKND--SSQHDGQIQNDISGKTVVNKP 119
                           +   + + +         K+     Q    I +   G       
Sbjct: 65  KPPAPDEKKEAAAPADKSSAAKAAKSEFAEAKDGKDAVQPGQKTITIIDGSKGTRQDVVV 124

Query: 120 TRSTSIDSLPTIEE-RLILGLSKKELLAKNKVGREDTEVPAM----------DKNFCSNA 168
           +  +  D +        +      +LL +++ G       A+          D +     
Sbjct: 125 SSGSGDDKVDAPPAEPAMANGINPKLLEQSRYGMIPVAAGALKPVSAYAMTTDADRAKAE 184

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               IAIVV+GLG+    T  A+  LP  +TLAF   G+   + +++A+ K  E +LQIP
Sbjct: 185 KMPTIAIVVTGLGVGAARTNDAVIKLPRAVTLAFTPYGSDPGKLVEQARAKQHEVLLQIP 244

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+ FD   N+    TL  +   +Q L+RL + L R  GY G+ N+ GA  ++   + + I
Sbjct: 245 MEPFDYPDNDPGPQTLLTSGAPEQNLDRLTWHLSRIQGYVGLSNFMGARFVATDAAMQPI 304

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +E AKRGL + DDGS+PR++   LA  L +P+  AD  +D      +I + L  LE +A
Sbjct: 305 IREAAKRGLGYLDDGSAPRSVAPSLAKSLAMPFARADSAIDAVPTAAEIDKALARLEALA 364

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +  G A+G A A   SIE I  W +    R + +VPL+ +A L S S+
Sbjct: 365 KERGSAVGTASALPVSIERIVSWSKSLESRGILLVPLT-MAMLKSKST 411


>gi|307942948|ref|ZP_07658293.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307773744|gb|EFO32960.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 385

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 101/386 (26%), Positives = 174/386 (45%), Gaps = 19/386 (4%)

Query: 4   DLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVI 63
           DL+ PL     +R       +  +G+  +F T      I+I I    +G     +     
Sbjct: 13  DLSAPLGLG-KRRFLRLPFGLIGIGIVSVFATV---ALIWIGIVDDPLGGEPTAV----- 63

Query: 64  REIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRST 123
                IPL+    +  +          +  +L     ++ G  +     + +  +   + 
Sbjct: 64  -----IPLSTADGLASRDIEVVEIRPAMDGELGPSLRKNGGDQRLGPRYELMDQEALNAA 118

Query: 124 SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF--CSNASGARIAIVVSGLG 181
           +       + R+     +       ++G E                AS  +IAIV++GLG
Sbjct: 119 AGGLPNYPDPRVS---ERTGFGFLPRIGSEGVRPLDAYARPFETEFASTPKIAIVITGLG 175

Query: 182 ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDS 241
           +S+ GTQ  ++ LPA+ TL  +  G +LDRW++ A+ KG E +L +PM+ FD   N+   
Sbjct: 176 LSEAGTQNVLDQLPADTTLGLSPYGANLDRWIQGARTKGHEIVLSLPMEPFDFPDNDPGP 235

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
           +TL V+ T  +L  RL + L R T Y GVM   GA   S + + +++ ++   RGL+F D
Sbjct: 236 HTLLVSLTQSELTERLTWLLTRITNYVGVMPEMGARYTSTRPTLQLLMEKLRDRGLMFVD 295

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF 361
           +G+S R++   +A +   P+   D+ LD     D+I  KL  LE IAR  G A+    A 
Sbjct: 296 NGTSSRSVADEIAEETTTPFSGVDVVLDAVPREDEINAKLLQLEGIARARGVAVATGSAL 355

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSC 387
             ++  I +W +    R + +VP+S 
Sbjct: 356 PVTVRQIEKWARDLEERGLLLVPVSA 381


>gi|117926782|ref|YP_867399.1| hypothetical protein Mmc1_3508 [Magnetococcus sp. MC-1]
 gi|117610538|gb|ABK45993.1| protein of unknown function DUF610, YibQ [Magnetococcus sp. MC-1]
          Length = 482

 Score =  276 bits (705), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 76/348 (21%), Positives = 130/348 (37%), Gaps = 2/348 (0%)

Query: 42  IYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQ 101
                S       + +          P         + K +P++ +         +    
Sbjct: 123 GVAADSQVEEEADTVLKATPSEASSEPATKAATDLEQAKPTPAELEEQPSVEIEADGEKG 182

Query: 102 HDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD 161
             G      +   V ++  ++   D      E     L ++ L            V    
Sbjct: 183 GLGPSATPATQPLVPSETAKAHGDDKSHPKSESKSDILYEEHLSEDLDKPEPPAVVEKKP 242

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
                ++   +IA+++  LG +  G  R I  LPA+ITLA    G    + +  A KKGQ
Sbjct: 243 VP-AKHSHMVKIAVIIDDLGYN-GGVGRGIVSLPADITLAVLPGGPYSRQLVNMAHKKGQ 300

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E IL  PMQ             L       ++   L ++L R     G+ N+ G+ L  N
Sbjct: 301 EIILHQPMQPQGYPRVNPGPGALLEGMDADEIAEVLNHNLERFPEVVGINNHMGSALTEN 360

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           +     + K   KR L F D  +SPR++    A    +P     ++LD++     I ++L
Sbjct: 361 RVIMNDVMKVLVKRELYFIDSRTSPRSVAYRAALSHGVPRAKRSVFLDNKRTVAAILKRL 420

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           +  EEIA+ +G AI +   +  +++ + QWL     R + VV  S L 
Sbjct: 421 QEAEEIAKRSGSAIAIGHPYGVTLQALKQWLPGLQARGIVVVRASNLL 468


>gi|157377603|ref|YP_001476203.1| protein of unknown function DUF610, YibQ [Shewanella sediminis
           HAW-EB3]
 gi|157319977|gb|ABV39075.1| protein of unknown function DUF610, YibQ [Shewanella sediminis
           HAW-EB3]
          Length = 253

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 50/226 (22%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A  +++AI++  +G  Q  +  A+  LP  +T +   +        K+A   G E +L 
Sbjct: 16  YAEASQVAIIIDDIGYRQ--SDEAVLSLPNTVTFSVLPHTPLGSEVAKKAHNMGHEIMLH 73

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQA +          L  T    +L + L  +        G  N+ G++L    E   
Sbjct: 74  LPMQALNGKT--MGPGGLTNTMDEAELKHTLEKAFDNIPYAKGANNHMGSLLTQLDEPML 131

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +   +R L F D  ++        A +L +P +   ++LD+ V +  + E+ + L  
Sbjct: 132 WVMESLKQRELYFVDSMTTRFTKASNKAEQLGIPLLRRQVFLDNDVSQSALEERFEHLIS 191

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +A   GQA+ +A  + E+I+ + + L +     + +V  S L    
Sbjct: 192 LAHKQGQAVAIAHPYPETIKFLKRNLHRLDKAGIELVKTSSLLPYK 237


>gi|294143080|ref|YP_003559058.1| hypothetical protein SVI_4309 [Shewanella violacea DSS12]
 gi|293329549|dbj|BAJ04280.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 256

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 97/227 (42%), Gaps = 4/227 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S  + A++AI++  +G     +  A+  LP NITL+   +          A ++G E
Sbjct: 12  FASSYVNAAQVAIIIDDIGYR--HSDEAVLSLPDNITLSVLPHTPLGRSVAHTAHQRGYE 69

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +L +PMQA +          +    +   +   ++          GV N+ G++L    
Sbjct: 70  VMLHLPMQALNGKK--LGPGGITNDMSEIDVKRIIQQDFESIPFAKGVNNHMGSLLTQLD 127

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           E    + +   ++ + F D  ++  +     A KL +P +   ++LD+ +    + ++ +
Sbjct: 128 EPMRWVMESLKQKQVYFVDSMTTRFSKAGSTAEKLGIPQLKRQIFLDNDLSPAALNQQFE 187

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            L  +A   GQ + +A  + E+IE +   L +     VS+V  S L 
Sbjct: 188 RLIALAHRQGQVVAIAHPYPETIEYLKLNLPRLQQAGVSLVKTSDLL 234


>gi|304392603|ref|ZP_07374543.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303295233|gb|EFL89593.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 408

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 116/407 (28%), Positives = 177/407 (43%), Gaps = 17/407 (4%)

Query: 3   IDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTIS----EMI 58
            DL+ P+    PK KS     +      ++    +VG   ++ +     G+      E  
Sbjct: 2   SDLHKPIGVD-PKSKSGGIGAVPVSIWLMVAALILVGSFTWLYLEGRDDGSQVVAVNEAG 60

Query: 59  PYSVIREIAPIPLTIPLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVN 117
             S     AP       +       P +   +   N + + S          +  +    
Sbjct: 61  QTSQTTAPAPATDQSTPSDNGGDDVPVEPKFDADGNIIIDLSKTKRLSPLEPLPDEPDGT 120

Query: 118 KPTRST-----SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN-----FCSN 167
                         +      R    +   + L  ++ GR         +        S 
Sbjct: 121 STPAKPQIAFQPRQNPAIQSARRNPWMPVPDNLEPSEFGRLPKVSGDGTRPLDIHSASSG 180

Query: 168 ASGA-RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           A GA RIA+V+ GLG+SQTGTQ AI  LP  ITLAF+  GNSL RWM+ A+++G E  LQ
Sbjct: 181 AVGANRIALVLGGLGLSQTGTQEAIKRLPEGITLAFSPQGNSLQRWMQAARREGHEVALQ 240

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+            TL    +    L  LR+SL R T Y  V+NY GA +LSN+ + E
Sbjct: 241 LPMEPLGYPTVNPGPQTLNSKVSKGANLKSLRWSLGRMTNYPVVINYLGAGMLSNRPALE 300

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            I +E   RGL   DDG+   +     A ++ LP   A + +D   D D+IR +L+ LE 
Sbjct: 301 PILQELRARGLGIVDDGTVQSSNLVTYANEMRLPNAKASIIIDRVRDADRIRAQLQTLEA 360

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +AR  G  I  A AF +++E++ +W +  + R + +VPLS L +  S
Sbjct: 361 VARQQGNVIATATAFPQTVEIVEEWAKTLNQRGILLVPLSNLVRDYS 407


>gi|319780956|ref|YP_004140432.1| hypothetical protein Mesci_1219 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166844|gb|ADV10382.1| protein of unknown function DUF610 YibQ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 392

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 110/395 (27%), Positives = 181/395 (45%), Gaps = 18/395 (4%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           +  D+  PL +     ++          +  +    + G+S  I +         E+   
Sbjct: 4   IGKDIERPLGQAVRPPRAAGKLSG-GAIMATVAVLVVAGISGAIALREKPFRKPQEVAVS 62

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
           +     A  P   P  +       +    +   Q+ +  ++      +      +V +  
Sbjct: 63  TPKVTAAAEPAAAPPALAPAAPKPEAPVKSGGPQIIHVQTEEG----DGPPKAAIVIRDP 118

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN------FCSNASGARIA 174
            +   +         +  +  K L+  ++ G          +         S   GAR+A
Sbjct: 119 STVGQNL-------KVAHIPDKALIEASETGPLPVRAADGRRPFDVYARPWSGGRGARVA 171

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IV+ GL +SQTGTQ AI  LPA +TLAFA  GNS+ RWM+ A++ G E ++Q+P++ FD 
Sbjct: 172 IVIGGLSVSQTGTQAAIAKLPAEVTLAFAPQGNSIGRWMQAARQSGHEIVMQVPLEPFDY 231

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
                   TL V  +  + L  L ++L R T Y GVMNY GA   ++  + E    E  K
Sbjct: 232 PKVNPGRNTLTVAASADENLKSLHWALSRTTNYTGVMNYMGARFSADAAAMEPFIAELGK 291

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGL + DDGSS R+L   LA K  +P++  D+ +D   DR +I +KL  LE  AR  G A
Sbjct: 292 RGLAYIDDGSSARSLAPDLALKDGVPFVAGDMAIDAVQDRGEILKKLDSLEATARAKGTA 351

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           +G+  AFD +++ +S W+ +   R + +VP+S +A
Sbjct: 352 VGIGSAFDLTVDTVSSWVVEAKKRGIEIVPISAVA 386


>gi|114706555|ref|ZP_01439456.1| hypothetical protein FP2506_12424 [Fulvimarina pelagi HTCC2506]
 gi|114537947|gb|EAU41070.1| hypothetical protein FP2506_12424 [Fulvimarina pelagi HTCC2506]
          Length = 386

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 117/399 (29%), Positives = 177/399 (44%), Gaps = 23/399 (5%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M    + PL+      +       + LGL  +    I                       
Sbjct: 1   MDAIFSQPLKANARSPRRSLRPTRADLGLGTVAVILIALSLYPAWFDR----IDRHPSDA 56

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKR-DNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
           S   E+A I       I   +  +K+ D +   N+     +              +  +P
Sbjct: 57  SGTVELAGIDQVATGGISSVRGTAKQIDIDAALNERARRETTE------------LPYQP 104

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA------SGARI 173
                 D     +   +  +     +  ++ G          + F           G R+
Sbjct: 105 ANMEVRDLGDMRQAISVAHMPDDAFIEDSEYGLLPVRAVDGRRPFDVYRGASPSRMGPRV 164

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           AIVV GLGISQ+GT  AI  LP+ +TLAFA+NGNSL RWM+EA++ G E +LQ+PM+   
Sbjct: 165 AIVVGGLGISQSGTLSAIRNLPSEVTLAFAANGNSLARWMQEARRGGHELLLQMPMEPVG 224

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
              N+    T+   Q   +  + +  SL + T Y GVMNY G  L S+  +      E A
Sbjct: 225 YPTNDPGDNTVTSEQMNAEDFSSVLASLGQMTNYVGVMNYLGGQLTSDASALHPFMSELA 284

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
           +RGL++ DDGSS R++   LA   ++P   ADL LDD  D  +I  +L  LE+IART G 
Sbjct: 285 RRGLMYLDDGSSARSVAVDLAETTSIPAGAADLVLDDVQDAGEISRRLDQLEQIARTRGH 344

Query: 354 AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           AIGVA AF+ +  VI  W+++   R ++V P+S + +  
Sbjct: 345 AIGVASAFETTTSVIGSWIREAERRGITVTPVSSVVRDP 383


>gi|325294144|ref|YP_004280008.1| hypothetical protein AGROH133_09217 [Agrobacterium sp. H13-3]
 gi|325061997|gb|ADY65688.1| hypothetical protein AGROH133_09217 [Agrobacterium sp. H13-3]
          Length = 373

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 115/372 (30%), Positives = 175/372 (47%), Gaps = 17/372 (4%)

Query: 30  FLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNN 89
            +L    ++ +    + +    G + +       +     P       +   +     N+
Sbjct: 1   MVLSALAVLTIGGLSVYTALSPGNLQKTASGPDTQ-----PQLAEDAPKTAAADVADPND 55

Query: 90  TVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPT------IEERLILGLSKKE 143
           T   + ++  S  +        G  V     R    D           ++  +       
Sbjct: 56  TAGLKPESGRSGANINRATMPDGNVVSVYSPRPRDSDGPVLMSGQTYGQDPRMATRPNDA 115

Query: 144 LLAKNKVGREDTEVPAMDKN------FCSNASGARIAIVVSGLGISQTGTQRAINLLPAN 197
           LL +   GR         +         S A G R+AIVV GLG+SQTG+Q+AI  LP  
Sbjct: 116 LLEETAFGRLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRELPPE 175

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           +TL FA++GNSL RWM+EA+++G E +LQIP++ F          TL      +  ++RL
Sbjct: 176 VTLGFAASGNSLQRWMQEARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRL 235

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
             S+ + T Y G+MNY G   LS + + E + ++  KRGLLF DD SS ++L+  +A  +
Sbjct: 236 HRSMAKITNYTGIMNYLGGRFLSEQAALEPVMRDIGKRGLLFLDDASSAQSLSGGIAKAI 295

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
           + P   AD+ LD +V    I  KL  LE IAR  GQAIGVA AFDESI  IS+W ++   
Sbjct: 296 SAPQGFADVLLDGEVTEATILRKLDELERIARRNGQAIGVASAFDESIAAISKWSREAGG 355

Query: 378 RDVSVVPLSCLA 389
           R + +V +S L 
Sbjct: 356 RGIEIVGVSALV 367


>gi|254470624|ref|ZP_05084027.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gi|211959766|gb|EEA94963.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
          Length = 387

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 100/384 (26%), Positives = 163/384 (42%), Gaps = 24/384 (6%)

Query: 26  RLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSK 85
            L    +         I+I I     G      P + I   + +    P +IE    P  
Sbjct: 4   GLIGVAIMTVIFTTGFIWIGIVDDPNGGE----PMATIELSSALDGVAPSDIEIVDLPDG 59

Query: 86  RD-----------NNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTI-EE 133
                        N    +     S Q    +++  SG T +    R    + L      
Sbjct: 60  SQLDLIEAEQFDANGVGPDGSYRPSRQLGSALKDQASGPTSLVDLARRVDYEGLDGGFSS 119

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA--------RIAIVVSGLGISQT 185
             +     ++LL  NK G      P   +   + A           RIAI+++G+G++  
Sbjct: 120 ESLSTEPIEQLLEPNKFGSLPKISPEGVRPLDAYARRPNPATLTQARIAILINGIGLNSD 179

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
            T +AI  LPA+I+L  +  G+ ++ WM+ A+  G E +LQ PM+ FD   N+    +L 
Sbjct: 180 MTIKAIEDLPADISLGLSPYGDDVNSWMESARLSGHEVLLQAPMEPFDYPDNDAGPQSLL 239

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
                +Q   RL + L + + Y G++N+ G    SN+        +   RGL++ DDGSS
Sbjct: 240 TNLDQKQNDERLSWVLGQTSNYVGLVNFMGDRFTSNETRMSEFLSKVRDRGLMYVDDGSS 299

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESI 365
           PR+    +A    +P++ ADL LD  +  + I  +L  LE IAR  G A+  A AF  ++
Sbjct: 300 PRSKAGQVAGTQKVPFVQADLVLDQNLSAEAIGTQLLELETIARQRGIAVATATAFPVTL 359

Query: 366 EVISQWLQQEHVRDVSVVPLSCLA 389
             +  W Q+   R +S+VP+S   
Sbjct: 360 NALEAWSQRLEERGLSLVPVSSAI 383


>gi|260466735|ref|ZP_05812921.1| protein of unknown function DUF610 YibQ [Mesorhizobium
           opportunistum WSM2075]
 gi|259029465|gb|EEW30755.1| protein of unknown function DUF610 YibQ [Mesorhizobium
           opportunistum WSM2075]
          Length = 392

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 116/397 (29%), Positives = 184/397 (46%), Gaps = 22/397 (5%)

Query: 1   MSIDLNHPLRK--KTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMI 58
           +  D+  PL +  + P+     S  +    + +L    +VG+S  I +         E+ 
Sbjct: 4   IGKDIERPLGQTVRVPRAAGKISAGVVASAIVVLA---VVGVSGAIALREKPFRKPQEVA 60

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNK 118
             +     A  P   P         ++    T   Q+ +  ++      +      +V +
Sbjct: 61  VSTPKVTAAAEPAAPPALAPAAVPKAQTPAKTGGPQIIHVQTEEG----DGPPKAGIVIR 116

Query: 119 PTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN------FCSNASGAR 172
              S   +         I  L  K L+  ++ G          +         S A GAR
Sbjct: 117 DPSSIGQNL-------KIAHLPDKALIEASETGPLPMRAADGRRPFDVYARPWSGARGAR 169

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AIV+ GL +SQTGTQ AI  LP  +TL FA  GNS+ RWM+ A++ G E ++Q+P++ F
Sbjct: 170 VAIVIGGLAVSQTGTQAAIAKLPPEVTLGFAPQGNSIGRWMQAARQGGHEIVMQVPLEPF 229

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           D         TL V  +  + L  L ++L R T Y GVMNY GA   ++  +      E 
Sbjct: 230 DYPSVNPGRNTLTVAASADENLKSLHWALSRTTNYTGVMNYMGARFSADATAMGPFMAEL 289

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            KRGL + DDGSS R+L   LA K  +P++  D+ +D   DR +I +KL  LE  AR  G
Sbjct: 290 GKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDMAIDAVQDRGEILKKLDSLEATARAKG 349

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            A+G+  AFD +++ +S W+ +   R + +VP+S +A
Sbjct: 350 FAVGIGSAFDLTVDTVSSWVAEAKKRGIEIVPISAVA 386


>gi|83593228|ref|YP_426980.1| hypothetical protein Rru_A1893 [Rhodospirillum rubrum ATCC 11170]
 gi|83576142|gb|ABC22693.1| Protein of unknown function DUF610, YibQ [Rhodospirillum rubrum
           ATCC 11170]
          Length = 432

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 80/409 (19%), Positives = 153/409 (37%), Gaps = 26/409 (6%)

Query: 5   LNHPLRKKTPKRKSFY-----SQIISRLGLFLLFCTFIVGLSIYILISHA---------- 49
           L+HP  +    R +F+        +  + L  L     +G ++  L              
Sbjct: 2   LDHPEDRGVLDRFAFFVARMAPLTLVLVALATLAVGLGIGFAVGRLAQGDKAAPPAPTAL 61

Query: 50  --FVGTISEMIPYSVIREIAPIPLTIPLNIEDK-QSPSKRDNNTVCNQLKNDSSQHDGQI 106
                            +  P PL  P        +       T     +  + +     
Sbjct: 62  AAIGPLPVAPAAGEAAHQYQPPPLPRPAETAPPLPADVAPPVQTAPAPSETPAGEKGALP 121

Query: 107 QN--DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
               D+               D     + ++   +    L    +      E   +    
Sbjct: 122 AEFRDLLASDGPGFVMEERLPDDAYVHKPQVKPTVKTAALAPVPRFPEGPAESSGLPWKT 181

Query: 165 CSNASG----ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
              A+G      IA+V+  +G+ +  T   +  L   +TLA+ +  + L   M+  +K G
Sbjct: 182 YGVAAGKWSKPAIALVIDDMGLDRVRT-EKVRKLAGPLTLAYLAYADGLAGQMRGGRKAG 240

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
            E ++ +PM+  D +        LKV  +  ++L RLR +L  G  + G+ N+ G+   +
Sbjct: 241 HEILMHMPMEPLD-AKVNPGPGALKVGLSDDEILTRLRRNLDGGAEFVGINNHMGSRFTA 299

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +     ++  E  KRGLL+ D  +S  ++   LA    +P++   ++LD+  D+  +  +
Sbjct: 300 DSRGMTLVMGELKKRGLLWLDSMTSANSVGLTLAEMAGVPHIGRTVFLDNLNDQAAVARQ 359

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           L  LE  AR  G A+G+    D +I  +S WL     + +++VP+S L 
Sbjct: 360 LAKLEAAARQHGVAVGIGHPRDGTIGALSVWLPALAAKGITLVPISALV 408


>gi|89094931|ref|ZP_01167862.1| hypothetical protein MED92_00710 [Oceanospirillum sp. MED92]
 gi|89080797|gb|EAR60038.1| hypothetical protein MED92_00710 [Oceanospirillum sp. MED92]
          Length = 277

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 55/227 (24%), Positives = 102/227 (44%), Gaps = 3/227 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               +AIV+  +G ++     AI  LP  IT AF  +        K A   G+E IL  P
Sbjct: 26  HQPVMAIVIDDIGDNRKKGLAAI-ELPGAITYAFLPHTPHSFELAKTAHFLGKEVILHAP 84

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+  +++        L       +L + L   L       G+ N+ G++L  ++E    I
Sbjct: 85  ME--NKAGLRLGPGALTHRHNTAELQHILGDGLDSIPYAVGMNNHMGSLLTEDREKMRDI 142

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +   +R + F D  ++ + +   +A +  +PY+V D++LD++ +   I  + K    +A
Sbjct: 143 MRVVKQRNMFFLDSMTTSKTVAWKVAHEYGIPYLVRDVFLDNRQEWGYIHNQFKQAVSLA 202

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            T G A+ +   + E++E +S+ L       + +V  S L  + S S
Sbjct: 203 VTQGHAVVIGHPYPETVEYLSEALPILEQLGIRLVTASELLAIRSRS 249


>gi|90418832|ref|ZP_01226743.1| possible divergent polysaccharide deacetylase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336912|gb|EAS50617.1| possible divergent polysaccharide deacetylase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 384

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 114/398 (28%), Positives = 168/398 (42%), Gaps = 26/398 (6%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M   L  PL            ++      F    T I+  S  I +       + +    
Sbjct: 4   MRGPLYQPLGLDLDDGVIRRRRLSGASIGFACAATMIIAGSTAIALFGQPQPRMVDRFAV 63

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
           +   E AP    +P +             +  +           ++++  S         
Sbjct: 64  AASPEPAPT--VVPASPAPVVREQLPVVISGSDTAPPPRGGVGFRVEDPQS--------- 112

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF------CSNASGARIA 174
                      +      +    L+  +  G      P   + +       S   G RIA
Sbjct: 113 ---------LRQNPSTAHMPDDALIEDSAYGPLPARAPDGRRPYDVYAGAWSGKPGTRIA 163

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IVV GLGISQTGT  AI  LP  +T  F+ +GNSLDRWM+EA++ G E +LQ+P++    
Sbjct: 164 IVVGGLGISQTGTLNAIGSLPPGVTFGFSPSGNSLDRWMQEARRSGHELVLQVPLEPVGY 223

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              +    TL V       L+ L  SL   T Y G+MNY G   ++   + E +  E  +
Sbjct: 224 PQVDPGEDTLTVDDAAAGDLSALHASLATITNYVGIMNYMGGRFVAEPAAMEALIAELGR 283

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGL+FFDD SS R++    A   ++P  V+DL +D   D   IR +L  LE IAR  G A
Sbjct: 284 RGLMFFDDASSLRSVAADTAQLQSVPAAVSDLSIDRSQDPADIRSQLDTLERIARAEGTA 343

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           IG A AFD S+  I++W+ +   R + +VPLS LA   
Sbjct: 344 IGFASAFDVSVATIAKWIGEARGRGIEIVPLSALANDP 381


>gi|116750484|ref|YP_847171.1| hypothetical protein Sfum_3062 [Syntrophobacter fumaroxidans MPOB]
 gi|116699548|gb|ABK18736.1| protein of unknown function DUF610, YibQ [Syntrophobacter
           fumaroxidans MPOB]
          Length = 430

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 66/388 (17%), Positives = 140/388 (36%), Gaps = 8/388 (2%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPI 69
           R K+       S+ +  L ++ L    +  L  +   +       +     S  +   P 
Sbjct: 40  RGKSFSAGMPRSRFLPLLTVWFLAVLALASLLYWNGGTEKPPPKPAANKATSTGQSSVPK 99

Query: 70  P-LTIPLNIEDKQSPSK---RDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSI 125
           P +  P   + +  P       +         +    +       +GK ++  P    S 
Sbjct: 100 PRMADPPAKQPEAGPVAGSRTPSPKGGEPGGKEPGTREPARTTAPAGKPLIEPPPPFHSR 159

Query: 126 DSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQT 185
           D      +       K + +  + +        A        A  A++AIV+   G +  
Sbjct: 160 DIPIDQPKEPAR---KPDSITLSALRPGVPPGTAPPPPSPVPAPVAKVAIVIDDFGQNL- 215

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
              +    +P  ++ A   N        + A    +E +L +PM+       +  S  L 
Sbjct: 216 EVAKKFLSIPLPLSFAILPNQRHTAEIAELAHAHHREVLLHLPMEPQGYPKMDPGSGALL 275

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
            + +  +L   L  +L     + GV N+ G+    N  S  V+  E   R L F D  ++
Sbjct: 276 TSMSRGRLRRTLLAALDSTPYFIGVNNHMGSKFTENTPSMRVVMSELRHRKLFFLDSATT 335

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESI 365
             ++   LA +  +P    D++LD  +  + ++ ++  L   A+  G A+ +    + ++
Sbjct: 336 GDSVGFALAREYGIPARKRDIFLDHTLTDEAVQSQVDQLIRKAKIEGTALAIGHPHEVTL 395

Query: 366 EVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           + + + + +    +V+VVP S L  + S
Sbjct: 396 KALIEGVDRFKEENVAVVPSSELMIVPS 423


>gi|144898156|emb|CAM75020.1| Protein of unknown function DUF610 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 222

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 63/218 (28%), Positives = 119/218 (54%), Gaps = 2/218 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           IA+V+  LG+ +  ++R +  LPA +TLA+ +  ++L    + A+++G E ++ +PMQ  
Sbjct: 2   IAVVIDDLGVDRKRSER-VTTLPAPLTLAWMTYADNLRPITQAARQRGHELMVHVPMQPQ 60

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
            ESY +     L+V    ++L  RLR+ L R  G+ G+ N+ G+   +++    V+  E 
Sbjct: 61  SESY-DPGPDVLEVGLPTEELRRRLRWGLSRFDGFVGINNHMGSRFTADRAGMNVVMDEI 119

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
             RGLLF D  ++ +++   LA +  +P+    ++LD+++    +R +L   E  AR  G
Sbjct: 120 RARGLLFLDSVTTQKSVAPDLARQYGVPFAARHVFLDNEMTVSAVRGQLAKTEAYARKYG 179

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AI +    D +IE ++ WL     +   +VP++ + K
Sbjct: 180 AAIAIGHPHDGTIEALAGWLPGLEAKGFVLVPVTTIVK 217


>gi|146291148|ref|YP_001181572.1| hypothetical protein Sputcn32_0037 [Shewanella putrefaciens CN-32]
 gi|145562838|gb|ABP73773.1| protein of unknown function DUF610, YibQ [Shewanella putrefaciens
           CN-32]
 gi|319428503|gb|ADV56577.1| protein of unknown function DUF610 YibQ [Shewanella putrefaciens
           200]
          Length = 247

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + + +   +IA+++  +G  Q  T  A+  LP  +TL+   +    +   K   +KG E 
Sbjct: 13  YVAPSYATKIALIIDDIGYRQ--TDEAVLSLPHTVTLSVLPHTPLGENLAKVGHRKGHEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +          L       ++   +  ++       G  N+ G++L     
Sbjct: 71  MLHLPMQAINGKA--LGPGGLTKGMDEAEIRANVSSAIANIPFAKGANNHMGSLLTQLDS 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  L F D  ++P +     A +L +P +   L+LD+ V +  + ++   
Sbjct: 129 HMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLGIPSLKRQLFLDNNVSKKALEKQFNL 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           +   A   G  + +A  + E+I  +   L       + +VP+S L  +
Sbjct: 189 MISNAHMQGSLVVIAHPYPETIRFLQANLPLLEAEGIDLVPVSDLLPI 236


>gi|56459342|ref|YP_154623.1| hypothetical protein IL0231 [Idiomarina loihiensis L2TR]
 gi|56178352|gb|AAV81074.1| Conserved protein [Idiomarina loihiensis L2TR]
          Length = 251

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 51/227 (22%), Positives = 105/227 (46%), Gaps = 4/227 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A  ++IAIV+  +G ++   + A+  LP NI+ A          +      + ++ +L 
Sbjct: 17  PAYASKIAIVIDDIGNNKNDLKAAL--LPGNISFAVLPYTPYARAFALRGHHQKKQILLH 74

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+A +   N      +       Q+  +L  +L       GV N+ G+ L       +
Sbjct: 75  MPMEAVE--NNRPGPGVVTADMNNAQIKLQLVDALDSIPYVTGVNNHMGSKLTQLHMPMQ 132

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +  A R L F D  +S  ++   +A +  +      ++LD+QVD   ++++ + L  
Sbjct: 133 AVMETLASRKLFFIDSRTSEFSVAEQMAGEFGVRTSHRHVFLDNQVDEPYLQQQFEQLLS 192

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           IA+  GQAIG+   + E++  + + L Q   + + +V +S L  +++
Sbjct: 193 IAKRQGQAIGIGHPYPETLSFLQKQLPQLQEQGIELVFVSELTTVAN 239


>gi|119475541|ref|ZP_01615894.1| hypothetical protein GP2143_17016 [marine gamma proteobacterium
           HTCC2143]
 gi|119451744|gb|EAW32977.1| hypothetical protein GP2143_17016 [marine gamma proteobacterium
           HTCC2143]
          Length = 282

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 54/220 (24%), Positives = 95/220 (43%), Gaps = 3/220 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A I ++V  +G S    QRAI  LP  I  AF             A ++ +E +L  PM 
Sbjct: 38  ANIVLIVDDMGNSLELGQRAI-NLPGAINYAFLPYSPHRVSLANIAFRQRKEVMLHAPMS 96

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                        L    + QQ L  L  +L       GV N+ G+++   ++    +  
Sbjct: 97  NLHSHPV--GQGGLTPNMSQQQFLQTLNTNLNSVPHVRGVNNHMGSLMTQLRQPMGWLMA 154

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              ++ L F D  ++P  + +  A KL +P +  D++LD++   D I  + + L  +A+ 
Sbjct: 155 ALKQQNLYFVDSRTTPLTVAKSTATKLGVPSLRRDIFLDNERQHDAIAMQFERLIALAKK 214

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           TG A+G+     E+++ + + L     R + +V  S   K
Sbjct: 215 TGIAVGIGHPHPETLKYLEKTLPTLEQRGIKLVLASQALK 254


>gi|120600823|ref|YP_965397.1| hypothetical protein Sputw3181_4041 [Shewanella sp. W3-18-1]
 gi|120560916|gb|ABM26843.1| protein of unknown function DUF610, YibQ [Shewanella sp. W3-18-1]
          Length = 247

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           + + +  A+IA+++  +G  Q  T  A+  LP  +TL+   +    +   K    KG E 
Sbjct: 13  YVAPSYAAKIALIIDDIGYRQ--TDEAVLSLPHTVTLSVLPHTPLGENLAKVGHSKGHEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +          L       ++   +  ++       G  N+ G++L     
Sbjct: 71  MLHLPMQAINGKA--LGPGGLTKGMDEAEIRANVSSAIANIPFAKGANNHMGSLLTQLDS 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  L F D  ++P +     A +L +P +   L+LD+ V +  + ++   
Sbjct: 129 HMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLGIPSLKRQLFLDNNVSKKALEKQFNL 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           +   A   G  + +A  + E+I  +   L       + +VP+S L  +
Sbjct: 189 MISNAHMQGSLVVIAHPYPETIRFLQANLPLLEAEGIDLVPVSDLLPI 236


>gi|261408347|ref|YP_003244588.1| hypothetical protein GYMC10_4558 [Paenibacillus sp. Y412MC10]
 gi|261284810|gb|ACX66781.1| protein of unknown function DUF610 YibQ [Paenibacillus sp.
           Y412MC10]
          Length = 293

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 41/235 (17%), Positives = 98/235 (41%), Gaps = 5/235 (2%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
                     ++A+++   G  Q GT+  +  LP  IT+A      +  +  + A ++G 
Sbjct: 51  SRSVQEKKPNKLAVIIDDFGNDQKGTEE-MLNLPVKITVAVMPFLPTSKKDAEAAHQQGH 109

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           + I+ +PM+      +      +  + T +++  R+  ++       G+ N+ G+ +  +
Sbjct: 110 DVIIHMPMEPKQGRSSWLGPGAILSSLTDEEIRKRMEEAIDSVPYAVGINNHMGSKVTGD 169

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           +    ++     +RGL F D  ++  ++   LA K  +P +  D++LDD      + ++L
Sbjct: 170 ERVMSIVLDVCRERGLFFVDSKTNYYSVVGKLAAKKGMPSISNDIFLDDVHTVQHVSKQL 229

Query: 342 KGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +   + A      I +         + + +   + +   + V  V +S L +  S
Sbjct: 230 QTAAQHAEERTSCIAIGHVGVYGIRTAKALKGTIPELQKK-VEFVGISDLVREHS 283


>gi|71278442|ref|YP_271042.1| hypothetical protein CPS_4393 [Colwellia psychrerythraea 34H]
 gi|71144182|gb|AAZ24655.1| conserved hypothetical protein [Colwellia psychrerythraea 34H]
          Length = 259

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 88/224 (39%), Gaps = 4/224 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A   ++AIV+  +G     T +    LP  IT AF  +     +   +A     + +
Sbjct: 25  QSIAQANQVAIVIDDMGYRY--TDKHALTLPGAITYAFLPHTTYGKKLAMQANSTNHDVL 82

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + IPM++ +          L      Q     L  S        G+ N+ G+ L    + 
Sbjct: 83  IHIPMESENRKK--LGPGALTSNMDEQAFSQSLTKSFAEIPFAIGINNHMGSYLTQLYQP 140

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
                    +  L F D  +SP +  +  A    +P     ++LD+++    I ++ K L
Sbjct: 141 MAWTMTFLKQHDLFFLDSKTSPHSQAQQAAIDFGVPVKARHIFLDNELTEKYISQQFKQL 200

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              A+    AI +A    E++  +++ +    +  + +VPLS L
Sbjct: 201 IHFAQKHQTAIAIAHPHPETVATLNKLIPTLKLHGIELVPLSRL 244


>gi|170729198|ref|YP_001763224.1| hypothetical protein Swoo_4880 [Shewanella woodyi ATCC 51908]
 gi|169814545|gb|ACA89129.1| protein of unknown function DUF610 YibQ [Shewanella woodyi ATCC
           51908]
          Length = 251

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 97/233 (41%), Gaps = 4/233 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S    A++AI++  +G  Q  +  A+  LP NITL+   +          A ++G E
Sbjct: 11  FISSFTHAAQVAIIIDDIGYRQ--SDEAVLTLPENITLSVLPHTPLGHSVASAAHERGHE 68

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PMQA +          L  T    +L   ++ +        G  N+ G++L   +
Sbjct: 69  IMVHLPMQALNGKA--LGPGGLTNTMGESELKKSIQSAFLSVPFAKGANNHMGSLLTQLE 126

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           E    + +   ++ L F D  ++        A +L +P +  +L+LD+ +    +  +  
Sbjct: 127 EPMLWVMESLKQQDLYFVDSMTTRFTKAGTTADQLGIPQLKRELFLDNDISAAALDRQFS 186

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            L  +A   GQ + +A  + E+IE +   L +     + +V  S L      S
Sbjct: 187 KLITLAHNQGQIVAIAHPYPETIEFLKLNLPRLQKAGIKLVKTSELLPYRLAS 239


>gi|110635778|ref|YP_675986.1| protein of unknown function DUF610, YibQ [Mesorhizobium sp. BNC1]
 gi|110286762|gb|ABG64821.1| protein of unknown function DUF610, YibQ [Chelativorans sp. BNC1]
          Length = 330

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 106/320 (33%), Positives = 166/320 (51%), Gaps = 6/320 (1%)

Query: 76  NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERL 135
           + + ++SPS         +  + S  H   I +  S      +             +   
Sbjct: 2   SPDRERSPSATAKPAPQLEAASASRLHSTFIPHLDSDDVGPLRRGLVFRDSLAEGGQNLR 61

Query: 136 ILGLSKKELLAKNKVGREDTEVPAMDKNF------CSNASGARIAIVVSGLGISQTGTQR 189
           +  L  + L+ ++++G          + F       S A GARIAIV+ GLGISQTGTQ 
Sbjct: 62  VAHLPDRALIEESELGPLPVRAADGLRPFDAYARPWSGARGARIAIVIGGLGISQTGTQE 121

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           AI  LP  ITLAFA  GNSL RWM+EA++ G E I+Q+P++           YTL     
Sbjct: 122 AIEKLPPEITLAFAPLGNSLMRWMQEARRDGHEVIMQVPLEPAGYPSTNPGRYTLLTNVG 181

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
             + +  LR+ L R T Y GVMNY GA   +++++ +++  E ++RGLL+FDDG S R+L
Sbjct: 182 ADKNIRNLRWVLSRITNYTGVMNYMGARFTADRKAMDLLMDELSQRGLLYFDDGMSARSL 241

Query: 310 TRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVIS 369
              +A    +P++  D  +D + +R  I +KL  LE IAR  G A+G  +A + +++ ++
Sbjct: 242 AEEVALAKGVPFVAGDDVIDQERERGAILKKLDELERIARAKGFAVGSGIALNATVDAVT 301

Query: 370 QWLQQEHVRDVSVVPLSCLA 389
            W  +   R V +VP+S +A
Sbjct: 302 SWAGEVRKRGVELVPISAVA 321


>gi|220924600|ref|YP_002499902.1| hypothetical protein Mnod_4734 [Methylobacterium nodulans ORS 2060]
 gi|219949207|gb|ACL59599.1| protein of unknown function DUF610 YibQ [Methylobacterium nodulans
           ORS 2060]
          Length = 404

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/397 (27%), Positives = 171/397 (43%), Gaps = 18/397 (4%)

Query: 5   LNHPLR--KKTPKRKSFYSQIISRLGLFLLFCTFIVG-LSIYILISHAFVGTISEMIPYS 61
           L+ PL    + P R + +   I    +     + +VG L+  I  +   +G     +   
Sbjct: 16  LSRPLGIRNEAPSRLARWRAAIPVRPILAAGSSVLVGALACLIAFTEDPLGGEPHAVVTI 75

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
            +RE            E   +P+  D +    +++  S     + +       VV +   
Sbjct: 76  TLREPVA------PAPEPTLAPAAPDGSRSAGEVERASGVAVTRPEGAAVPDAVVIRVPD 129

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS------NASGARIAI 175
              +   P  + RL+    K       ++G +      +     +       A   RIA+
Sbjct: 130 PAELSLAPAPDPRLV---EKGRYGVLPRIGPDGARALDIYARPEATSLRSGAAPAGRIAL 186

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           VV+GLGI QT TQ A+  LP  +TLAFA  G+ + +    A++ G E ++Q PM+ FD  
Sbjct: 187 VVTGLGIGQTVTQEAVTRLPPAVTLAFAPYGSDIGKAATRAREAGHEVLVQAPMEPFDYP 246

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
            N+    TL       +   RL + L R  G  GV+NY GA L     S E + +E   R
Sbjct: 247 DNDPGPQTLLAGAKPAENTGRLAFVLARVPGAIGVVNYMGARLTGEAASLEPVLREIGAR 306

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAI 355
           GL F DDGSSPR+L   +  +   P   AD  +D Q   D I  +L  LEE AR  G A+
Sbjct: 307 GLGFLDDGSSPRSLALEVGRRTRTPVARADAVVDAQPLPDAIDRELARLEETARRKGFAL 366

Query: 356 GVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           G A+A   ++E I +W +    R + +VP S   +  
Sbjct: 367 GTAMALPLTVERILRWSRDLEARGILLVPASHALRTR 403


>gi|188025459|ref|ZP_02958730.2| hypothetical protein PROSTU_00480 [Providencia stuartii ATCC 25827]
 gi|188023551|gb|EDU61591.1| hypothetical protein PROSTU_00480 [Providencia stuartii ATCC 25827]
          Length = 303

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 50/230 (21%), Positives = 101/230 (43%), Gaps = 4/230 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            AS A++AIV+   G  +T     I  LP  IT+A   +         +A ++G+E I+ 
Sbjct: 5   QASAAKLAIVIDDFGY-RTKEDNQILALPTPITIAILPDSPHGQLVANKAHQQGREVIIH 63

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+   +   E    TL  T + +++   ++ ++ +     G+ N+ G+ + S+     
Sbjct: 64  MPMKPLSKQPLE--KNTLSPTMSAEEIDRIIKRAISQVPYAKGMNNHMGSEMTSSLSGMR 121

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +    +K    F D  +         A +  +P +   ++LD+    ++ R +L     
Sbjct: 122 HVMNSLSKANFFFLDSVTIGNTQAVKAANEFGVPVVRRHIFLDNHQSEEETRVQLNKAVA 181

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            AR  G AI +      ++  + ++L Q    D+ +V +S L + SS  +
Sbjct: 182 YARKHGNAIAIGHPHPSTVRALQKYLPQLPA-DIELVSVSALLQGSSQPT 230


>gi|91795046|ref|YP_564697.1| protein of unknown function DUF610, YibQ [Shewanella denitrificans
           OS217]
 gi|91717048|gb|ABE56974.1| protein of unknown function DUF610, YibQ [Shewanella denitrificans
           OS217]
          Length = 245

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 50/229 (21%), Positives = 95/229 (41%), Gaps = 4/229 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F     GA++AI++  +G  Q  T  A+  LP  ITL+   +     +  ++  KKG E
Sbjct: 1   MFIQPVFGAKLAIIIDDIGYRQ--TDEAVLSLPNTITLSVLPHTPLGQKLAQDGHKKGHE 58

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +L +PMQA +    E     L    T  Q+  +L  ++       G  N+ G++L   +
Sbjct: 59  IMLHLPMQALNGK--ELGPGGLTNVMTEGQIKQQLHSAVSSIPFAKGANNHMGSLLTQMQ 116

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
           +    + +   +  L F D  ++        A  L +P +   ++LD+ +    ++ +  
Sbjct: 117 DPMRWVMESLKQNNLYFVDSMTTRFTKATASAQSLGVPTLKRQIFLDNDISEAALQRQFN 176

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            +   A+   Q I +A    E+I  +   L +     + +V  S L   
Sbjct: 177 LIMVKAKQEQQVIAIAHPHPETIRFLKANLARLEQAGIELVHTSHLLPE 225


>gi|329929364|ref|ZP_08283112.1| divergent polysaccharide deacetylase [Paenibacillus sp. HGF5]
 gi|328936451|gb|EGG32896.1| divergent polysaccharide deacetylase [Paenibacillus sp. HGF5]
          Length = 293

 Score =  261 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 41/234 (17%), Positives = 98/234 (41%), Gaps = 5/234 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
                    ++A+++   G  Q GT+  +  LP  IT+A      +  +  + A ++G +
Sbjct: 52  RSAQEKKPNKLAVIIDDFGNDQKGTEE-MLNLPVKITVAVMPFLPTSKKDAEAAHQQGHD 110

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+      +      +  + T +++  R+  ++       G+ N+ G+ +  ++
Sbjct: 111 VIIHMPMEPKQGRSSWLGPGAILSSLTDEEIRKRMEEAIDSVPYAVGINNHMGSKVTGDE 170

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               ++     +RGL F D  ++  ++   LA  + +P +  D++LDD      + ++L+
Sbjct: 171 RVMSIVLDVCRERGLFFVDSKTNYYSVVGKLAASMGMPSIANDIFLDDVHTVQHVSKQLQ 230

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
              + A      I +         + E +   + +   + V  V +S L +  S
Sbjct: 231 TAAQHAVERTSCIAIGHVGVYGIRTAEALKGTIPELQKK-VEFVGISDLVREHS 283


>gi|238794396|ref|ZP_04638007.1| hypothetical protein yinte0001_39420 [Yersinia intermedia ATCC
           29909]
 gi|238726297|gb|EEQ17840.1| hypothetical protein yinte0001_39420 [Yersinia intermedia ATCC
           29909]
          Length = 343

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 47/226 (20%), Positives = 96/226 (42%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G      +  I  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  AAQAGKLSIVIDDFGYRPQN-ENKILQMPLPISVAILPNAPYAREMAIKAHNQGREILIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--RDTLQPSMSSEEIQRIMRQAVNNVPYAKGMNNHMGSAMTSSFSGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +E     L F D  +   +     A   ++  +   ++LDD  +   IR++     E
Sbjct: 137 KVMQELDHYQLYFLDSVTIGNSQAGRAAEGTHVKVIKRKVFLDDSQNEAAIRQQFNRAVE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 197 LARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLNEP 241


>gi|260892757|ref|YP_003238854.1| N-acetylmuramoyl-L-alanine amidase [Ammonifex degensii KC4]
 gi|260864898|gb|ACX52004.1| N-acetylmuramoyl-L-alanine amidase [Ammonifex degensii KC4]
          Length = 476

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 56/288 (19%), Positives = 118/288 (40%), Gaps = 7/288 (2%)

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
              VV     S++ ++   ++      +++           +   +PA  K    ++  A
Sbjct: 176 PAVVVEMGYLSSAAEAARLLDPGYQQRIAEALCAGLEAYFAQANSLPAGGKL---HSPRA 232

Query: 172 RIAIVVSGL-GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           R+AIV+    G S+    R    L   +T A   N        +EA K G E ++ +PM+
Sbjct: 233 RVAIVIDDFAGPSEKKGTREFLSLNKPLTFAVLPNYPLSAPTAREAVKAGFEVLVHLPME 292

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                 +      + V    +++  R+  ++    G  G+ N+ G+   ++      + +
Sbjct: 293 PLKGDPSWLGPGAIYVHLNDEEIERRVERAIASVPGAVGMNNHMGSRATADPRVIRAVLR 352

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              +  L F D  ++ +++   +A +L +PY    L+LD   D   I+E+L+ L ++A  
Sbjct: 353 VAKRHNLFFLDSKTTNKSVIPQIAKELGVPYAEDGLFLDAVNDVGHIKEQLRKLAQLALK 412

Query: 351 TGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            G AI +         ++  I + L +     + +V +S L K  + +
Sbjct: 413 NGSAIAIGHVGVTGPNTVRAIKEMLPEFERLGIELVYVSTLLKHPASA 460


>gi|254429372|ref|ZP_05043079.1| Divergent polysaccharide deacetylase superfamily [Alcanivorax sp.
           DG881]
 gi|196195541|gb|EDX90500.1| Divergent polysaccharide deacetylase superfamily [Alcanivorax sp.
           DG881]
          Length = 258

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 59/219 (26%), Positives = 102/219 (46%), Gaps = 3/219 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            RIAI++  LG S+   Q AI  LPA +T A         R  + A   G+E ++ +PM 
Sbjct: 25  PRIAIIIDDLGYSRQHGQ-AIVDLPAPVTCAVIPFSPHARRLAERASLAGKEVLVHMPMA 83

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A      +     L+      QLL+ +R +L +     G+ N+ G+ L   ++    +  
Sbjct: 84  AQRHQTLDQG--GLRDGMDEPQLLDAVRQALSQIPQARGLNNHMGSALTEQQQPMGWLMT 141

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E     L F D  +S  ++ + +A ++ L +   D++LD++ +   I E+   L  +AR 
Sbjct: 142 ELKAHQLFFVDSRTSSHSVAQQMARQVGLSHAGRDVFLDNERNLVSINEQFNRLIRLARQ 201

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            GQAI +   + E++  + Q L       + VVP+S L 
Sbjct: 202 RGQAIAIGHPYPETVHYLQQVLPLMQDAGIEVVPVSTLL 240


>gi|311695899|gb|ADP98772.1| secreted protein containing DUF610, YibQ [marine bacterium HP15]
          Length = 271

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 99/232 (42%), Gaps = 3/232 (1%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
            +    A    IAI++  +G S    +R +  L   +TLAF       D   + A K+ +
Sbjct: 21  ADPARKALPPTIAIIIDDMGHSLVEGER-LANLDQPLTLAFLPYRPHTDSLARLAYKQHK 79

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E +L  PM   +          L      Q +   LR +L+      GV N+ G++L   
Sbjct: 80  EIMLHAPMA--NTRNYGLGPGGLTPEMDEQSMATTLRRALQSIPHVQGVNNHMGSLLTQQ 137

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
            +  + + KE  +  + F D  +   ++   +A    +P M  D++LD +   + +  + 
Sbjct: 138 LQPMDWVMKELFRYPVYFIDSRTIASSVAGDVAAAYRIPTMTRDVFLDHEQTEEFVDRQF 197

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           K L + A+  G AIG+      +++ + + L +   + +++  +S L  + +
Sbjct: 198 KLLIKRAKENGSAIGIGHPHKVTVDYLEKHLPKLDEQGIAIATVSGLWAMRN 249


>gi|300721222|ref|YP_003710492.1| hypothetical protein XNC1_0147 [Xenorhabdus nematophila ATCC 19061]
 gi|297627709|emb|CBJ88235.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus nematophila ATCC 19061]
          Length = 349

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 41/222 (18%), Positives = 95/222 (42%), Gaps = 4/222 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  AR+AIV+  +G  +   +  I  +P  +++A   +         +A ++G+E ++ +
Sbjct: 34  ARAARLAIVIDDVGY-RIHEENKILQMPIAVSVAILPDSPHGREMAVKAYQQGREVLIHL 92

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E    TL    + +++   ++ ++++     G+ N+ G+ + S+    E 
Sbjct: 93  PMAPLSQQPLE--KNTLHPAMSREEIGRIIQEAIQKVPHAVGMNNHMGSAMTSDLTGMEK 150

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  ++  L F D  +         A   ++P +  +++LD+     + R +      +
Sbjct: 151 VMQVLSRHHLYFLDSVTIGNTQVTKAATGTSVPVIRRNIFLDNVQTEAETRHQFNRAITL 210

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           AR  G AI +      ++  + Q L      D+ +V    L 
Sbjct: 211 ARKKGSAIAIGHPHPTTVRALQQALATLPD-DIELVTPGILL 251


>gi|330720619|gb|EGG98878.1| putative divergent polysaccharide deacetylase [gamma
           proteobacterium IMCC2047]
          Length = 305

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 50/231 (21%), Positives = 97/231 (41%), Gaps = 3/231 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + +S  +I I++  LG +    QRAI  LP  +T +         +  K+A ++ +E 
Sbjct: 20  IQAASSSPQITIIIDDLGNNLRNGQRAI-ALPGAVTYSVLPFTPFGKQLAKQAHQQDKEV 78

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PM              L   Q       +L  ++       G+ N+ G+ L ++ E
Sbjct: 79  MLHMPMDNSHGHP--LGPGGLTFKQDRPLFEQQLAAAITATPFVSGINNHMGSGLTTSSE 136

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +S  ++    A  L +P +  D++LD +     I ++ K 
Sbjct: 137 RMQWLMQSLKNYPLYFVDSRTSANSVAGRTALALKIPTLKRDIFLDHETTPAFIDKQFKR 196

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           L + A + G A+ +   +  +++ + + L Q     V +VP S L  L   
Sbjct: 197 LLKKAHSKGHAVAIGHPYPSTLDYLEKALPQLDKLGVELVPPSQLLALKRT 247


>gi|331006625|ref|ZP_08329910.1| hypothetical protein IMCC1989_515 [gamma proteobacterium IMCC1989]
 gi|330419564|gb|EGG93945.1| hypothetical protein IMCC1989_515 [gamma proteobacterium IMCC1989]
          Length = 349

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 60/275 (21%), Positives = 111/275 (40%), Gaps = 4/275 (1%)

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSG 179
                  S    +++  +G ++   L            P   K      +   +AI++  
Sbjct: 59  AHPHQQVSPYQQDKQQGVGAAQPLTLPSFVEPSAPALKPTAIK-EKVVKTSISVAIIIDD 117

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
           LG +     +A+  LP  IT A   +      + +EA+K  +E +L  PM   +      
Sbjct: 118 LGYNYEQGLKAM-QLPGAITYAIIPHSPKAQFFAQEAQKHNKEIMLHAPMSTINHKP--L 174

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLF 299
               L            L  SL       G+ N+ G++L    +    + +   +R L F
Sbjct: 175 GKNGLTGLMEEADFKQVLNQSLLSLPSVKGMNNHMGSLLTQKSQPMSWVMQSLKQRQLYF 234

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV 359
            D  +S +++   +A +  +P +  D++LD + +   I ++ K L   A+  G A+ +A 
Sbjct: 235 IDSRTSAQSVAWDIAQQYGIPSLKRDVFLDHEPNEAFIDKQFKLLISTAKHQGYAVAIAH 294

Query: 360 AFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
              E++  +S  L + H   +S+VP S LAK  SP
Sbjct: 295 PHPETVAYLSLNLSRLHDAGISLVPASELAKRFSP 329


>gi|134299434|ref|YP_001112930.1| hypothetical protein Dred_1577 [Desulfotomaculum reducens MI-1]
 gi|134052134|gb|ABO50105.1| protein of unknown function DUF610, YibQ [Desulfotomaculum reducens
           MI-1]
          Length = 271

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 54/226 (23%), Positives = 95/226 (42%), Gaps = 3/226 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             +AIV+   G + T        L   IT+A   N  +     +EA K+G E IL  PM+
Sbjct: 41  PMLAIVIDDFGGADTHGVAQFMELKQPITVAVMPNLVNSKEHSEEAHKRGHEVILHQPME 100

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                 +      +K   + +++      +L       G  N+ G+ + SNK+    + +
Sbjct: 101 PLHGKDSWLGPGAIKSDMSYEEIKKVFLDNLATVPHAEGFNNHTGSKITSNKDKVAPMLE 160

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
               +GL   D  +S ++    +A  + +P++  D++LD+   +  I   LK    IA+ 
Sbjct: 161 VAKDKGLFVLDSRTSDKSQVIKVAKSMQVPWVKRDVFLDEVKSKAVITRNLKKACAIAKK 220

Query: 351 TGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            G AI +         + E + + L       V +VPLS + KL S
Sbjct: 221 QGYAISIGHVGPGGNVTAEAVKEALPLIEKEGVKLVPLSQVVKLKS 266


>gi|238754759|ref|ZP_04616111.1| hypothetical protein yruck0001_30950 [Yersinia ruckeri ATCC 29473]
 gi|238707067|gb|EEP99432.1| hypothetical protein yruck0001_30950 [Yersinia ruckeri ATCC 29473]
          Length = 328

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 92/227 (40%), Gaps = 4/227 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G      +  I  +P  I++A             +A  +G+E ++ +
Sbjct: 21  AQAGKLSIVIDDFGYRPQN-ENQILQMPLPISVAILPYAPHAKEMAIKAHSQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM        E    TL+ + + +++   +R ++       G+ N+ G+ + S+    + 
Sbjct: 80  PMAPLSRQPLE--RDTLQPSMSSEEIQRIIRQAVSNVPYAVGMNNHMGSAMTSSLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  +         A    +  +   ++LDD  +   IR++     ++
Sbjct: 138 VMQALEHYSLYFLDSVTIGNTQASKAAEGTGVKVIKRKVFLDDVQNDVAIRQQFNRAIQL 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           AR  G AI +      +I V+ Q L+Q    D+ +V  S L     P
Sbjct: 198 ARKNGSAIAIGHPHPSTIRVLQQMLRQLPP-DIVLVRPSALLNEPVP 243


>gi|238897058|ref|YP_002921804.1| hypothetical protein KP1_5309 [Klebsiella pneumoniae NTUH-K2044]
 gi|262040666|ref|ZP_06013904.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|238549386|dbj|BAH65737.1| hypothetical protein KP1_5309 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|259042030|gb|EEW43063.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 315

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 46/238 (19%), Positives = 94/238 (39%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      + A   +++IV+   G  +  T+  +  LPA I++A   N         
Sbjct: 8   ALAVAGSLALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPATISVAVLPNAPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A  +G E ++ +PM    +   E    TL+   + +++   +R +  +     G+ N+ 
Sbjct: 67  KAHNQGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSEEIERIIREAYGKVPYAVGLNNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSAMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +      +AR  G AI +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRNQFNRAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLNEP 241


>gi|94499747|ref|ZP_01306283.1| hypothetical protein RED65_14537 [Oceanobacter sp. RED65]
 gi|94427948|gb|EAT12922.1| hypothetical protein RED65_14537 [Oceanobacter sp. RED65]
          Length = 293

 Score =  260 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 50/244 (20%), Positives = 100/244 (40%), Gaps = 3/244 (1%)

Query: 152 REDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
               +  +  +   S+ S A++AI++  +G S      AI  LP NIT A   +     +
Sbjct: 9   PVQAQGLSNAELSASSPSVAQLAIIIDDIGNSWQKGLDAI-ALPGNITFAVMPHRKHSIQ 67

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
             + A + G+E +L  PM   +    E  +  L      +    RLR+++       G+ 
Sbjct: 68  LAERAGRLGKEVMLHAPMATMN--NRELGAGALHENLGEKLFKLRLRFAIDNIPYVRGIN 125

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+ L ++  +   +     ++ L F D  +   ++    A +  L     D++LD +
Sbjct: 126 NHMGSRLTTSTNAMGWVMDVLKEKQLFFVDSRTHANSIAFEQAQQYGLASAKRDVFLDHE 185

Query: 332 VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
              D +  + K    IA+  G AI +    + ++  +   + Q     +  + +S L K 
Sbjct: 186 RTLDAVHRQFKLAVTIAKEYGNAIAIGHPHNVTLRYLEHVIPQLEQHHIETIFVSALLKT 245

Query: 392 SSPS 395
            + S
Sbjct: 246 GNQS 249


>gi|238760441|ref|ZP_04621579.1| hypothetical protein yaldo0001_39810 [Yersinia aldovae ATCC 35236]
 gi|238701336|gb|EEP93915.1| hypothetical protein yaldo0001_39810 [Yersinia aldovae ATCC 35236]
          Length = 336

 Score =  259 bits (662), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 47/228 (20%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S A   +++IV+   G      +  I  +P  I++A   N         +A  +G+E +
Sbjct: 18  ASAAQAGKLSIVIDDFGYRPQN-ENKILQMPLPISVAILPNAPHAKEMAMKAHNQGREIL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+   
Sbjct: 77  IHLPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRQAVNNVPYAKGMNNHMGSAMTSSLPG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +      L F D  +   +     A    +  +   ++LDD  +   IR++    
Sbjct: 135 MQKVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            E+AR  G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 195 VELARRNGSAIAIGHPHPATIKVLQQMLPQLPT-DIVLVRPSELLNEP 241


>gi|288933028|ref|YP_003437087.1| hypothetical protein Kvar_0143 [Klebsiella variicola At-22]
 gi|288887757|gb|ADC56075.1| protein of unknown function DUF610 YibQ [Klebsiella variicola
           At-22]
          Length = 318

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 93/238 (39%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      + A   +++IV+   G  +  T+  +  LP+ I++A   N         
Sbjct: 8   ALAVAGSLALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   + +++   +R +  +     G+ N+ 
Sbjct: 67  KAHNLGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSEEIERIIREAYGKVPYAIGLNNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSAMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +      +AR  G AI +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRNQFNRAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLNEP 241


>gi|77359329|ref|YP_338904.1| hypothetical protein PSHAa0363 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76874240|emb|CAI85461.1| conserved protein of unknown function ; putative signal peptide
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 246

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 52/226 (23%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +IAIV+  +G  Q      +  LP  ++ +   +      +   A K  +E +L I
Sbjct: 18  AKAKQIAIVIDDIGYHQR--DLELLTLPGQVSYSILPHTPYAQAFATLASKTNKELLLHI 75

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQA +    E     L +    +Q+   L  +L       GV N+ G+ L    ++   
Sbjct: 76  PMQALNGK--ELGPGALTLNMNKEQIQQILGTALASLPQVKGVNNHMGSALTQQSQAMRW 133

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           I +   KR L F D  ++  +  +  A  L +  +   ++LD+    ++++ +L  L++ 
Sbjct: 134 IMEVLKKRHLYFLDSRTTELSQAQNAANFLGVENIGRHIFLDNITTPEQLQLRLDELKQH 193

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           A     AI +A  + E+I  +   L Q   +   +VP+S L +   
Sbjct: 194 ATEHKFAIAIAHPYPETIAFLRHVLPQLSKQGFELVPVSKLVERKY 239


>gi|127514737|ref|YP_001095934.1| protein of unknown function DUF610, YibQ [Shewanella loihica PV-4]
 gi|126640032|gb|ABO25675.1| protein of unknown function DUF610, YibQ [Shewanella loihica PV-4]
          Length = 251

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 51/224 (22%), Positives = 97/224 (43%), Gaps = 4/224 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
             A+++I++  +G  Q  T  A+  LP++ITL+   +    +R    A  KG E +L +P
Sbjct: 17  FAAQVSIIIDDIGYRQ--TDEAVLALPSDITLSVLPHTPLGERLAAIAHDKGHEIMLHLP 74

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           MQA +    E     L    + Q L   +  + +      GV N+ G++L         +
Sbjct: 75  MQALNGK--EMGPGGLTNQMSEQALKRAVDDAFKSVPYAKGVNNHMGSLLTQLDAPMTWL 132

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +   ++   F D  ++  +     A +L +P +   L+LD+ V    +  +   L ++A
Sbjct: 133 MESLKQQDNYFVDSMTTRYSKASDAANRLGIPLLRRQLFLDNDVSPQGLERQFNQLIQLA 192

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
              GQ I +A  + E+I  +   L +     +++V  S L    
Sbjct: 193 NKEGQLIVIAHPYPETISFLKANLSRLSDEGIALVNTSRLLPYR 236


>gi|119773199|ref|YP_925939.1| hypothetical protein Sama_0057 [Shewanella amazonensis SB2B]
 gi|119765699|gb|ABL98269.1| protein of unknown function DUF610, YibQ [Shewanella amazonensis
           SB2B]
          Length = 250

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 43/225 (19%), Positives = 96/225 (42%), Gaps = 4/225 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A GA++AI++  +G     T   +  LP +ITL+   +     +   +  ++G E +L +
Sbjct: 16  AHGAQLAIIIDDIGYR--HTDEDVLSLPKDITLSVIPSSPLGVKLASKGHQRGHEIMLHL 73

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ+ +          L      Q++  ++  ++ R     G  N+ G+ML         
Sbjct: 74  PMQSLNARP--LGQGGLTSDMDEQEIKRKVDDAMVRIPFAKGANNHMGSMLTQLDSHMLW 131

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +      L F D  ++  +     A ++ +P +   ++LD+   +  + ++ K + E 
Sbjct: 132 VMERLKHNNLYFVDSLTTRYSKAGAKAEQVGVPLLKRHVFLDNDTSKRGLEKQFKLMMEQ 191

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           A   G  + +A     +++ ++  L +     +++VP S L    
Sbjct: 192 AHQQGFVVAIAHPHPATVKFLNANLHRLRDEGINLVPTSELLPYR 236


>gi|110835138|ref|YP_693997.1| hypothetical protein ABO_2277 [Alcanivorax borkumensis SK2]
 gi|110648249|emb|CAL17725.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 259

 Score =  258 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 58/226 (25%), Positives = 99/226 (43%), Gaps = 3/226 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S  +  RIAI++  LG S+   Q AI  LPA +  A         R  + A   G+E 
Sbjct: 19  SVSGLAAPRIAIIIDDLGYSRQQGQ-AIIDLPAPVACAVIPFSPHGRRLAERASLAGKEV 77

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM        +     L+      QLL  +R +L +     G+ N+ G+ L    +
Sbjct: 78  LVHMPMATQGHQKLDRG--GLQNGMDEPQLLEAVRQALGQIPQARGLNNHMGSALTEQPQ 135

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   +  E     L F D  +S   + + +A ++ LP    D++LD+  +   I ++   
Sbjct: 136 TMGWLMAELKAHQLFFVDSRTSSHTVAQQVAQQVGLPNARRDVFLDNNRNPVSINQQFNR 195

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           L  +AR  GQAI +   + E++  + Q L       + VVP+S L 
Sbjct: 196 LIRLARQHGQAIAIGHPYPETVHYLQQVLPLMEEAGIDVVPVSSLL 241


>gi|268679505|ref|YP_003303936.1| hypothetical protein Sdel_0870 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268617536|gb|ACZ11901.1| protein of unknown function DUF610 YibQ [Sulfurospirillum
           deleyianum DSM 6946]
          Length = 381

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 60/379 (15%), Positives = 129/379 (34%), Gaps = 22/379 (5%)

Query: 16  RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPL 75
           +KS  S     +GL L F    +G+  Y  ++H      S                    
Sbjct: 19  KKSKISFKPFLIGLALCFIALGIGIGGYWYVNH------SLPFLKHQKAVPTKEESVSTD 72

Query: 76  NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT------RSTSIDSLP 129
            +  K              L      +  +    +    V +K         + + ++L 
Sbjct: 73  ALMLKMQQMLESEKLRQATLPPLPETNVSKPAPLVESAIVPSKVEENSSLETTQNNEALV 132

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                L      ++ L ++K   +   V    +      +  ++AI++    +S     R
Sbjct: 133 QKAPELSEVHEYQQSLKESKSSHKPHTVV---RKEYPQGTTPKLAIIIDD--VSFPWQTR 187

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
            +  +P  +T AF          ++ + +    A++ +P++A   S    +  TL  T +
Sbjct: 188 LMKEIPYKVTPAFFPPTKGHPETVRLSHEFPF-AMVHLPLEAKYYSR--PEEDTLNTTDS 244

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
           +  +  R++             N+ G    ++  + + + K      L F D  +   + 
Sbjct: 245 LDVIEKRIKRIKAWFPHIHYYNNHTGGYFTADYAAMDRLIKVMKDHNLSFVDSRTVGNSK 304

Query: 310 TRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVIS 369
              +  K  +     D++LD+ +++  IR++LK     A+  G AI +      ++EV+ 
Sbjct: 305 APEVMKKYGMFLYSRDVFLDNSLEKSAIRKQLKEAVFKAKKYGYAIAIGHPHKNTLEVLR 364

Query: 370 QWLQQEHVRDVSVVPLSCL 388
                     V +V L  L
Sbjct: 365 DSQVLLE--GVEMVYLKEL 381


>gi|152972465|ref|YP_001337611.1| hypothetical protein KPN_03959 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150957314|gb|ABR79344.1| hypothetical protein KPN_03959 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 315

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 93/238 (39%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      + A   +++IV+   G  +  T+  +  LP+ I++A   N         
Sbjct: 8   ALAVAGSLALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   + +++   +R +  +     G+ N+ 
Sbjct: 67  KAHNLGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSEEIERIIREAYGKVPYAVGLNNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSAMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +      +AR  G AI +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRNQFNRAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLNEP 241


>gi|206578516|ref|YP_002236021.1| polysaccharide deacetylase family protein [Klebsiella pneumoniae
           342]
 gi|290511821|ref|ZP_06551189.1| yibQ [Klebsiella sp. 1_1_55]
 gi|206567574|gb|ACI09350.1| polysaccharide deacetylase family protein [Klebsiella pneumoniae
           342]
 gi|289775611|gb|EFD83611.1| yibQ [Klebsiella sp. 1_1_55]
          Length = 318

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 93/238 (39%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      + A   +++IV+   G  +  T+  +  LP+ I++A   N         
Sbjct: 8   ALAVAGSLALAAPAFAGKLSIVIDDFGY-RPQTENQVLALPSTISVAVLPNAPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   + +++   +R +  +     G+ N+ 
Sbjct: 67  KAHNLGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSEEIERIIREAYGKVPYAVGLNNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSAMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDTQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +      +AR  G AI +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRTQFNRAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLNEP 241


>gi|56415596|ref|YP_152671.1| hypothetical protein SPA3558 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364523|ref|YP_002144160.1| hypothetical protein SSPA3321 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56129853|gb|AAV79359.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197096000|emb|CAR61587.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 320

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|317153225|ref|YP_004121273.1| hypothetical protein Daes_1513 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943476|gb|ADU62527.1| protein of unknown function DUF610 YibQ [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 413

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 79/405 (19%), Positives = 151/405 (37%), Gaps = 30/405 (7%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGL--SIYILISHAFVGTISEMIPYSVIREIA 67
           R +     SF++++     L  LF     GL    Y +++              VI +  
Sbjct: 10  RNEETGPVSFFAKLYRPGPLVALFTLAFAGLITLGYFILTDTTPPDEVAAAAGMVI-KAE 68

Query: 68  PIPLTIPLNIEDKQSPSK---RDNNTVCNQLKNDSSQHDGQI-QNDISGKTVVNKPTRST 123
           P+ +   +  ED     +   R  +    +    +     ++   D+  +T+  +P    
Sbjct: 69  PVTVVPKVYEEDTTGDMEDLVRQADLAVIEAMRGAGMDLARLGLLDVELRTLDGRPYHYQ 128

Query: 124 SIDSLPTIEERL-ILGLSKKELLAKN-------------------KVGREDTEVPAMDKN 163
            +D  P  +    + GL  +  +                         R   E   M   
Sbjct: 129 VLDIPPLKDRSAFLTGLKNRLAVRVPDAVLTDKGNAEAVITIASLPTHRLMLETVPMTLP 188

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                 G  +AIV+  +G       + +  L   +TLA   N +     ++  +  G++ 
Sbjct: 189 R-PTGKGPMLAIVIDDIGEDL-HVLKGLINLNFPVTLAVWPNASQSRESVRLIQASGRDL 246

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PM+          S  L  T + + +  R+  S+ R     GV N+ G+   ++  
Sbjct: 247 IIHFPMEPMGYPAYNPGSDALFTTMSEEAIRKRVADSVARIPEAIGVNNHMGSKFTAHTP 306

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
                  EF +RGL F D  +S R++ R +A +   P+   D++LD+  D   I  +L+ 
Sbjct: 307 GMTTALSEFRQRGLFFLDSLTSARSVARSVARQTGTPFYQRDIFLDNVKDVSAITLQLRK 366

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            E +A   G AI +   + E++  +  W  +    ++ V+PLS L
Sbjct: 367 AENVALKNGVAIAIGHPYPETLAALKSWHAR-KNPNIRVLPLSLL 410


>gi|322835022|ref|YP_004215049.1| hypothetical protein Rahaq_4336 [Rahnella sp. Y9602]
 gi|321170223|gb|ADW75922.1| protein of unknown function DUF610 YibQ [Rahnella sp. Y9602]
          Length = 309

 Score =  258 bits (658), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 44/236 (18%), Positives = 97/236 (41%), Gaps = 4/236 (1%)

Query: 160 MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
               F      A+++I++   G  Q   +  +  +P  +++A   N       M +A ++
Sbjct: 13  GTAFFACQVQAAKLSILIDDFGYRQ-HEENQVLQMPKAVSVAIFPNAPDSQMMMNKAHQQ 71

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           G+E ++ +PM    +   E    TL  + +  ++   +  ++       G+ N+ G+ + 
Sbjct: 72  GREILIHLPMAPLSKQPLE--KDTLTPSMSAAEVKRIVDQAIINIPYAIGINNHMGSAMT 129

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           S+    E + +      L F D  +     +   A    +  +  +++LDD  +  +IR 
Sbjct: 130 SSLTGMENVMQAMNAHNLFFLDSMTIGNTQSVKAAQGTRVKVIKRNVFLDDVQNEAEIRR 189

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           + +   ++AR  G AI +      +++V+ Q L      D+ +V  S L      S
Sbjct: 190 QFERAIQLARKNGYAIAIGHPHPTTVKVLQQMLPNLPS-DIVLVRPSDLLNEPQRS 244


>gi|163792328|ref|ZP_02186305.1| hypothetical protein BAL199_15813 [alpha proteobacterium BAL199]
 gi|159182033|gb|EDP66542.1| hypothetical protein BAL199_15813 [alpha proteobacterium BAL199]
          Length = 418

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 83/389 (21%), Positives = 162/389 (41%), Gaps = 9/389 (2%)

Query: 8   PLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIA 67
           PL     KR +  S       L  +    +      I  + A VG +      +  R++ 
Sbjct: 26  PLDDAPAKRPAAASDGRIGRLLIGIATGVLA--VAVIGGTGALVGWLLVNAETTESRQVL 83

Query: 68  PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDS 127
             P      + + ++P+   ++          ++ DG   +  +        T + +   
Sbjct: 84  RRPQLTVPVLAEGETPTANSSDGGQPVTAGPHTEKDGHAGSAATNSPAPTGDTAAPAPVP 143

Query: 128 LPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG-------ARIAIVVSGL 180
                + + L      LL      +     P   + + + A          R+AIV+ G+
Sbjct: 144 EVVSVDGVRLAAVDPTLLETKDSAKLPIIGPDGRQPWSTYARPFNLDDSRPRVAIVMIGV 203

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           G  +  T++A  LLP  I+L+F+    +++  M  A++ G E ++ +PM+  D   ++  
Sbjct: 204 GFGKDITEKATTLLPGAISLSFSPYVRNIEALMARARQAGHETLIDLPMEPLDFPRDDPG 263

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  + ++   LNRL + L R  GY GV  + G+   + +++   + +   +RGL+F 
Sbjct: 264 PSTLLTSLSLVDNLNRLEWVLGRAPGYVGVTTWMGSQFTTVEDALMPVLQGLRQRGLMFV 323

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           D  +S R++   LA  + LP    + ++D       I   L  LE  AR    A+G+A  
Sbjct: 324 DSRASSRSIATELASSIQLPRAFNNTFIDQTPSAGTIDRALASLEATARQQRYAVGIARP 383

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              +IE +S+W      + +++ P+S +A
Sbjct: 384 LPVTIERLSRWAGTLEGKGIALAPISAIA 412


>gi|167549047|ref|ZP_02342806.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205325644|gb|EDZ13483.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
          Length = 320

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 89/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  I  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQILALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G  I +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSTIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|157373053|ref|YP_001481042.1| hypothetical protein Spro_4821 [Serratia proteamaculans 568]
 gi|157324817|gb|ABV43914.1| protein of unknown function DUF610 YibQ [Serratia proteamaculans
           568]
          Length = 318

 Score =  258 bits (658), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 97/232 (41%), Gaps = 4/232 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
              A   +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E +
Sbjct: 18  VCAAQAGKLSIVIDDVGY-RPHEEGAVLQMPTAISVAVLPNAPHAHLMATRAHSQGREVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+  +
Sbjct: 77  IHMPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPA 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +      L F D  +   +     A   ++  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALDSYQLYFLDSMTIGNSQATRAAAGTHVKVIKRKVFLDDTANEADIRRQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            E+AR  G AI +      ++ V+ Q L      D+ +V  S L      SS
Sbjct: 195 VELARRNGSAIAIGHPRPATVRVLQQMLPTLPA-DIVLVKPSSLLNEPQGSS 245


>gi|204928803|ref|ZP_03220002.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|204322236|gb|EDZ07434.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|322612872|gb|EFY09824.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618937|gb|EFY15824.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625286|gb|EFY22113.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322630047|gb|EFY26820.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322634238|gb|EFY30973.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635861|gb|EFY32570.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322643053|gb|EFY39629.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322643820|gb|EFY40369.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649830|gb|EFY46253.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322653036|gb|EFY49371.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322661145|gb|EFY57373.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662366|gb|EFY58579.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322667244|gb|EFY63410.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674379|gb|EFY70472.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322678413|gb|EFY74474.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322680919|gb|EFY76953.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322687145|gb|EFY83118.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323192105|gb|EFZ77338.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323198212|gb|EFZ83319.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323200832|gb|EFZ85902.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323206586|gb|EFZ91544.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323210501|gb|EFZ95387.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323216211|gb|EGA00939.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323220434|gb|EGA04888.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225297|gb|EGA09531.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323228411|gb|EGA12542.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323234232|gb|EGA18320.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237217|gb|EGA21284.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323244736|gb|EGA28740.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323249217|gb|EGA33135.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250928|gb|EGA34804.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257323|gb|EGA41022.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323262248|gb|EGA45809.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323264541|gb|EGA48045.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323268831|gb|EGA52289.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|62182199|ref|YP_218616.1| hypothetical protein SC3629 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197248431|ref|YP_002148639.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|224585506|ref|YP_002639305.1| hypothetical protein SPC_3788 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|62129832|gb|AAX67535.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|197212134|gb|ACH49531.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|224470034|gb|ACN47864.1| hypothetical protein SPC_3788 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322716687|gb|EFZ08258.1| Uncharacterized protein yibQ [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVLKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|168464987|ref|ZP_02698879.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|195632452|gb|EDX50936.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|161616784|ref|YP_001590749.1| hypothetical protein SPAB_04603 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168818465|ref|ZP_02830465.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194445745|ref|YP_002042956.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|198245856|ref|YP_002217668.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205354691|ref|YP_002228492.1| hypothetical protein SG3725 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858943|ref|YP_002245594.1| hypothetical protein SEN3528 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|238910259|ref|ZP_04654096.1| hypothetical protein SentesTe_03869 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|161366148|gb|ABX69916.1| hypothetical protein SPAB_04603 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194404408|gb|ACF64630.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|197940372|gb|ACH77705.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|205274472|emb|CAR39505.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205344542|gb|EDZ31306.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|206710746|emb|CAR35107.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|320088125|emb|CBY97887.1| Uncharacterized protein yibQ Flags: Precursor [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|326625452|gb|EGE31797.1| Uncharacterized protein yibQ [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629830|gb|EGE36173.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|238789568|ref|ZP_04633352.1| hypothetical protein yfred0001_24040 [Yersinia frederiksenii ATCC
           33641]
 gi|238722321|gb|EEQ13977.1| hypothetical protein yfred0001_24040 [Yersinia frederiksenii ATCC
           33641]
          Length = 337

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 94/226 (41%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  AAQAGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAKEMAVKAHNQGREILIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR++     +
Sbjct: 137 KVMQTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVD 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 197 LARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLNEP 241


>gi|16766991|ref|NP_462606.1| periplasmic protein [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|167994326|ref|ZP_02575418.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168241884|ref|ZP_02666816.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|194447310|ref|YP_002047737.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197265013|ref|ZP_03165087.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|200387258|ref|ZP_03213870.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|16422273|gb|AAL22565.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194405614|gb|ACF65833.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|197243268|gb|EDY25888.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|199604356|gb|EDZ02901.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205327801|gb|EDZ14565.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205338812|gb|EDZ25576.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|261248854|emb|CBG26707.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995965|gb|ACY90850.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301160243|emb|CBW19765.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914732|dbj|BAJ38706.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321226758|gb|EFX51808.1| putative divergent polysaccharide deacetylase [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|323132066|gb|ADX19496.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990555|gb|AEF09538.1| putative periplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|168260540|ref|ZP_02682513.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|205350154|gb|EDZ36785.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|168232551|ref|ZP_02657609.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|194470628|ref|ZP_03076612.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194456992|gb|EDX45831.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|205333317|gb|EDZ20081.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
          Length = 320

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|149376054|ref|ZP_01893820.1| hypothetical protein MDG893_03710 [Marinobacter algicola DG893]
 gi|149359691|gb|EDM48149.1| hypothetical protein MDG893_03710 [Marinobacter algicola DG893]
          Length = 269

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 44/235 (18%), Positives = 96/235 (40%), Gaps = 3/235 (1%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
            +            IAI++  +G +    +R I  L   ITLAF        R  + A +
Sbjct: 16  PVVAGEHEGQLPPTIAIIIDDMGHNLVEGERLI-ALEQPITLAFLPYRRYTTRLAELAHR 74

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           K +E +L  PM   +          L        +   LR +L+      GV N+ G++L
Sbjct: 75  KHKEIMLHAPMA--NTRNIGLGPGGLNPDMDQNSIATTLRRALQSIPHVQGVNNHMGSLL 132

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
               +  + +  E     + F D  +   ++   +A    +P +  D++LD +   + + 
Sbjct: 133 TQQLQPMDWVMSELDHYPVYFVDSRTIASSIAGEVAAAYRIPTLTRDVFLDHEQTEEFVD 192

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++ + L + A+  G AIG+      +++ + + L +   + +++  +S +  + +
Sbjct: 193 QQFELLIKRAKENGSAIGIGHPHKVTVDYLEKRLPELDEQGIAIATVSGVWAMRN 247


>gi|123440475|ref|YP_001004469.1| hypothetical protein YE0075 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122087436|emb|CAL10217.1| putative exported protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 341

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 92/223 (41%), Gaps = 4/223 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E    TL+   + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLE--RDTLQPLMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+AR
Sbjct: 140 QVLEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVKASALLNEP 241


>gi|168235310|ref|ZP_02660368.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|194735049|ref|YP_002116641.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|194710551|gb|ACF89772.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197291430|gb|EDY30782.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
          Length = 320

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|238798823|ref|ZP_04642292.1| hypothetical protein ymoll0001_38940 [Yersinia mollaretii ATCC
           43969]
 gi|238717331|gb|EEQ09178.1| hypothetical protein ymoll0001_38940 [Yersinia mollaretii ATCC
           43969]
          Length = 352

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 94/228 (41%), Gaps = 4/228 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  AAQAGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAREMAVKAHNQGREILIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRQAVSNVPYAKGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR++     E
Sbjct: 137 KVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           +AR  G AI +      +I+V+ Q L Q    D+ +V  S L      
Sbjct: 197 LARRNGSAIAIGHPHPATIKVLQQMLPQLPS-DIVLVRPSALLNEPQQ 243


>gi|238750811|ref|ZP_04612309.1| hypothetical protein yrohd0001_10680 [Yersinia rohdei ATCC 43380]
 gi|238710955|gb|EEQ03175.1| hypothetical protein yrohd0001_10680 [Yersinia rohdei ATCC 43380]
          Length = 341

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 94/226 (41%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G      +  I  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  AAQAGKLSIVIDDFGYRPQN-ENKILQMPLPISVAILPNAPYAREMAVKAHNQGREILIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR++     E
Sbjct: 137 KVMQVLEHYQLYFLDSVTIGNSQASNAAQGTGVKVIKRKVFLDDSQNEAAIRQQFTRAVE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 197 LARRNGSAIAIGHPHPSTIKVLQQMLPQLPS-DIVLVKPSALLNEP 241


>gi|288958439|ref|YP_003448780.1| hypothetical protein AZL_015980 [Azospirillum sp. B510]
 gi|288910747|dbj|BAI72236.1| hypothetical protein AZL_015980 [Azospirillum sp. B510]
          Length = 375

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 71/388 (18%), Positives = 141/388 (36%), Gaps = 21/388 (5%)

Query: 9   LRKKTPKRKSFYSQII----SRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIR 64
           + +K P R    S         L                  ++    G            
Sbjct: 1   MARKAPSRARKSSLPPFLSNPFLLALAAVAAVFAVAIGVATLTGGRSGGEPAQQAAVRPA 60

Query: 65  EIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTS 124
            +           + +    +          ++   +     Q         ++P  +T 
Sbjct: 61  AVPAPAPPALPAAKTEAPAQQATAPQAAEGPEHAVPERPASAQPQAE-----SRPPATTV 115

Query: 125 IDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQ 184
               P +   +          A  +      EVP              IAIV+  +G+ +
Sbjct: 116 AMLPPPVPPAVAPVQPPPGNAALWRRNALPAEVPPG---------KPVIAIVIDDMGLDR 166

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
             + R +  L   +TL++      L    K A+  G E +L +PM+       +     L
Sbjct: 167 RRSTR-MASLHGPLTLSWLPYARDLSAQSKAARANGHELMLHMPMEPS--VKADPGPNAL 223

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
            V+    +++ R R +L    GY GV N+ G+   +++ +   +  E  +RGLL+ D  +
Sbjct: 224 LVSLDKGEIVKRFRAALDSFDGYVGVNNHMGSRFTADRAALAPVLAELHRRGLLWLDSRT 283

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
           +P +    LA +L +P++  D++LD+Q     ++ +L   E++A+  G A+ +    D +
Sbjct: 284 TPNSAGIGLAQELKMPWVGRDVFLDNQETVAAVKAQLAKTEQVAKRQGYAVAIGHPHDAT 343

Query: 365 IEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           IE ++ WL     R   +VP+S + +  
Sbjct: 344 IEALASWLPDVQKRGFVLVPVSAVVRTH 371


>gi|237728916|ref|ZP_04559397.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226909538|gb|EEH95456.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 311

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 95/229 (41%), Gaps = 4/229 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F +     ++AIV+   G  +  T+  +  +P+ I++A   N         +A   G E 
Sbjct: 18  FATPVFAGKLAIVIDDFGY-RPHTENQVLAMPSTISVAVLPNAPHAREMAIKAHNSGHEV 76

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+   + +++   +R ++ +     G+ N+ G+ + S+  
Sbjct: 77  LIHLPMAPLSKQPLE--KDTLRPEMSSEEIERIIRDAVSKVPNAVGLNNHMGSAMTSSLF 134

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +  L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 135 GMQKVMQALERYDLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             E+AR  G AI +      ++ V+ Q L      D+++V  S L    
Sbjct: 195 AVELARRNGSAIAIGHPHPSTVRVLQQMLYSLPA-DITLVRPSSLLNEP 242


>gi|302391080|ref|YP_003826900.1| hypothetical protein Acear_0286 [Acetohalobium arabaticum DSM 5501]
 gi|302203157|gb|ADL11835.1| protein of unknown function DUF610 YibQ [Acetohalobium arabaticum
           DSM 5501]
          Length = 380

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 103/227 (45%), Gaps = 4/227 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                 AR+A ++  LG ++ GT   +  +   +T+A            ++A + G E +
Sbjct: 157 TQPKVKARMAFIIDDLGFNRDGTAE-LMEIDRPLTVAVLPFRPYSTSDAEKAVQAGHEIL 215

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGT-GYFGVMNYRGAMLLSNKE 283
           L +PM+             +      +++   ++  L        GV N+ G+ + ++ +
Sbjct: 216 LHLPMEPSS--PVSPGEGAIYTDMAPEEIRTTIQKGLASLGVEVAGVNNHMGSKVTADNK 273

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +  V+     ++ L F D  ++PR++    A ++   Y V  L++D+  D+++I ++++ 
Sbjct: 274 TMSVVLDYLHQQDLFFIDSSTAPRSVVPAAAREVGESYAVNHLFIDNIDDKERINKQIQY 333

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           L ++A   G+ I +      +I+ I + + +   + + +V +S L K
Sbjct: 334 LADVALKQGELITIGHIKPNTIQAIKELIPKLEEKGIQLVYVSELVK 380


>gi|90020140|ref|YP_525967.1| hypothetical protein Sde_0491 [Saccharophagus degradans 2-40]
 gi|89949740|gb|ABD79755.1| protein of unknown function DUF610, YibQ [Saccharophagus degradans
           2-40]
          Length = 382

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 62/304 (20%), Positives = 125/304 (41%), Gaps = 7/304 (2%)

Query: 94  QLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLIL---GLSKKELLAKNKV 150
             +N  ++   + + + +   +  KP             +         + K +  +  +
Sbjct: 69  TSENLPAEKTERPRTEQTPPLITAKPAEPGEPSESIGHTQTHTAENEPAAAKAVEDEPAI 128

Query: 151 GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
                    ++    S  +  RIAI++  +G      +  I  LP  +T AF        
Sbjct: 129 EVIAKPAVPVNITEQSTVTSPRIAIIIDDIGYRFDEGRELI-ELPYPLTFAFIPFSPYGA 187

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
           R  + AK+  +  +L  PM   +ES  E    +L  T    +L+  L   L       GV
Sbjct: 188 RLAELAKQLNKPVMLHAPMATLNESKWEA---SLNPTMARTELIASLDAMLADIPHVTGV 244

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            N+ G++   ++ES + + +  A+R L F D  ++ +++ +  A ++N+P+   D++LD+
Sbjct: 245 NNHGGSLFTQSRESMQWLSEALAERELFFVDSRTTAQSVAKEEAQRVNIPFNERDVFLDN 304

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           + D   I  +L  L  IA   G+A+ +   + E+++ +   L     + V VV +  L  
Sbjct: 305 ERDLPAIDSQLDKLVAIALKHGEAVAIGHPYPETLQALKARLPLLAAQGVEVVGIELLLN 364

Query: 391 LSSP 394
              P
Sbjct: 365 RHRP 368


>gi|146309788|ref|YP_001174862.1| protein of unknown function DUF610, YibQ [Enterobacter sp. 638]
 gi|145316664|gb|ABP58811.1| protein of unknown function DUF610, YibQ [Enterobacter sp. 638]
          Length = 314

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 90/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P  I++A   N         +A   G E +
Sbjct: 18  ASPVYAGKLAIVIDDFGY-RPHNENQVLAMPTAISVAVLPNAPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R +  +     G+ N+ G+ + S+   
Sbjct: 77  IHLPMAPLSKQPLE--KDTLRPDMSSDEIERIIRDAYGKVPFAVGLNNHMGSAMTSSLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +   +     +    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSMTIGNSQALRASQGTGVKVIKRKVFLDDTQNDADIRAQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G AI +      ++ V+ Q L      D+++V  S L    
Sbjct: 195 VQLARRNGSAIAIGHPHPSTVRVLQQMLPTLPS-DITLVRPSDLLNEP 241


>gi|253991822|ref|YP_003043178.1| hypothetical protein PAU_04350 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783272|emb|CAQ86437.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 301

 Score =  256 bits (654), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 97/227 (42%), Gaps = 4/227 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F    S +R+AIV+   G  +   +  I  +P  I++A   +        ++A K+ +E
Sbjct: 16  FFSLQTSASRLAIVIDDFGY-RPHNESKILQMPVAISIAILPDSPYGREMAEKAYKQRRE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+ T + +++   ++ ++++     G+ N+ G+ + S+ 
Sbjct: 75  ILIHLPMAPLSKQRLE--PDTLQPTMSSEEIDRIIQQAIQKVPYAVGMNNHMGSAMTSSL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + +    ++  L F D  +   +     A    +  +  +++LDD     + R +L 
Sbjct: 133 PGMQKVMHSLSRYRLYFLDSVTIGNSQATKAAKGTPVRVIRRNVFLDDVQSEAETRYQLN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
               IAR  G AI +      +I  + + L      D+ +V  S L 
Sbjct: 193 RAISIARKNGSAIAIGHPHPTTIRALQKMLPTLPA-DIELVSPSMLL 238


>gi|218782460|ref|YP_002433778.1| hypothetical protein Dalk_4632 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218763844|gb|ACL06310.1| protein of unknown function DUF610 YibQ [Desulfatibacillum
           alkenivorans AK-01]
          Length = 359

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 56/225 (24%), Positives = 98/225 (43%), Gaps = 2/225 (0%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                R+AI++  +G    G Q     LP  IT +   +          A  KG++ +L 
Sbjct: 135 ADDRPRVAIIIDDMGYGN-GIQHKFLDLPYVITYSILPHSPDQIEIANLAHDKGRQVLLH 193

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+       +    TL  + T   +++ L+  L       GV N+ G+ L     +  
Sbjct: 194 LPMEPMQYPEVDPGPGTLLASMTTDTMMDILKEDLAAVPYIAGVNNHMGSRLTMESGALY 253

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            IF    K+GL F D  ++  ++ R  A    LP+   D++LD       + ++LK L  
Sbjct: 254 PIFTVLKKQGLFFVDSRTTRHSVCRPSARLFQLPFAQRDVFLDHVRTEAFVEKQLKLLVS 313

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
           +A+  GQAIG+   +  + +V++  L       V +VP S L ++
Sbjct: 314 VAKKRGQAIGIGHPYKVTYKVLAARLPAVDAE-VRLVPASDLVRV 357


>gi|16762604|ref|NP_458221.1| hypothetical protein STY4089 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144093|ref|NP_807435.1| hypothetical protein t3813 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213163814|ref|ZP_03349524.1| hypothetical protein Salmoneentericaenterica_28901 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213420031|ref|ZP_03353097.1| hypothetical protein Salmonentericaenterica_20595 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213427149|ref|ZP_03359899.1| hypothetical protein SentesTyphi_16972 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213647904|ref|ZP_03377957.1| hypothetical protein SentesTy_11844 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824144|ref|ZP_06543741.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|25367617|pir||AD0974 probable exported protein STY4089 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|16504909|emb|CAD03288.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29139730|gb|AAO71295.1| putative exported protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 320

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +     E
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRTIE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 197 LARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 241


>gi|150392120|ref|YP_001322169.1| protein of unknown function DUF610, YibQ [Alkaliphilus
           metalliredigens QYMF]
 gi|149951982|gb|ABR50510.1| protein of unknown function DUF610, YibQ [Alkaliphilus
           metalliredigens QYMF]
          Length = 286

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 44/252 (17%), Positives = 102/252 (40%), Gaps = 7/252 (2%)

Query: 149 KVGREDTEVPAMDKNFCSNASGAR--IAIVVSGLGISQTGTQRAINLLPANITLAFASNG 206
           +  +    +           +  +  +AIV+   G + +GT   +N++   +T A     
Sbjct: 36  RNEQNPLWMSREASVIEETVAETKGIVAIVIDDFGNNGSGTDEMMNII-QPLTFAVIPFL 94

Query: 207 NSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTG 266
                  K A K G E I+ IPM+    +        +    T +++ + +  ++     
Sbjct: 95  PYSQEEAKRANKAGHEVIVHIPMEPKKGNPKWLGDRGITSNLTSEEVHSIVLEAIEDVQY 154

Query: 267 YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADL 326
             G  N+ G+ +  +K   E + +      +   D  +S  ++ + +A + N+P +   +
Sbjct: 155 AVGANNHMGSKITEDKRIMEAVMQVLKANDMYMIDSKTSQTSIVKEVADQYNVPVLERAI 214

Query: 327 YLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSV 382
           +LD++ + + I+ +++ L  +A  +G A+ +     E    + E I Q L     + + +
Sbjct: 215 FLDNEKNVEAIKRQIEKLAVVALESGSAVAIGHVGPEGGRITAEAIKQMLPYLQEKGIEI 274

Query: 383 VPLSCLAKLSSP 394
           +P S L      
Sbjct: 275 MPASKLLNKPRQ 286


>gi|315648451|ref|ZP_07901550.1| divergent polysaccharide deacetylase [Paenibacillus vortex V453]
 gi|315276145|gb|EFU39491.1| divergent polysaccharide deacetylase [Paenibacillus vortex V453]
          Length = 295

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 97/225 (43%), Gaps = 5/225 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++A+++   G  Q GTQ  +  LP  IT+A      +  +  + A K G + I+ +PM+ 
Sbjct: 63  KLAVIIDDFGNGQKGTQE-MLSLPVKITVAVMPFLPTSKKDAESAHKMGHDVIIHMPMEP 121

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +  + T +++  R+  ++       G+ N+ G+ +  ++    ++   
Sbjct: 122 KQGRASWLGPGAILSSLTDEEIRKRMEEAIDSVPYAIGINNHMGSKVTGDERIMSIVLDV 181

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             +RGL F D  ++ R++   LA +  +P +  D++LDD      + ++L    + A   
Sbjct: 182 CKERGLFFMDSKTNYRSVVGKLAAEKGMPAIANDIFLDDVHTVQHVSKQLVTAAQHAEER 241

Query: 352 GQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
              I +         + E +   + +   + V  V +S L +  S
Sbjct: 242 TSCIAIGHVGVFGTRTAEALKVSIPELQKK-VEFVGISDLVRERS 285


>gi|51594416|ref|YP_068607.1| hypothetical protein YPTB0058 [Yersinia pseudotuberculosis IP
           32953]
 gi|153950008|ref|YP_001399074.1| divergent polysaccharide deacetylase [Yersinia pseudotuberculosis
           IP 31758]
 gi|170026350|ref|YP_001722855.1| hypothetical protein YPK_4143 [Yersinia pseudotuberculosis YPIII]
 gi|186893404|ref|YP_001870516.1| hypothetical protein YPTS_0060 [Yersinia pseudotuberculosis PB1/+]
 gi|51587698|emb|CAH19298.1| HYPOTHETICAL 30.7 KD PROTEIN IN SECB-TDH INTERGENIC REGION
           [Yersinia pseudotuberculosis IP 32953]
 gi|152961503|gb|ABS48964.1| Divergent polysaccharide deacetylase [Yersinia pseudotuberculosis
           IP 31758]
 gi|169752884|gb|ACA70402.1| protein of unknown function DUF610 YibQ [Yersinia
           pseudotuberculosis YPIII]
 gi|186696430|gb|ACC87059.1| protein of unknown function DUF610 YibQ [Yersinia
           pseudotuberculosis PB1/+]
          Length = 336

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 46/233 (19%), Positives = 94/233 (40%), Gaps = 4/233 (1%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S A   +++IV+   G      +  I  +P  I++A   N         +A  +G+E
Sbjct: 16  FIASTAQAGKLSIVIDDFGYRPQN-ENKILQMPLPISVAILPNAPYAREMATKAHNQGRE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+ + + +++   +R +        G+ N+ G+ + ++ 
Sbjct: 75  ILIHLPMAPQSKQPLE--RDTLQPSMSSEEIQRIIRQAANNVPYAKGMNNHMGSAMTASL 132

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
              + + +      L F D  +   +     A    +  +   ++LDD  +   IR++  
Sbjct: 133 PGMQKVMQALGSYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKIFLDDSQNEAAIRQQFN 192

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
               +AR  G AI +      +I+V+ Q L Q    D+ +V  S L      S
Sbjct: 193 RAVALARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLNEPVQS 244


>gi|212712560|ref|ZP_03320688.1| hypothetical protein PROVALCAL_03655 [Providencia alcalifaciens DSM
           30120]
 gi|212684776|gb|EEB44304.1| hypothetical protein PROVALCAL_03655 [Providencia alcalifaciens DSM
           30120]
          Length = 357

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 99/229 (43%), Gaps = 4/229 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
             S A++AIV+   G  +      I  LP  I++A   N          A ++G++ ++ 
Sbjct: 21  QVSAAKLAIVIDDFGY-RVKEDNQILALPVAISIAILPNSPHGAEVAATAYQQGRDILIH 79

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+   +   E    TL  + + +++   ++ ++ R     G+ N+ G+ + S+     
Sbjct: 80  MPMKPLSKQPLE--KDTLAPSMSAEEVDRIIKNAISRVPHAKGMNNHMGSEMTSSLSGMR 137

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +  ++  L F D  +         A +  +P    ++++D+    ++ R +L     
Sbjct: 138 NVMRSLSQSNLFFLDSVTIGNTQAVNAAKEFGVPSAKRNIFIDNHQSEEETRTQLNKAIA 197

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            AR  G A+ +      ++  + +++ Q    D+ +VP+S L    S +
Sbjct: 198 YARKHGSAVAIGHPHPSTVRALQKFIPQVPA-DIELVPVSTLVNHQSAT 245


>gi|290477275|ref|YP_003470196.1| hypothetical protein XBJ1_4335 [Xenorhabdus bovienii SS-2004]
 gi|289176629|emb|CBJ83438.1| conserved hypothetical protein; putative exported protein
           [Xenorhabdus bovienii SS-2004]
          Length = 335

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 98/229 (42%), Gaps = 5/229 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  AR+AIV+   G  +   +  I  +P  +++A   +        ++A K+G+E ++ +
Sbjct: 32  AHAARLAIVIDDFGY-RVHHENKILQMPTAVSIAILPDSPHGREMAQKAHKQGREILIHL 90

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E    TL  + + +++   +  ++++     G+ N+ G+ + S+    E 
Sbjct: 91  PMAPLSKQPLE--KNTLHPSMSREEIGRIIHDAIQKVPHAMGMNNHMGSAMTSSLNGMEN 148

Query: 288 IFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           + +  +    L F D  +  +      A    +  +   ++LD+     + R +L     
Sbjct: 149 VMQVLSSYHHLYFLDSVTIGKTQVTKAAMGTPVQVLRRHVFLDNVQTEAETRHQLNRAIA 208

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           +AR  G AI +   +  ++  + Q L      D+ +V  S L   +S S
Sbjct: 209 LARKQGSAIAIGHPYPTTVRALQQALTALPD-DIELVTPSRLLNPTSAS 256


>gi|217971260|ref|YP_002356011.1| hypothetical protein Sbal223_0044 [Shewanella baltica OS223]
 gi|217496395|gb|ACK44588.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS223]
          Length = 251

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 95/227 (41%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    E  
Sbjct: 73  HLPMQALNGKA--LGLGGLTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDEPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+      +  +   + 
Sbjct: 131 LWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDTSTKALERQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             A T G  + +A  + E++  +   LQ+     + +VP S L  + 
Sbjct: 191 SQAHTQGSLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPIG 237


>gi|26250262|ref|NP_756302.1| hypothetical protein c4440 [Escherichia coli CFT073]
 gi|91213132|ref|YP_543118.1| hypothetical protein UTI89_C4159 [Escherichia coli UTI89]
 gi|218560689|ref|YP_002393602.1| polysaccharide deacetylase [Escherichia coli S88]
 gi|227883784|ref|ZP_04001589.1| divergent polysaccharide deacetylase [Escherichia coli 83972]
 gi|237703387|ref|ZP_04533868.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|300984983|ref|ZP_07177235.1| divergent polysaccharide deacetylase [Escherichia coli MS 45-1]
 gi|301047406|ref|ZP_07194486.1| divergent polysaccharide deacetylase [Escherichia coli MS 185-1]
 gi|26110691|gb|AAN82876.1|AE016768_294 Hypothetical protein yibQ precursor [Escherichia coli CFT073]
 gi|91074706|gb|ABE09587.1| hypothetical protein YibQ precursor [Escherichia coli UTI89]
 gi|218367458|emb|CAR05240.1| putative polysaccharide deacetylase [Escherichia coli S88]
 gi|226902651|gb|EEH88910.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|227839062|gb|EEJ49528.1| divergent polysaccharide deacetylase [Escherichia coli 83972]
 gi|294494032|gb|ADE92788.1| polysaccharide deacetylase family protein [Escherichia coli
           IHE3034]
 gi|300300680|gb|EFJ57065.1| divergent polysaccharide deacetylase [Escherichia coli MS 185-1]
 gi|300408263|gb|EFJ91801.1| divergent polysaccharide deacetylase [Escherichia coli MS 45-1]
 gi|307555716|gb|ADN48491.1| hypothetical protein YibQ precursor [Escherichia coli ABU 83972]
 gi|307628691|gb|ADN72995.1| putative polysaccharide deacetylase [Escherichia coli UM146]
 gi|315285352|gb|EFU44797.1| divergent polysaccharide deacetylase [Escherichia coli MS 110-3]
 gi|315292992|gb|EFU52344.1| divergent polysaccharide deacetylase [Escherichia coli MS 153-1]
 gi|323949856|gb|EGB45740.1| divergent polysaccharide deacetylase [Escherichia coli H252]
 gi|323954843|gb|EGB50623.1| divergent polysaccharide deacetylase [Escherichia coli H263]
          Length = 319

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRMQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|161505759|ref|YP_001572871.1| hypothetical protein SARI_03935 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867106|gb|ABX23729.1| hypothetical protein SARI_03935 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 320

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 93/229 (40%), Gaps = 4/229 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F       ++AIV+   G  +  T+  +  LP +I++A   N         +A   G E 
Sbjct: 17  FAQPVFAGKLAIVIDDFGY-RPHTENQVLALPPDISVAVLPNAPQAREMATKAHNSGHEV 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+   +  ++   +R +++      G+ N+ G+ + S+  
Sbjct: 76  LIHLPMAPLSKQPLE--KDTLRPEMSSDEIDRIIREAVKNVPYAVGLNNHMGSAMTSSLF 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 134 GMQKVMQALEHYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNR 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             E+AR  G AI +      ++ V+ Q + +    D+++V  S L    
Sbjct: 194 AIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLVRPSSLLNEP 241


>gi|258514447|ref|YP_003190669.1| hypothetical protein Dtox_1161 [Desulfotomaculum acetoxidans DSM
           771]
 gi|257778152|gb|ACV62046.1| protein of unknown function DUF610 YibQ [Desulfotomaculum
           acetoxidans DSM 771]
          Length = 293

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 50/238 (21%), Positives = 99/238 (41%), Gaps = 3/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
             +   D++       A++AIV+   G S       +  +   +T A   N  +  +   
Sbjct: 55  VGMNKNDQSASKKVKKAQVAIVIDDFGQSNREGVMEMLSINRPLTFAVMPNLENSVKDAA 114

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
            AK+KG E I+ +PMQ             +     V+Q+  R+     +     G  N+ 
Sbjct: 115 MAKEKGFEIIVHLPMQPISGKSRWMGPGGITFDMGVEQIRQRVLQDFDQVPFAVGFNNHM 174

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+++ S ++    I +   ++G    D  ++  +    ++  L +P    D++LD+  + 
Sbjct: 175 GSLITSKEKLMSPILEVAKEKGFFVLDSRTTEDSKVVSISKSLGIPCAKRDVFLDEVKNY 234

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAF---DESIEVISQWLQQEHVRDVSVVPLSCLA 389
           + ++++LK L  IA T G AIG+        +    IS+ +     + +  V LS L 
Sbjct: 235 EHMKKQLKVLSTIALTKGTAIGIGHVGQGDKKMALAISEMIPVMEEQGIEFVYLSKLV 292


>gi|300939215|ref|ZP_07153896.1| divergent polysaccharide deacetylase [Escherichia coli MS 21-1]
 gi|300455896|gb|EFK19389.1| divergent polysaccharide deacetylase [Escherichia coli MS 21-1]
          Length = 319

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|298530220|ref|ZP_07017622.1| protein of unknown function DUF610 YibQ [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509594|gb|EFI33498.1| protein of unknown function DUF610 YibQ [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 440

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 57/270 (21%), Positives = 114/270 (42%), Gaps = 8/270 (2%)

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
             +     K++  A N  G     +    +          + I++  LG       R + 
Sbjct: 165 AEIKPQDPKRQKWAINISGHTTHVLHLGIQKPDRQKGSGSLVIIIDDLGECLEF-ARKLA 223

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESY-NEDDSYTLKVTQTVQ 251
            L   +T +     +  +   + A KK  E +L +PM+        E     L V  T +
Sbjct: 224 ELNFPVTYSILPYLHKTEEVAEFASKKDFEVMLHMPMEPDTYHRGVEPGPGALFVDMTPR 283

Query: 252 QLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
           ++  +L +SL +     G+ N+ G+    + E  +V+F+E  KR + F D  ++P ++ R
Sbjct: 284 EIRRQLVHSLEQVPQATGMNNHMGSAFTRHYEGMQVVFEELEKRDMFFLDSVTTPDSVAR 343

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
            LA +  L +M   ++LD+      I  +L+  E++A   G A+ +   + E++E + QW
Sbjct: 344 RLARETGLDFMQRHVFLDNVRSIQAITYQLQKAEQLASRHGMAVAIGHPYPETLEALQQW 403

Query: 372 LQQEHVRDVSVVPLSCLA-----KLSSPSS 396
            +    + +++  +  L      +  S SS
Sbjct: 404 SKNRDAK-INMASVDELLLQQRIRAVSSSS 432


>gi|332996160|gb|EGK15787.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri VA-6]
          Length = 319

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|256021379|ref|ZP_05435244.1| putative polysaccharide deacetylase [Shigella sp. D9]
 gi|332282613|ref|ZP_08395026.1| polysaccharide deacetylase [Shigella sp. D9]
 gi|332104965|gb|EGJ08311.1| polysaccharide deacetylase [Shigella sp. D9]
          Length = 319

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|37528651|ref|NP_931996.1| hypothetical protein plu4842 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36788090|emb|CAE17214.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 271

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 46/223 (20%), Positives = 94/223 (42%), Gaps = 4/223 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
               AR+AIV+   G  +   +  I  +P  I++A   +        ++A K+G+E ++ 
Sbjct: 26  QTGAARLAIVIDDFGY-RPHNENKILQMPVAISIAILPDSPHGREMAEKAYKQGREILIH 84

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ T + + +   ++ ++++     G+ N+ G+ + S+    +
Sbjct: 85  LPMAPLSKQLLE--PDTLQPTMSSEDIDRIIQRAIQKVPYAVGINNHMGSAMTSSLPGMQ 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +  +   L F D  +         A    +  +  +++LDD     + R +L     
Sbjct: 143 KVMRSLSGYNLYFLDSVTIGNTQATKAAQGTPVRVIRRNVFLDDVQSEAETRHQLNRAIS 202

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           IAR  G AI +      +I  + Q L      D+ +V  S L 
Sbjct: 203 IARKNGSAIAIGHPHSTTIRALQQMLPTLPA-DIELVSPSRLL 244


>gi|320644962|gb|EFX13992.1| putative polysaccharide deacetylase [Escherichia coli O157:H- str.
           493-89]
 gi|320650229|gb|EFX18718.1| putative polysaccharide deacetylase [Escherichia coli O157:H- str.
           H 2687]
          Length = 319

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|270265206|ref|ZP_06193468.1| hypothetical protein SOD_l00560 [Serratia odorifera 4Rx13]
 gi|270040840|gb|EFA13942.1| hypothetical protein SOD_l00560 [Serratia odorifera 4Rx13]
          Length = 321

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 96/232 (41%), Gaps = 4/232 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
              A   +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E +
Sbjct: 18  VCAAQAGKLSIVIDDVGY-RPHEEGAVLQMPTAISVAVLPNAPHARLMATRAHSQGREVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+   
Sbjct: 77  IHMPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +      L F D  +   +     A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALESYRLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDDTANEADIRRQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            ++AR  G AI +      +++V+ Q L      D+ +V  S L      +S
Sbjct: 195 VDLARRNGSAIAIGHPRPATVKVLQQMLPTLPA-DIVLVKPSSLLNEPQSNS 245


>gi|218707251|ref|YP_002414770.1| putative polysaccharide deacetylase [Escherichia coli UMN026]
 gi|293407240|ref|ZP_06651164.1| yibQ protein [Escherichia coli FVEC1412]
 gi|298382986|ref|ZP_06992581.1| yibQ protein [Escherichia coli FVEC1302]
 gi|300898550|ref|ZP_07116882.1| divergent polysaccharide deacetylase [Escherichia coli MS 198-1]
 gi|218434348|emb|CAR15272.1| putative polysaccharide deacetylase [Escherichia coli UMN026]
 gi|284923650|emb|CBG36747.1| putative polysaccharide deacetylase [Escherichia coli 042]
 gi|291426051|gb|EFE99085.1| yibQ protein [Escherichia coli FVEC1412]
 gi|298276822|gb|EFI18340.1| yibQ protein [Escherichia coli FVEC1302]
 gi|300357770|gb|EFJ73640.1| divergent polysaccharide deacetylase [Escherichia coli MS 198-1]
          Length = 319

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|238764340|ref|ZP_04625291.1| hypothetical protein ykris0001_18390 [Yersinia kristensenii ATCC
           33638]
 gi|238697491|gb|EEP90257.1| hypothetical protein ykris0001_18390 [Yersinia kristensenii ATCC
           33638]
          Length = 336

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 98/234 (41%), Gaps = 8/234 (3%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  AVQAGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAKEMAIKAHNQGREILIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--RDTLQPSMSSEEVQRIIRQAVSNVPYATGMNNHMGSAMTSSFPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR++     E
Sbjct: 137 KVMQALEHYQLYFLDSMTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL----AKLSSPSS 396
           +AR  G AI +      +I+V+ Q L Q    D+ +V  S L     + +S SS
Sbjct: 197 LARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVRPSALLNEPVRNNSGSS 249


>gi|168766036|ref|ZP_02791043.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4486]
 gi|189364563|gb|EDU82982.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4486]
          Length = 319

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|293413051|ref|ZP_06655719.1| yibQ protein [Escherichia coli B354]
 gi|331675098|ref|ZP_08375855.1| YibQ protein product [Escherichia coli TA280]
 gi|291468698|gb|EFF11191.1| yibQ protein [Escherichia coli B354]
 gi|331068007|gb|EGI39405.1| YibQ protein product [Escherichia coli TA280]
          Length = 319

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|331685279|ref|ZP_08385865.1| YibQ protein product [Escherichia coli H299]
 gi|331077650|gb|EGI48862.1| YibQ protein product [Escherichia coli H299]
          Length = 319

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|296100521|ref|YP_003610667.1| hypothetical protein ECL_00150 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295054980|gb|ADF59718.1| hypothetical protein ECL_00150 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 310

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/228 (18%), Positives = 90/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            +     ++AIV+   G  +   +  +  +PA I++A   N         +A   G + +
Sbjct: 18  VAPVYAGKLAIVIDDFGY-RPHYENQVLAMPAAISVAVLPNAPHAREMATKAHNSGHQVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R +  +     G+ N+ G+ + S+   
Sbjct: 77  IHLPMAPISKQPLE--KDTLRPEMSSDEIDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              + +   +  L F D  +   +     A    +  +   ++LDD  +   IR +    
Sbjct: 135 MLKVMQALERYNLYFLDSMTIGNSQAMRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G AI +      ++ V+ Q L      D+++V  S L    
Sbjct: 195 VQLARRNGSAIAIGHPHPSTVRVLQQMLPTLPS-DITLVRPSDLLNEP 241


>gi|88858432|ref|ZP_01133074.1| hypothetical protein PTD2_13619 [Pseudoalteromonas tunicata D2]
 gi|88820049|gb|EAR29862.1| hypothetical protein PTD2_13619 [Pseudoalteromonas tunicata D2]
          Length = 251

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 95/227 (41%), Gaps = 4/227 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            +   ++AIV+  +G        AI  LP  ++ +          + ++A+   +E +L 
Sbjct: 12  FSYAGQVAIVIDDIGY-HERDLDAI-NLPGEVSFSILPFTPFAKSFAQQAQLAKKEMLLH 69

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQA      E     +      +QL + L  +L       G+ N+ G++L    +   
Sbjct: 70  VPMQAISGK--ELGPGAITYDMNKEQLQHMLARALDDLPQVKGINNHMGSLLTQKIKPMS 127

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
              +   +R L F D  ++  +  + +A    +  +   +++D+     ++  ++  L  
Sbjct: 128 WTMEVLKERNLYFLDSKTTQHSQAQHMANLFGVDNISRHVFIDNIPSEKQMTFRMNQLIR 187

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +A+    AI +A  + E++  + Q L +   + + +VPLS L     
Sbjct: 188 LAKKNDYAIAIAHPYPETLAFLEQALPKLAEQGIKLVPLSDLVTKKY 234


>gi|323166902|gb|EFZ52641.1| divergent polysaccharide deacetylase family protein [Shigella
           sonnei 53G]
          Length = 319

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 89/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G      +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGYRPNN-ENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|242279092|ref|YP_002991221.1| hypothetical protein Desal_1620 [Desulfovibrio salexigens DSM 2638]
 gi|242121986|gb|ACS79682.1| protein of unknown function DUF610 YibQ [Desulfovibrio salexigens
           DSM 2638]
          Length = 418

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 53/235 (22%), Positives = 105/235 (44%), Gaps = 2/235 (0%)

Query: 154 DTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
                        + +  ++AIV+  +G       + +  L A IT +   N + + + +
Sbjct: 182 PVVKKQKPAPVKLDPNAPKLAIVIDDMGEDLKL-AKGLAALDAKITFSIWPNSSHVKKTI 240

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
             AKK G E ++ +PMQ          +  L V     ++ +    ++ +  G  G+ N+
Sbjct: 241 AIAKKSGNEIMVHLPMQPKGYPKVNPGADALLVGMDADKISSITLAAIAKVPGATGLNNH 300

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+    N        K+  K+ L F D  ++P++  R  A K  + +   +++LD+  D
Sbjct: 301 MGSSFTENYNGMLAALKQLNKKHLFFLDSRTTPKSACRRAASKAGVTFYERNIFLDNVKD 360

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              I+ +L    +IAR +GQAI +     E+++ I QW+ +   + + +VP+S L
Sbjct: 361 VGAIKYQLSKAAKIARKSGQAIAIGHPNHETLKAIRQWVAENKGK-IRIVPVSSL 414


>gi|238783976|ref|ZP_04627992.1| hypothetical protein yberc0001_4960 [Yersinia bercovieri ATCC
           43970]
 gi|238715084|gb|EEQ07080.1| hypothetical protein yberc0001_4960 [Yersinia bercovieri ATCC
           43970]
          Length = 342

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 94/226 (41%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ 
Sbjct: 20  AAQAGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAREMAVKAHNQGREILIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--RDTLQPSMSSEEIQRIIRQAVNNVPYAKGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR++     E
Sbjct: 137 RVMQALEHYQLYFLDSVTIGNSQASRAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVE 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 197 LARRNGSAIAIGHPHPATIKVLQQMLPQLPS-DIVLVKPSALLNEP 241


>gi|188493391|ref|ZP_03000661.1| divergent polysaccharide deacetylase [Escherichia coli 53638]
 gi|218697338|ref|YP_002405005.1| putative polysaccharide deacetylase [Escherichia coli 55989]
 gi|293417079|ref|ZP_06659706.1| hypothetical protein ECDG_04229 [Escherichia coli B185]
 gi|293463941|ref|ZP_06664355.1| hypothetical protein ECCG_04022 [Escherichia coli B088]
 gi|309784406|ref|ZP_07679045.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 1617]
 gi|188488590|gb|EDU63693.1| divergent polysaccharide deacetylase [Escherichia coli 53638]
 gi|218354070|emb|CAV00606.1| putative polysaccharide deacetylase [Escherichia coli 55989]
 gi|291321573|gb|EFE61009.1| hypothetical protein ECCG_04022 [Escherichia coli B088]
 gi|291431110|gb|EFF04103.1| hypothetical protein ECDG_04229 [Escherichia coli B185]
 gi|308927913|gb|EFP73381.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 1617]
 gi|320201358|gb|EFW75939.1| putative divergent polysaccharide deacetylase [Escherichia coli
           EC4100B]
 gi|323934840|gb|EGB31222.1| divergent polysaccharide deacetylase [Escherichia coli E1520]
 gi|324116044|gb|EGC09970.1| divergent polysaccharide deacetylase [Escherichia coli E1167]
          Length = 319

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|332159700|ref|YP_004296277.1| hypothetical protein YE105_C0076 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325663930|gb|ADZ40574.1| hypothetical protein YE105_C0076 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330861126|emb|CBX71390.1| uncharacterized protein yibQ [Yersinia enterocolitica W22703]
          Length = 334

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 93/223 (41%), Gaps = 4/223 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLE--RDTLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR++     E+AR
Sbjct: 140 QTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIRQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVKASALLNEP 241


>gi|120556079|ref|YP_960430.1| protein of unknown function DUF610, YibQ [Marinobacter aquaeolei
           VT8]
 gi|120325928|gb|ABM20243.1| protein of unknown function DUF610, YibQ [Marinobacter aquaeolei
           VT8]
          Length = 272

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 96/223 (43%), Gaps = 3/223 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             IAI++  +G ++   +R +  L   +TLAF           K A  + +E +L  PM 
Sbjct: 31  PTIAIIIDDMGHNRHEGER-LARLDQPLTLAFLPYRRHTVPLAKLAHAQSKEIMLHAPMA 89

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
             +          L        +   LR +L+      GV N+ G++L    E  + + K
Sbjct: 90  --NTRNFGLGPGGLTPDMDELAIATTLRRALQSIPFVSGVNNHMGSLLTQQLEPMDWVMK 147

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E  +  + F D  +   ++   +A   N+P +  D++LD +   + + ++ K L + AR 
Sbjct: 148 ELDRYPVYFVDSRTIANSIAGSVADAYNIPSLTRDVFLDHEQTEEFVDKQFKLLIQTARE 207

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            G AIG+      +++ + + L     + +++  +S L  + +
Sbjct: 208 KGTAIGIGHPHKVTVDYLEKHLPMLDEQGIAIATVSGLWAMRN 250


>gi|320193877|gb|EFW68510.1| putative divergent polysaccharide deacetylase [Escherichia coli
           WV_060327]
          Length = 319

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRMQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|114565173|ref|YP_752687.1| protein of unknown function DUF610, YibQ [Shewanella frigidimarina
           NCIMB 400]
 gi|114336466|gb|ABI73848.1| protein of unknown function DUF610, YibQ [Shewanella frigidimarina
           NCIMB 400]
          Length = 238

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 99/223 (44%), Gaps = 4/223 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
             A+  ++AI++  +G     T  A   LP++ITL+   +     +  ++   KG E +L
Sbjct: 1   MPATATKLAIIIDDIGYRL--TDEAALSLPSSITLSVLPHTPLGQKLAQDGYHKGHEIML 58

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L       Q+  +L+ +        G  N+ G++L    E  
Sbjct: 59  HLPMQALNGKA--LGPGGLTNDMNEAQIKQQLQSAFSNIPFAKGANNHMGSLLTQMDEPM 116

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   ++LD+ +    +  + + + 
Sbjct: 117 LWVMQSLKQQQLFFVDSFTTKYTKASSKAMQLGVPSLRRHIFLDNDIGERALERQFQQMI 176

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             ++  G+ + +A  + E+I  ++  L + +  D+++VP S L
Sbjct: 177 TQSKQQGKLVVIAHPYPETIRFLNANLARLNDNDITLVPTSQL 219


>gi|78223057|ref|YP_384804.1| hypothetical protein Gmet_1850 [Geobacter metallireducens GS-15]
 gi|78194312|gb|ABB32079.1| protein of unknown function DUF610, YibQ [Geobacter metallireducens
           GS-15]
          Length = 320

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 112/283 (39%), Gaps = 3/283 (1%)

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
            + +  +    K      + +   +  R      +  +                 +    
Sbjct: 40  IDGLLNQKRPEKKPEPPKVVARHKLPPRESAAEKEPVVHEDYTATVVPPPTERHVRPR-- 97

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A    +AI++  +G       R+I  +   +T +       + +  +EA+++G EA++ 
Sbjct: 98  PAGSGNLAIIIDDMGKGMQE-ARSIIDIGVPVTFSIIPGLPKVRQVAQEAQRRGIEAMIH 156

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+         +   L ++Q+  +++ R+    +      G  N+ G+    NKE   
Sbjct: 157 LPMEPKGYPERRLEENGLLLSQSNDEIVVRMNGYFKEVPQAVGANNHMGSAFTENKEKMA 216

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
           ++ +   ++GL F D  +S  ++    A ++ L      ++LD+  D   I ++++    
Sbjct: 217 IVLRVLKEKGLFFVDSKTSAISVGESTAREMGLRTASRSVFLDNIQDVGYISKQIRQAAS 276

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           IAR  G AI +      +I+ ++  L +     V++VP S L 
Sbjct: 277 IARKRGSAIAICHPHPATIQALAAELPKLRDEGVTLVPASSLV 319


>gi|189424978|ref|YP_001952155.1| hypothetical protein Glov_1919 [Geobacter lovleyi SZ]
 gi|189421237|gb|ACD95635.1| protein of unknown function DUF610 YibQ [Geobacter lovleyi SZ]
          Length = 334

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 59/292 (20%), Positives = 115/292 (39%), Gaps = 2/292 (0%)

Query: 101 QHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM 160
           Q   Q       +  V +  RS+S  S  T +         +             ++P+ 
Sbjct: 45  QKPAQQNKATVQQLPVPQSPRSSSTVSPSTQKPAENATSQTQTKNDYYSGDIHPAQLPSQ 104

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
                  A  A +A++V  +G S     R++  +   I  A              A  KG
Sbjct: 105 TVQR-PTAGRAELAVIVDDMG-SSLQEARSLAAIGLPINFAIIPGLRHDREVALFATGKG 162

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
            E +L +PMQ  +      +   L + Q+ ++L +R+R  L       G  N+ G+    
Sbjct: 163 IEVLLHMPMQPKEYPQRRLEPNGLLLDQSDEELRSRVRGYLELLPQAVGANNHMGSGFTE 222

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           N +   V+     + GL F D  ++P+     +A ++ L     D++LD++ + + IR +
Sbjct: 223 NADKMRVVLNVLKEHGLFFVDSITTPKTTGLKVAAEIKLASARRDVFLDNEQNEEYIRGQ 282

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           L      AR  G+AI +      ++  +++ L +   + +S+V ++ L    
Sbjct: 283 LNQAVARARKNGRAIAICHPHPVTVATLTKALPELQSKGISLVKVTRLITAK 334


>gi|194431299|ref|ZP_03063592.1| polysaccharide deacetylase family protein [Shigella dysenteriae
           1012]
 gi|194420754|gb|EDX36830.1| polysaccharide deacetylase family protein [Shigella dysenteriae
           1012]
 gi|320179953|gb|EFW54895.1| putative divergent polysaccharide deacetylase [Shigella boydii ATCC
           9905]
 gi|332084497|gb|EGI89692.1| divergent polysaccharide deacetylase family protein [Shigella
           dysenteriae 155-74]
 gi|332084797|gb|EGI89980.1| divergent polysaccharide deacetylase family protein [Shigella
           boydii 5216-82]
          Length = 319

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 91/238 (38%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +  A+  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|304412443|ref|ZP_07394050.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS183]
 gi|307305787|ref|ZP_07585533.1| protein of unknown function DUF610 YibQ [Shewanella baltica BA175]
 gi|304349278|gb|EFM13689.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS183]
 gi|306911280|gb|EFN41706.1| protein of unknown function DUF610 YibQ [Shewanella baltica BA175]
          Length = 251

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKA--LGLGGLTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  +   + 
Sbjct: 131 LWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALERQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             A T G  + +A  + E++  +   LQ+     + +VP S L  + 
Sbjct: 191 SQAHTQGSLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPIG 237


>gi|317494739|ref|ZP_07953151.1| divergent polysaccharide deacetylase [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917341|gb|EFV38688.1| divergent polysaccharide deacetylase [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 305

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 96/231 (41%), Gaps = 5/231 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             ++A   ++AIV+   G      +  I  +P  I++A             +A  +G+E 
Sbjct: 17  SAASAYAGKLAIVIDDFGYRPQE-ENKILQMPLAISVAVLPTAPHAREMATKAHAQGREI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+ + +  ++   +  ++       G+ N+ G+++ SN +
Sbjct: 76  LIHLPMAPISKQPLE--KDTLQPSMSEAEIQRIIHQAVNSVPYAVGMNNHMGSLMTSNLQ 133

Query: 284 SAEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             + + +   +   L F D  +   +     +    +  +   ++LDD  +   IR++  
Sbjct: 134 GMQKVMRTLEQYHFLYFLDSMTIGNSQVTNASAGTGIKVIKRRVFLDDSQNEASIRQQFN 193

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
              +IAR  G AI +      ++ V+ Q L      D+ +V  S L   +S
Sbjct: 194 RAIQIARKNGSAIAIGHPHPSTVRVLQQMLPSLPA-DIVLVRPSSLLNGAS 243


>gi|110643858|ref|YP_671588.1| hypothetical protein ECP_3715 [Escherichia coli 536]
 gi|191170375|ref|ZP_03031928.1| polysaccharide deacetylase family protein [Escherichia coli F11]
 gi|215488894|ref|YP_002331325.1| predicted polysaccharide deacetylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218691901|ref|YP_002400113.1| putative polysaccharide deacetylase [Escherichia coli ED1a]
 gi|218702383|ref|YP_002410012.1| putative polysaccharide deacetylase [Escherichia coli IAI39]
 gi|301018946|ref|ZP_07183169.1| divergent polysaccharide deacetylase [Escherichia coli MS 69-1]
 gi|306816035|ref|ZP_07450173.1| putative polysaccharide deacetylase [Escherichia coli NC101]
 gi|312968044|ref|ZP_07782255.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 2362-75]
 gi|331649432|ref|ZP_08350518.1| YibQ protein product [Escherichia coli M605]
 gi|331665242|ref|ZP_08366143.1| YibQ protein product [Escherichia coli TA143]
 gi|110345450|gb|ABG71687.1| hypothetical protein YibQ precursor [Escherichia coli 536]
 gi|190909183|gb|EDV68769.1| polysaccharide deacetylase family protein [Escherichia coli F11]
 gi|215266966|emb|CAS11411.1| predicted polysaccharide deacetylase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218372369|emb|CAR20243.1| putative polysaccharide deacetylase [Escherichia coli IAI39]
 gi|218429465|emb|CAR10430.2| putative polysaccharide deacetylase [Escherichia coli ED1a]
 gi|222035325|emb|CAP78070.1| Uncharacterized protein yibQ [Escherichia coli LF82]
 gi|300399440|gb|EFJ82978.1| divergent polysaccharide deacetylase [Escherichia coli MS 69-1]
 gi|305850431|gb|EFM50888.1| putative polysaccharide deacetylase [Escherichia coli NC101]
 gi|312287303|gb|EFR15212.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 2362-75]
 gi|312948178|gb|ADR29005.1| putative polysaccharide deacetylase [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|315297051|gb|EFU56331.1| divergent polysaccharide deacetylase [Escherichia coli MS 16-3]
 gi|323189343|gb|EFZ74625.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli RN587/1]
 gi|324008122|gb|EGB77341.1| divergent polysaccharide deacetylase [Escherichia coli MS 57-2]
 gi|324012623|gb|EGB81842.1| divergent polysaccharide deacetylase [Escherichia coli MS 60-1]
 gi|330909679|gb|EGH38193.1| putative divergent polysaccharide deacetylase [Escherichia coli
           AA86]
 gi|331041930|gb|EGI14074.1| YibQ protein product [Escherichia coli M605]
 gi|331057752|gb|EGI29738.1| YibQ protein product [Escherichia coli TA143]
          Length = 319

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|318603800|emb|CBY25298.1| putative divergent polysaccharide deacetylase [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 334

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 92/223 (41%), Gaps = 4/223 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             +++IV+   G      +  +  +P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSIVIDDFGYRPQN-ENKVLQMPLPISVAILPNAPYAKEMAIKAHNQGREILIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E    TL+ + + +++   +R ++       G+ N+ G+ + S+    + + 
Sbjct: 82  APLSKQPLE--RDTLQPSMSSEEIQRIIRQAVNNVPYATGMNNHMGSAMTSSLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   I ++     E+AR
Sbjct: 140 QTLEHYQLYFLDSVTIGNSQASKAAEGTGVKVIKRKVFLDDSQNEAAIHQQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             G AI +      +I+V+ Q L Q    D+ +V  S L    
Sbjct: 200 RNGSAIAIGHPHPATIKVLQQMLPQLPA-DIVLVKASALLNEP 241


>gi|297519266|ref|ZP_06937652.1| putative polysaccharide deacetylase [Escherichia coli OP50]
          Length = 319

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 91/238 (38%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S A   ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPALAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|170683133|ref|YP_001745916.1| polysaccharide deacetylase family protein [Escherichia coli
           SMS-3-5]
 gi|170520851|gb|ACB19029.1| polysaccharide deacetylase family protein [Escherichia coli
           SMS-3-5]
          Length = 319

 Score =  253 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|126665725|ref|ZP_01736706.1| hypothetical protein MELB17_04132 [Marinobacter sp. ELB17]
 gi|126629659|gb|EBA00276.1| hypothetical protein MELB17_04132 [Marinobacter sp. ELB17]
          Length = 281

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 49/252 (19%), Positives = 99/252 (39%), Gaps = 3/252 (1%)

Query: 142 KELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLA 201
           K  L+   +    T +  M  N         IAI++  +G  +   +R +  L   ITL+
Sbjct: 2   KPRLSNTSIRILLTMLVGMVSNIALAGPPPTIAIIIDDMGHDRLEGER-LARLEQPITLS 60

Query: 202 FASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSL 261
           F           K +    +E +L  PM   +  +       L       QL   LR +L
Sbjct: 61  FLPYRRHTVELAKLSHSLNKEIMLHAPMA--NTQHFGLGPGGLTEDMDQAQLTRTLRRAL 118

Query: 262 RRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPY 321
           +      GV N+ G++L    +  + +  E  +  L F D  +   ++   +A    +P 
Sbjct: 119 QSVPHVQGVNNHMGSLLTQRLQPMDWVMTELGQYPLYFVDSRTIASSIAGDVARAHRIPS 178

Query: 322 MVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVS 381
              D++LD +   + +  + K L + AR  G AI +      +++ + + L     + ++
Sbjct: 179 FTRDVFLDHEQTEEFVDRQFKLLIQRARQQGTAIAIGHPHKITVDYLEKHLPLLDEQGIA 238

Query: 382 VVPLSCLAKLSS 393
           +  +S +  + +
Sbjct: 239 IATVSGVWAIRN 250


>gi|323173207|gb|EFZ58836.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli LT-68]
          Length = 319

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGY-RPHNENQVLEMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|260870347|ref|YP_003236749.1| putative polysaccharide deacetylase [Escherichia coli O111:H- str.
           11128]
 gi|257766703|dbj|BAI38198.1| predicted polysaccharide deacetylase [Escherichia coli O111:H- str.
           11128]
          Length = 319

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|113968388|ref|YP_732181.1| hypothetical protein Shewmr4_0042 [Shewanella sp. MR-4]
 gi|113883072|gb|ABI37124.1| protein of unknown function DUF610, YibQ [Shewanella sp. MR-4]
          Length = 251

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 46/227 (20%), Positives = 100/227 (44%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           ++++ A+IA+++  +G     T  A+  LP+ +TL+   +    ++  K A  KG E +L
Sbjct: 15  ASSNAAQIALIIDDIGYR--HTDEAVLSLPSAVTLSVLPHTPLSNKLAKAAHAKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L    +  Q+ + +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKA--LGVGGLTNNMSEAQIRSSVLAAIASVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A  L++P +   L+LD+ V    + ++   + 
Sbjct: 131 LWVMETLKQKQLYFVDSMTTKFTKAGDKADSLSVPLLRRQLFLDNDVSAAALEKQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             A + G  + +A  + E+I  +   L +     + +VP S L  + 
Sbjct: 191 SQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSLLPIE 237


>gi|308272530|emb|CBX29134.1| hypothetical protein N47_J01150 [uncultured Desulfobacterium sp.]
          Length = 301

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 52/223 (23%), Positives = 104/223 (46%), Gaps = 2/223 (0%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             +AI++  +G      ++    L A  T +        +  ++ A+KKG+E +L +PM+
Sbjct: 81  PDVAIIIDDIGYHPDL-EKKYLELDAAFTFSVLPFSPYKNITIEAARKKGREIMLHLPME 139

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
             +          L  + +  QL++++   +       GV N+ G+ + ++      IF 
Sbjct: 140 PNEYPEISPGPGALLTSMSPDQLISQINEDIDDVPFIKGVNNHMGSKMSASDVQMNQIFS 199

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
               RGL F D  + P+   R  A    L +   D+++D + DR+ I+ ++  L +IA  
Sbjct: 200 VLKARGLYFIDSKTGPKTYGRESARLFKLTFAERDVFIDHKQDREFIKNQIYELIKIANR 259

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            G+AI +   +  + +V+S+ L     + +++VP S + K SS
Sbjct: 260 HGKAIAIMHPYPLTYQVVSEMLPYMKKK-MNIVPASAIVKDSS 301


>gi|114045553|ref|YP_736103.1| hypothetical protein Shewmr7_0040 [Shewanella sp. MR-7]
 gi|113886995|gb|ABI41046.1| protein of unknown function DUF610, YibQ [Shewanella sp. MR-7]
          Length = 251

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 100/234 (42%), Gaps = 4/234 (1%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
           A+     + ++ A+IA+++  +G     T  A+  LP+ +TL+   +    ++  K A  
Sbjct: 8   ALWALSIAPSNAAQIALIIDDIGYR--HTDEAVLSLPSAVTLSVLPHTPLSNKLAKAAHA 65

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           KG E +L +PMQA +          L    +  Q+ + +  ++       G  N+ G++L
Sbjct: 66  KGHEIMLHLPMQALNGKA--LGVGGLTNNMSETQIRSSVLAAIASVPFAKGANNHMGSLL 123

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
               +    + +   ++ L F D  ++        A  L +P +   L+LD+ V    + 
Sbjct: 124 TQLDDPMLWVMETLKQKQLYFVDSMTTKFTKAGDKADSLGVPLLRRQLFLDNDVSAAALE 183

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           ++   +   A + G  + +A  + E+I  +   L +     + +VP S L  + 
Sbjct: 184 KQFNLMISQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSLLPIE 237


>gi|258406280|ref|YP_003199022.1| hypothetical protein Dret_2160 [Desulfohalobium retbaense DSM 5692]
 gi|257798507|gb|ACV69444.1| protein of unknown function DUF610 YibQ [Desulfohalobium retbaense
           DSM 5692]
          Length = 403

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 60/229 (26%), Positives = 106/229 (46%), Gaps = 2/229 (0%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           DK   +  S AR+AIV+  LG      +R I      +T A   +          A +  
Sbjct: 173 DKAEQNTKSQARLAIVIDDLGEDVRKARRLIQT-GLPLTFAVLPSCTHTRDIASLAHEHN 231

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
            E +L  PM+       +  +  L V     Q+   L+ +L +     G+ N+ G+   S
Sbjct: 232 LELLLHQPMEPLSYPATDPGTGALFVGMNASQIRKTLKDNLAQIQHAVGLNNHMGSRFTS 291

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +       F+  A R L F D  +SP ++ R  A + ++PY+  +++LD+  +R+ I  +
Sbjct: 292 SSAGMRTTFRNIANRQLFFLDSLTSPDSVARETAKRTHVPYLRRNIFLDNTQNREAILYQ 351

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           L+  E +A + G AI +   ++ ++E I++W  Q   R V ++PLS L 
Sbjct: 352 LQKAERLALSRGSAIAIGHPYEATLEAIAKWKTQRDPR-VRLIPLSTLL 399


>gi|291327262|ref|ZP_06127547.2| polysaccharide deacetylase family protein [Providencia rettgeri DSM
           1131]
 gi|291311023|gb|EFE51476.1| polysaccharide deacetylase family protein [Providencia rettgeri DSM
           1131]
          Length = 338

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 44/229 (19%), Positives = 99/229 (43%), Gaps = 4/229 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
             S A++AIV+   G  +      I  L   +T+A   +        ++A ++G++ ++ 
Sbjct: 5   PVSAAKLAIVIDDFGY-RVKEDNQILALSPAVTIAILPSSPHGREVAEKAHQQGRDILIH 63

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+   +   E    TL  + + +++   ++ ++ R     G+ N+ G+ + SN     
Sbjct: 64  MPMKPLSKQPLE--KDTLVPSMSAEEIDRIIKNAITRVPYAKGMNNHMGSEMTSNLVGMR 121

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +  +K  L F D  +         A +  +P +   +++D+    ++ R +L     
Sbjct: 122 NVMQSLSKSNLFFLDSVTIGNTQAGNAAKEYGVPSLRRHIFIDNHQSEEETRTQLNKAVA 181

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            AR  G A+ +      ++  + ++L Q    DV +V +S L    S +
Sbjct: 182 YARKHGSAVAIGHPHPSTVRALQKYLAQLPA-DVELVAVSALLSPQSST 229


>gi|332982318|ref|YP_004463759.1| hypothetical protein Mahau_1756 [Mahella australiensis 50-1 BON]
 gi|332699996|gb|AEE96937.1| protein of unknown function DUF610 YibQ [Mahella australiensis 50-1
           BON]
          Length = 267

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 96/233 (41%), Gaps = 8/233 (3%)

Query: 167 NASGAR---IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            A   +   IAI++   G +  GT+  +  L   +T A   N    +     A   G E 
Sbjct: 32  AAHTPKTHYIAIIIDDFGNNGDGTKE-MLELSIPLTAAVMPNLPYTEHDANMAHDAGLEV 90

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ  +   +      +       ++  R+   L +     G+ N+ G+    +K 
Sbjct: 91  IMHTPMQPINGKPSWLGPKGITTDLPDDEIKARINEGLEQIKWAIGMNNHMGSKATQDKR 150

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +   +R + F D   +  ++   +A  LN+P +  D++LD+  ++  I+++L+ 
Sbjct: 151 VMKSVLEIAKQRNMFFVDSKVTANSVIDEVASSLNVPCVSRDIFLDNSKNQHDIQKQLEK 210

Query: 344 LEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           L  IA   G AIG+     E    + + I   +     R +    +S +  ++
Sbjct: 211 LGNIAVEKGYAIGIGHVGPEGGVVTAKAIRTEIPLLEKRGIQFTYISKVVDIA 263


>gi|38704183|ref|NP_312519.2| hypothetical protein ECs4492 [Escherichia coli O157:H7 str. Sakai]
 gi|157157521|ref|YP_001465097.1| polysaccharide deacetylase family protein [Escherichia coli
           E24377A]
 gi|157163098|ref|YP_001460416.1| polysaccharide deacetylase family protein [Escherichia coli HS]
 gi|168746834|ref|ZP_02771856.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|168753440|ref|ZP_02778447.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|168759714|ref|ZP_02784721.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|168772418|ref|ZP_02797425.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|168779772|ref|ZP_02804779.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|168785494|ref|ZP_02810501.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|168797460|ref|ZP_02822467.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|170018153|ref|YP_001723107.1| protein of unknown function DUF610 YibQ [Escherichia coli ATCC
           8739]
 gi|191168137|ref|ZP_03029934.1| polysaccharide deacetylase family protein [Escherichia coli B7A]
 gi|193068550|ref|ZP_03049512.1| polysaccharide deacetylase family protein [Escherichia coli
           E110019]
 gi|208807566|ref|ZP_03249903.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208814455|ref|ZP_03255784.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208820448|ref|ZP_03260768.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209399753|ref|YP_002273096.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209921088|ref|YP_002295172.1| hypothetical protein ECSE_3897 [Escherichia coli SE11]
 gi|217325442|ref|ZP_03441526.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|253771543|ref|YP_003034374.1| hypothetical protein ECBD_0111 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254163544|ref|YP_003046652.1| putative polysaccharide deacetylase [Escherichia coli B str.
           REL606]
 gi|254795572|ref|YP_003080409.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224201|ref|ZP_05938482.1| predicted polysaccharide deacetylase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254812|ref|ZP_05947345.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284988|ref|YP_003501806.1| hypothetical protein G2583_4353 [Escherichia coli O55:H7 str.
           CB9615]
 gi|300815145|ref|ZP_07095370.1| divergent polysaccharide deacetylase [Escherichia coli MS 107-1]
 gi|300822387|ref|ZP_07102527.1| divergent polysaccharide deacetylase [Escherichia coli MS 119-7]
 gi|300907658|ref|ZP_07125286.1| divergent polysaccharide deacetylase [Escherichia coli MS 84-1]
 gi|300919816|ref|ZP_07136291.1| divergent polysaccharide deacetylase [Escherichia coli MS 115-1]
 gi|300923401|ref|ZP_07139442.1| divergent polysaccharide deacetylase [Escherichia coli MS 182-1]
 gi|300927953|ref|ZP_07143512.1| divergent polysaccharide deacetylase [Escherichia coli MS 187-1]
 gi|300948053|ref|ZP_07162192.1| divergent polysaccharide deacetylase [Escherichia coli MS 116-1]
 gi|300954492|ref|ZP_07166941.1| divergent polysaccharide deacetylase [Escherichia coli MS 175-1]
 gi|301303850|ref|ZP_07209969.1| divergent polysaccharide deacetylase [Escherichia coli MS 124-1]
 gi|301325299|ref|ZP_07218806.1| divergent polysaccharide deacetylase [Escherichia coli MS 78-1]
 gi|301644280|ref|ZP_07244283.1| divergent polysaccharide deacetylase [Escherichia coli MS 146-1]
 gi|307140313|ref|ZP_07499669.1| putative polysaccharide deacetylase [Escherichia coli H736]
 gi|307314298|ref|ZP_07593906.1| protein of unknown function DUF610 YibQ [Escherichia coli W]
 gi|309797485|ref|ZP_07691876.1| divergent polysaccharide deacetylase [Escherichia coli MS 145-7]
 gi|312972100|ref|ZP_07786274.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1827-70]
 gi|331644333|ref|ZP_08345462.1| YibQ protein product [Escherichia coli H736]
 gi|331655247|ref|ZP_08356246.1| YibQ protein product [Escherichia coli M718]
 gi|331670458|ref|ZP_08371297.1| YibQ protein product [Escherichia coli TA271]
 gi|331679708|ref|ZP_08380378.1| YibQ protein product [Escherichia coli H591]
 gi|157068778|gb|ABV08033.1| polysaccharide deacetylase family protein [Escherichia coli HS]
 gi|157079551|gb|ABV19259.1| polysaccharide deacetylase family protein [Escherichia coli
           E24377A]
 gi|169753081|gb|ACA75780.1| protein of unknown function DUF610 YibQ [Escherichia coli ATCC
           8739]
 gi|187771729|gb|EDU35573.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4196]
 gi|188018304|gb|EDU56426.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4113]
 gi|189002373|gb|EDU71359.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4076]
 gi|189358842|gb|EDU77261.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4401]
 gi|189369563|gb|EDU87979.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4501]
 gi|189374594|gb|EDU93010.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC869]
 gi|189380099|gb|EDU98515.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC508]
 gi|190901806|gb|EDV61558.1| polysaccharide deacetylase family protein [Escherichia coli B7A]
 gi|192958201|gb|EDV88642.1| polysaccharide deacetylase family protein [Escherichia coli
           E110019]
 gi|208727367|gb|EDZ76968.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4206]
 gi|208735732|gb|EDZ84419.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4045]
 gi|208740571|gb|EDZ88253.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4042]
 gi|209161153|gb|ACI38586.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. EC4115]
 gi|209914347|dbj|BAG79421.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|217321663|gb|EEC30087.1| polysaccharide deacetylase family protein [Escherichia coli O157:H7
           str. TW14588]
 gi|242379138|emb|CAQ33940.1| putative nucleoside (IDP) diphosphatase [Escherichia coli
           BL21(DE3)]
 gi|253322587|gb|ACT27189.1| protein of unknown function DUF610 YibQ [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253975445|gb|ACT41116.1| predicted polysaccharide deacetylase [Escherichia coli B str.
           REL606]
 gi|253979601|gb|ACT45271.1| predicted polysaccharide deacetylase [Escherichia coli BL21(DE3)]
 gi|254594972|gb|ACT74333.1| predicted polysaccharide deacetylase [Escherichia coli O157:H7 str.
           TW14359]
 gi|281602976|gb|ADA75960.1| Polysaccharide deacetylase family protein [Shigella flexneri
           2002017]
 gi|290764861|gb|ADD58822.1| Uncharacterized protein conserved in bacteria [Escherichia coli
           O55:H7 str. CB9615]
 gi|300318525|gb|EFJ68309.1| divergent polysaccharide deacetylase [Escherichia coli MS 175-1]
 gi|300400594|gb|EFJ84132.1| divergent polysaccharide deacetylase [Escherichia coli MS 84-1]
 gi|300413169|gb|EFJ96479.1| divergent polysaccharide deacetylase [Escherichia coli MS 115-1]
 gi|300420311|gb|EFK03622.1| divergent polysaccharide deacetylase [Escherichia coli MS 182-1]
 gi|300452394|gb|EFK16014.1| divergent polysaccharide deacetylase [Escherichia coli MS 116-1]
 gi|300464045|gb|EFK27538.1| divergent polysaccharide deacetylase [Escherichia coli MS 187-1]
 gi|300525034|gb|EFK46103.1| divergent polysaccharide deacetylase [Escherichia coli MS 119-7]
 gi|300532037|gb|EFK53099.1| divergent polysaccharide deacetylase [Escherichia coli MS 107-1]
 gi|300840813|gb|EFK68573.1| divergent polysaccharide deacetylase [Escherichia coli MS 124-1]
 gi|300847826|gb|EFK75586.1| divergent polysaccharide deacetylase [Escherichia coli MS 78-1]
 gi|301077380|gb|EFK92186.1| divergent polysaccharide deacetylase [Escherichia coli MS 146-1]
 gi|306906121|gb|EFN36640.1| protein of unknown function DUF610 YibQ [Escherichia coli W]
 gi|308118921|gb|EFO56183.1| divergent polysaccharide deacetylase [Escherichia coli MS 145-7]
 gi|310334477|gb|EFQ00682.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1827-70]
 gi|315062905|gb|ADT77232.1| predicted polysaccharide deacetylase [Escherichia coli W]
 gi|315254003|gb|EFU33971.1| divergent polysaccharide deacetylase [Escherichia coli MS 85-1]
 gi|320191332|gb|EFW65982.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. EC1212]
 gi|320639523|gb|EFX09131.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           G5101]
 gi|320655581|gb|EFX23509.1| putative polysaccharide deacetylase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320661315|gb|EFX28739.1| putative polysaccharide deacetylase [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320666329|gb|EFX33328.1| putative polysaccharide deacetylase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323376502|gb|ADX48770.1| protein of unknown function DUF610 YibQ [Escherichia coli KO11]
 gi|323939624|gb|EGB35830.1| divergent polysaccharide deacetylase [Escherichia coli E482]
 gi|323944070|gb|EGB40150.1| divergent polysaccharide deacetylase [Escherichia coli H120]
 gi|323959865|gb|EGB55513.1| divergent polysaccharide deacetylase [Escherichia coli H489]
 gi|323971259|gb|EGB66504.1| divergent polysaccharide deacetylase [Escherichia coli TA007]
 gi|324019726|gb|EGB88945.1| divergent polysaccharide deacetylase [Escherichia coli MS 117-3]
 gi|326337384|gb|EGD61219.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. 1044]
 gi|326339909|gb|EGD63716.1| putative divergent polysaccharide deacetylase [Escherichia coli
           O157:H7 str. 1125]
 gi|331036627|gb|EGI08853.1| YibQ protein product [Escherichia coli H736]
 gi|331047262|gb|EGI19340.1| YibQ protein product [Escherichia coli M718]
 gi|331062520|gb|EGI34440.1| YibQ protein product [Escherichia coli TA271]
 gi|331072880|gb|EGI44205.1| YibQ protein product [Escherichia coli H591]
 gi|332749934|gb|EGJ80346.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-671]
 gi|332750094|gb|EGJ80505.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 4343-70]
 gi|332751254|gb|EGJ81657.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2747-71]
 gi|332764186|gb|EGJ94423.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2930-71]
 gi|332997354|gb|EGK16970.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-218]
 gi|333012897|gb|EGK32274.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-304]
          Length = 319

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|331659937|ref|ZP_08360875.1| YibQ protein product [Escherichia coli TA206]
 gi|331053152|gb|EGI25185.1| YibQ protein product [Escherichia coli TA206]
          Length = 319

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|260857988|ref|YP_003231879.1| putative polysaccharide deacetylase [Escherichia coli O26:H11 str.
           11368]
 gi|257756637|dbj|BAI28139.1| predicted polysaccharide deacetylase [Escherichia coli O26:H11 str.
           11368]
 gi|323155268|gb|EFZ41451.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli EPECa14]
          Length = 319

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMRALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|320176324|gb|EFW51384.1| putative divergent polysaccharide deacetylase [Shigella dysenteriae
           CDC 74-1112]
 gi|320186843|gb|EFW61563.1| putative divergent polysaccharide deacetylase [Shigella flexneri
           CDC 796-83]
 gi|332089546|gb|EGI94650.1| divergent polysaccharide deacetylase family protein [Shigella
           boydii 3594-74]
          Length = 319

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPLTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|24371646|ref|NP_715688.1| hypothetical protein SO_0046 [Shewanella oneidensis MR-1]
 gi|24345408|gb|AAN53133.1|AE015456_3 conserved hypothetical protein [Shewanella oneidensis MR-1]
          Length = 251

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 45/234 (19%), Positives = 96/234 (41%), Gaps = 4/234 (1%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
           A+     + ++ A+IA+++  +G     T  A+  LP+++TL+   +     +  K A  
Sbjct: 8   ALWTISVAPSNAAQIALIIDDIGYR--HTDEAVLSLPSSVTLSVLPHTPLSSKLAKAAHA 65

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
            G E +L +PMQA +          L       Q+ + +  ++       G  N+ G++L
Sbjct: 66  NGHEIMLHLPMQALNGKA--LGVGGLTNNMNEAQIRSSVLAAMASVPFAKGANNHMGSLL 123

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
               +    + +   ++   F D  ++        A +L +P +   L+LD+ V    + 
Sbjct: 124 TQLDDPMLWVMETLKQKQFYFVDSMTTKFTKAGDRADQLGVPLLRRQLFLDNDVSTQALE 183

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            +   +   A   G  + +A  + E+I  +   L +     + +VP S L  + 
Sbjct: 184 RQFNLMISQAHAQGSLVAIAHPYPETIHFLKANLARLKAEGIELVPTSRLLPIK 237


>gi|194435962|ref|ZP_03068065.1| polysaccharide deacetylase family protein [Escherichia coli 101-1]
 gi|194425505|gb|EDX41489.1| polysaccharide deacetylase family protein [Escherichia coli 101-1]
          Length = 319

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 89/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL    +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLCPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|323965881|gb|EGB61329.1| divergent polysaccharide deacetylase [Escherichia coli M863]
 gi|327250739|gb|EGE62441.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli STEC_7v]
          Length = 319

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|320539186|ref|ZP_08038857.1| putative polysaccharide deacetylase [Serratia symbiotica str.
           Tucson]
 gi|320030824|gb|EFW12832.1| putative polysaccharide deacetylase [Serratia symbiotica str.
           Tucson]
          Length = 278

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 91/230 (39%), Gaps = 4/230 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                +++IV+  +G      + A+  +P  +++A   N          A  + +E ++ 
Sbjct: 20  AVQAGKLSIVIDDVGY-HPHEENAVLQMPEAVSVAVLPNAPYARLMATRAHSQNREVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM  F +   E    TL+   + + +   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  MPMAPFSKQPLE--QDTLQPDMSSENIQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +      L F D  +   +     A    +  +   ++LDD  +   IR +      
Sbjct: 137 KVMQALTSYRLYFLDSLTISNSQATRAAIGTGVKVIKRKVFLDDTANEADIRHQFNRAVA 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +AR  G AI +      +++V+ Q L      D+ +V  S L      SS
Sbjct: 197 LARRNGSAIAIGHPRPATVKVLQQMLPVLPA-DIVLVKPSSLLNEPQGSS 245


>gi|154251924|ref|YP_001412748.1| hypothetical protein Plav_1471 [Parvibaculum lavamentivorans DS-1]
 gi|154155874|gb|ABS63091.1| protein of unknown function DUF610 YibQ [Parvibaculum
           lavamentivorans DS-1]
          Length = 426

 Score =  253 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 91/385 (23%), Positives = 164/385 (42%), Gaps = 32/385 (8%)

Query: 39  GLSIYILISHAFVGTIS----EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQ 94
           G   ++  S   +         + P   + E A  P        +  +P + +       
Sbjct: 42  GTLGWLYFSDNRLAGEPVVHVALAPEEPVEEPAAPPQAEEPAGMETPAPPQDEPQGETPP 101

Query: 95  LKNDSSQHDGQ------------------IQNDISGKTVVNKPTRSTSIDSLPTIEERL- 135
           L  D  +                      I  D++ +  +      +     P  E    
Sbjct: 102 LDLDPDELSPDERALLDAARDLNNGIDRGIDADVADEVKIVGAESVSGGRETPLAEPAEI 161

Query: 136 -ILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA--------RIAIVVSGLGISQTG 186
            +  +    L+ K   G          K +   A           RIA+VVSG+GIS++ 
Sbjct: 162 KLAPVPDPALVEKTAQGPLPKIAADGRKAWQVYARPVPDGTPTDRRIALVVSGMGISESA 221

Query: 187 TQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKV 246
           T  AI++LP  +TL+FA  G  L  W+  A+  G E +L++PM+ F    N+   +TL  
Sbjct: 222 TSHAIDVLPPEVTLSFAPYGTGLQGWIDRARAAGHEVLLELPMEPFGYPQNDPGPHTLLT 281

Query: 247 TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
           +   ++ + RL + + R +GY GVMNY+GA   ++  + + +      RGLL+ D+G+S 
Sbjct: 282 SLQPKENIERLEWLMSRFSGYAGVMNYQGARFTTSATALKPVVAALGARGLLYVDNGASA 341

Query: 307 RNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIE 366
           R+L   LA +  +P + A   +D   + + I   L  LE+ +  TG A+GVA  F  +++
Sbjct: 342 RSLAPQLAGESRMPAVQATRIIDPVQNPEVIATSLDMLEKTSSETGSAVGVASGFPVTVD 401

Query: 367 VISQWLQQEHVRDVSVVPLSCLAKL 391
            +++W +        +VP++ +A+ 
Sbjct: 402 ALAEWAKTLRNDGYVLVPVTAIARE 426


>gi|323975163|gb|EGB70268.1| divergent polysaccharide deacetylase [Escherichia coli TW10509]
          Length = 319

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 43/238 (18%), Positives = 91/238 (38%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +  A+  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|304407156|ref|ZP_07388810.1| protein of unknown function DUF610 YibQ [Paenibacillus
           curdlanolyticus YK9]
 gi|304344143|gb|EFM09983.1| protein of unknown function DUF610 YibQ [Paenibacillus
           curdlanolyticus YK9]
          Length = 284

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 91/222 (40%), Gaps = 5/222 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+AIV+   G   TGT   +  LP   T+A      +     + A K G + I+ +PM+ 
Sbjct: 56  RVAIVIDDFGNGMTGTTE-MMKLPFPFTVAVMPFMPTTRADAETAHKLGHDVIVHMPMEP 114

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                       L    +  ++  R+  ++       G+ N+ G+ + +++    ++   
Sbjct: 115 NKGKREWLGPGALTTDLSDSEIRKRVEAAIDNVPYAVGMNNHMGSKVTADERVMRIVLTV 174

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             +RGL F D  ++ + +   +A +L +P +   ++LDD      I +++  L +     
Sbjct: 175 CKERGLFFLDSRTTYKTVVPKIANELGVPLLSNHVFLDDVYSVQHIAKQIGVLRKYLEEH 234

Query: 352 GQAIGVAV---AFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              + +        ++  V+ Q       + V +V LS L +
Sbjct: 235 ENCVAIGHVGPPGKKTAAVLLQSTPVLREKAV-IVKLSDLVQ 275


>gi|315127791|ref|YP_004069794.1| hypothetical protein PSM_A2729 [Pseudoalteromonas sp. SM9913]
 gi|315016305|gb|ADT69643.1| hypothetical protein PSM_A2729 [Pseudoalteromonas sp. SM9913]
          Length = 250

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 49/230 (21%), Positives = 95/230 (41%), Gaps = 4/230 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S     +IAIV+  +G  Q         LP  ++ +   +      +   A +  +E 
Sbjct: 13  TSSAVKAKQIAIVIDDIGYHQR--DLEFLSLPGQLSYSILPHTPYSQIFATLASQSNKEL 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PMQA +          L +     QL   L  +L       GV N+ G+ L    +
Sbjct: 71  LLHVPMQALNGKK--LGPGALTLNMDKAQLQQTLGNALASLPQVKGVNNHMGSALTQQSQ 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + +   +   KR L F D  ++  +  +  A  L +  +   ++LD+    ++++ +L+ 
Sbjct: 129 AMKWTMEVLKKRQLYFLDSRTTELSQAQNAANFLGVENISRHVFLDNITTTEQLQLRLEE 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           L+  A     AI +A  + E+I+ +   L Q   +   +VP+S L +   
Sbjct: 189 LKSKATKYQFAIAIAHPYPETIDFLRHALPQLSEQGFELVPVSQLVERKY 238


>gi|218556179|ref|YP_002389092.1| putative polysaccharide deacetylase [Escherichia coli IAI1]
 gi|218362947|emb|CAR00584.1| putative polysaccharide deacetylase [Escherichia coli IAI1]
          Length = 319

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRRAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGYTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|187731969|ref|YP_001882314.1| polysaccharide deacetylase family protein [Shigella boydii CDC
           3083-94]
 gi|187428961|gb|ACD08235.1| polysaccharide deacetylase family protein [Shigella boydii CDC
           3083-94]
          Length = 319

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPLTVRVLQQMVYNLPP-DITLVKASRLLNEP 241


>gi|148263945|ref|YP_001230651.1| protein of unknown function DUF610, YibQ [Geobacter uraniireducens
           Rf4]
 gi|146397445|gb|ABQ26078.1| protein of unknown function DUF610, YibQ [Geobacter uraniireducens
           Rf4]
          Length = 313

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 46/274 (16%), Positives = 101/274 (36%), Gaps = 1/274 (0%)

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAI 175
             +       +     E   +      +               A  +          +AI
Sbjct: 40  TKRGASEKPAEKPQVSERLKMPSHPAPQAAKHAAYSAAVVAPVARVRPKPHPTGSGTVAI 99

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           +V  +G S     R++  +   +T +            + A   G E ++ +PM+     
Sbjct: 100 IVDDMGSSMQEV-RSLMAIDIPVTFSIIPGLAKSKGVAEAAHGNGGEVMVHMPMEPKGYP 158

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
               +   L ++++ +++  +++  L+      G  N+ G+    N+E  + + K    R
Sbjct: 159 KQRMEKNGLLLSESDEEIAAKVKAYLQAVPYAVGANNHMGSRFTENEEKMQSVLKVLKGR 218

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAI 355
            + F D  +SP ++   LA K+ L      ++LD+  +   I+ +L+ + + AR  G AI
Sbjct: 219 EMFFVDSKTSPASVGYSLARKMGLKAGTRQVFLDNVQNVAAIKAQLQQVADTARKRGSAI 278

Query: 356 GVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            +      +I+ +S  L       ++ V  S L 
Sbjct: 279 AICHPHQTTIQALSSMLPALKKDGITFVYASQLV 312


>gi|324111944|gb|EGC05924.1| divergent polysaccharide deacetylase [Escherichia fergusonii B253]
          Length = 318

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|89110397|ref|AP_004177.1| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. W3110]
 gi|90111621|ref|NP_418071.4| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|170083122|ref|YP_001732442.1| polysaccharide deacetylase [Escherichia coli str. K-12 substr.
           DH10B]
 gi|238902705|ref|YP_002928501.1| putative polysaccharide deacetylase [Escherichia coli BW2952]
 gi|254038815|ref|ZP_04872867.1| polysaccharide deacetylase [Escherichia sp. 1_1_43]
 gi|18545478|sp|P37691|YIBQ_ECOLI RecName: Full=Uncharacterized protein yibQ; Flags: Precursor
 gi|85676428|dbj|BAE77678.1| predicted polysaccharide deacetylase [Escherichia coli str. K12
           substr. W3110]
 gi|87082298|gb|AAC76638.2| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. MG1655]
 gi|169890957|gb|ACB04664.1| predicted polysaccharide deacetylase [Escherichia coli str. K-12
           substr. DH10B]
 gi|226838780|gb|EEH70807.1| polysaccharide deacetylase [Escherichia sp. 1_1_43]
 gi|238862835|gb|ACR64833.1| predicted polysaccharide deacetylase [Escherichia coli BW2952]
 gi|260447367|gb|ACX37789.1| protein of unknown function DUF610 YibQ [Escherichia coli DH1]
 gi|309704018|emb|CBJ03364.1| putative polysaccharide deacetylase [Escherichia coli ETEC H10407]
 gi|315138196|dbj|BAJ45355.1| putative polysaccharide deacetylase [Escherichia coli DH1]
          Length = 319

 Score =  253 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPATVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|282600473|ref|ZP_05974435.2| YibQ protein [Providencia rustigianii DSM 4541]
 gi|282565189|gb|EFB70724.1| YibQ protein [Providencia rustigianii DSM 4541]
          Length = 364

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 45/233 (19%), Positives = 103/233 (44%), Gaps = 4/233 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
            CS AS A++AIV+   G  +      I  +PA I++A   N         +A ++G++ 
Sbjct: 35  ICSQASAAKLAIVIDDFGY-RAKEDNQILAMPAAISIAILPNSPHGIEVATQAYQQGRDI 93

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E    TL  + + + +   ++ ++ R     G+ N+ G+ + S+  
Sbjct: 94  LIHMPMKPLSKQPLE--KDTLTPSMSAEDVDRIIKNAISRVPHAKGMNNHMGSEMTSSLS 151

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +  ++  L F D  +      +  A +  +P    ++++D+    ++ R +L  
Sbjct: 152 GMRNVMRSLSQSNLFFLDSVTIGNTQAQNAAKEFGVPSTKRNIFIDNHQSEEETRAQLNK 211

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
               AR  G A+ +      ++  + +++      DV +VP+S L      ++
Sbjct: 212 AISYARKHGSAVAIGHPHPSTVRALQKFIPLIPA-DVELVPVSTLVNNQPTTT 263


>gi|281180660|dbj|BAI56990.1| conserved hypothetical protein [Escherichia coli SE15]
          Length = 319

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQLVYNLPP-DITLVKASSLLNEP 241


>gi|126176516|ref|YP_001052665.1| hypothetical protein Sbal_4335 [Shewanella baltica OS155]
 gi|125999721|gb|ABN63796.1| protein of unknown function DUF610, YibQ [Shewanella baltica OS155]
          Length = 251

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 49/227 (21%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +    +       KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGEELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKA--LGLGGLTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             I +   ++ L F D  ++        A +L +P +   L+LD+      +  +   + 
Sbjct: 131 LWIMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDTSAKALERQFNLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             A T G  + +A  + E++  +   LQ+     + +VP S L  + 
Sbjct: 191 SQAHTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPIG 237


>gi|117918507|ref|YP_867699.1| hypothetical protein Shewana3_0048 [Shewanella sp. ANA-3]
 gi|117610839|gb|ABK46293.1| protein of unknown function DUF610, YibQ [Shewanella sp. ANA-3]
          Length = 251

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 47/234 (20%), Positives = 99/234 (42%), Gaps = 4/234 (1%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
           A+     + ++ A+IA+++  +G     T  A+  LP+ +TL+   +    ++  K A  
Sbjct: 8   ALWALSIAPSNAAQIALIIDDIGYR--HTDEAVLSLPSAVTLSVLPHTPLSNKLAKAAHA 65

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
           KG E +L +PMQA +          L    +  Q+ + +  ++       G  N+ G++L
Sbjct: 66  KGHEIMLHLPMQALNGKA--LGVGGLTNNMSEAQIRSSVLAAIASVPFAKGANNHMGSLL 123

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
               +    +     ++ L F D  ++        A  L +P +   L+LD+ V    + 
Sbjct: 124 TQLDDPMLWVMDTLKQKQLYFVDSMTTKFTKAGDKADSLGVPLLRRKLFLDNDVSAAALE 183

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           ++   +   A + G  + +A  + E+I  +   L +     + +VP S L  + 
Sbjct: 184 KQFNLMISQAHSQGSLVAIAHPYPETIHFLKTNLARLKAEGIELVPTSSLLPIE 237


>gi|301028373|ref|ZP_07191620.1| divergent polysaccharide deacetylase [Escherichia coli MS 196-1]
 gi|299878575|gb|EFI86786.1| divergent polysaccharide deacetylase [Escherichia coli MS 196-1]
          Length = 319

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKGIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|152998595|ref|YP_001364276.1| hypothetical protein Shew185_0040 [Shewanella baltica OS185]
 gi|151363213|gb|ABS06213.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS185]
          Length = 251

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 97/227 (42%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKA--LGLGGLTNTMTEAQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  +   + 
Sbjct: 131 LWVMETLKQKHLYFIDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALERQFSLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             A+T G  + +A  + E++  +   LQ+     + +VP S L  + 
Sbjct: 191 SQAQTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPIG 237


>gi|332345585|gb|AEE58919.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 319

 Score =  252 bits (643), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNGSTIAIGHPHPATVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|261341775|ref|ZP_05969633.1| hypothetical protein ENTCAN_08255 [Enterobacter cancerogenus ATCC
           35316]
 gi|288316144|gb|EFC55082.1| YibQ protein product [Enterobacter cancerogenus ATCC 35316]
          Length = 304

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 41/226 (18%), Positives = 89/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +   +  +  +P+ I++A   N         +A   G + ++ 
Sbjct: 14  PVYAGKLAIVIDDFGY-RPHYENQVLAMPSAISVAVLPNAPHAREMATKAHNSGHQVLIH 72

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R +  +     G+ N+ G+ + S+     
Sbjct: 73  LPMAPLSKQPLE--KDTLRPEMSSDEIDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYGML 130

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +   +  L F D  +   +     A    +  +   ++LDD  +   IR +     +
Sbjct: 131 KVMQSLERYNLYFLDSMTIGNSQAMRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQ 190

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G AI +      ++ V+ Q L      D+++V  S L    
Sbjct: 191 LARRNGSAIAIGHPHPSTVRVLQQMLPTLPA-DITLVRPSDLLNEP 235


>gi|332997808|gb|EGK17419.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-272]
 gi|333013340|gb|EGK32712.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri K-227]
          Length = 319

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 42/238 (17%), Positives = 90/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARHNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|256025655|ref|ZP_05439520.1| predicted polysaccharide deacetylase [Escherichia sp. 4_1_40B]
          Length = 319

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|193066089|ref|ZP_03047145.1| polysaccharide deacetylase family protein [Escherichia coli E22]
 gi|260846618|ref|YP_003224396.1| putative polysaccharide deacetylase [Escherichia coli O103:H2 str.
           12009]
 gi|192926251|gb|EDV80889.1| polysaccharide deacetylase family protein [Escherichia coli E22]
 gi|257761765|dbj|BAI33262.1| predicted polysaccharide deacetylase [Escherichia coli O103:H2 str.
           12009]
 gi|323182645|gb|EFZ68048.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1357]
          Length = 319

 Score =  252 bits (643), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|194427407|ref|ZP_03059956.1| polysaccharide deacetylase family protein [Escherichia coli B171]
 gi|194414447|gb|EDX30720.1| polysaccharide deacetylase family protein [Escherichia coli B171]
 gi|323160707|gb|EFZ46644.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli E128010]
          Length = 319

 Score =  252 bits (643), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 89/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  SSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +   +  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|158522465|ref|YP_001530335.1| protein of unknown function DUF610 YibQ [Desulfococcus oleovorans
           Hxd3]
 gi|158511291|gb|ABW68258.1| protein of unknown function DUF610 YibQ [Desulfococcus oleovorans
           Hxd3]
          Length = 315

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 58/313 (18%), Positives = 112/313 (35%), Gaps = 7/313 (2%)

Query: 81  QSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLS 140
               +R   T        +  H  +I         +        +  LP        G  
Sbjct: 1   MKKKRRTPATARKASAPSTPGHYLKILAGALLLVGILGAAALVGLVFLPDTPPDRTAGQP 60

Query: 141 KKELLAKNKVGREDTEVPAMDKNFCSNASGA----RIAIVVSGLGISQTGTQRAINLLPA 196
                 +             D   C  A       ++AI++  +G  +    R    L  
Sbjct: 61  DVPA-RRPPFEVYPETDRLPDSPPCGPAHAPSARPKVAIIIDDMGYDRALAGR-FVNLGI 118

Query: 197 NITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNR 256
            +T +   +        + A++KG E +L +PM+  +          L  +    +L+ R
Sbjct: 119 PLTFSILPHSPRGREIARTARQKGIEIMLHLPMEPDEYPAVNPGDGVLLTSMGPDELIAR 178

Query: 257 LRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPK 316
           +  +L   +   GV N+ G+ + ++      +F    K GL F D  ++P +  R  A  
Sbjct: 179 MENNLNDISHVAGVNNHMGSKMTADSARMYQVFSVLKKHGLFFVDSRTTPESQCRPAARL 238

Query: 317 LNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEH 376
           L +P+   D++LD+  D   I  ++  L  +A+  G+A+ +  A   +   + + L    
Sbjct: 239 LQVPFAERDVFLDNDSDVAAIEAQIDRLIAVAKRNGKAVAIGHAHGSTCTALEKHLAALT 298

Query: 377 VRDVSVVPLSCLA 389
            + V +VP S L 
Sbjct: 299 QQ-VELVPASHLV 310


>gi|218550892|ref|YP_002384683.1| polysaccharide deacetylase [Escherichia fergusonii ATCC 35469]
 gi|218358433|emb|CAQ91080.1| putative polysaccharide deacetylase [Escherichia fergusonii ATCC
           35469]
 gi|325499163|gb|EGC97022.1| polysaccharide deacetylase [Escherichia fergusonii ECD227]
          Length = 318

 Score =  251 bits (641), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 88/226 (38%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E ++ 
Sbjct: 20  PVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN    +
Sbjct: 79  LPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +   +  L F D  +         A    +  +   ++LDD  +   IR +     +
Sbjct: 137 KVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAID 196

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 197 LARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|254504290|ref|ZP_05116441.1| Divergent polysaccharide deacetylase family [Labrenzia alexandrii
           DFL-11]
 gi|222440361|gb|EEE47040.1| Divergent polysaccharide deacetylase family [Labrenzia alexandrii
           DFL-11]
          Length = 372

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 97/382 (25%), Positives = 173/382 (45%), Gaps = 26/382 (6%)

Query: 14  PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTI 73
            +R       +   GL       +    I+IL+     G      P++V+     +    
Sbjct: 3   KRRLVRLPFGLIGAGLI---SVVLTTALIWILVVDDPYGGE----PFAVLPLDEVVEGIT 55

Query: 74  PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEE 133
             +IE  +      ++   N  +  S        + +  +  +         ++  T   
Sbjct: 56  SQDIEVVEIRPTVGDDLGPNLRQQSSG-------DYLGPRYEMIIRPDGLGPEAPVTG-- 106

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------ARIAIVVSGLGISQT 185
             +       +  ++  G       A  +   + A           +IA+VV+GLG+S+ 
Sbjct: 107 --LAINPDPRVSERSDYGFLPMVSDAGVRPLDAYARPIQTQFTSIPKIAVVVTGLGLSEA 164

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
           GTQ AI+ LPA++T A A  G+ LD WM++A+ KG E +LQ+P++ FD   N+   +TL 
Sbjct: 165 GTQNAIDSLPADVTFALAPYGSDLDLWMQQARMKGHELLLQLPLEPFDFPDNDPGPHTLL 224

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
           V+    +LL+RL + L R T Y GV+   GA   S + S + + ++   RGL+F D+G++
Sbjct: 225 VSLQPTELLDRLAFLLTRATNYVGVIGEMGARFSSTRPSMQYLLEKLETRGLMFVDNGTT 284

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESI 365
            R++   +A +L +P+   D+ LD+      I  KL  LE +AR  G A+    A   ++
Sbjct: 285 SRSIADEVAGELRMPFSGVDVVLDEVPRESNIDAKLLQLESVARARGYAVAAGSALPVTV 344

Query: 366 EVISQWLQQEHVRDVSVVPLSC 387
             + +W+Q    R + +VP+S 
Sbjct: 345 RQLQEWVQDLEQRGLQLVPVSA 366


>gi|39996868|ref|NP_952819.1| hypothetical protein GSU1769 [Geobacter sulfurreducens PCA]
 gi|39983756|gb|AAR35146.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
          Length = 290

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 111/270 (41%), Gaps = 2/270 (0%)

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
                   P +E   +     ++ +A           PA  +          +A+++  +
Sbjct: 23  PVVQQTPPPVVERHKLPPREPEQPVAHEDYTGV-IHHPAEPQRAQRPTGPGTLAVIIDDM 81

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           G       RA+  +   +T A       + R  +EA+++G E ++ +PM+         +
Sbjct: 82  GKGLPE-ARALMDIGIPLTFAIIPGLPKVRRVAEEARQRGIEVMVHLPMEPKGYPERRLE 140

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
           +  L ++Q   ++  R+   L       G  N+ G+    N++   V+     +RGL F 
Sbjct: 141 ANGLLLSQGDDEIAGRVNGYLNEIPQAVGANNHMGSGFTENRQKMAVVMGVLKERGLFFV 200

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           D  +SP ++   +A ++ +   V +++LD+  +   I  +L+    IAR  G AI +   
Sbjct: 201 DSKTSPVSVGDAVAREMGVRTAVRNVFLDNIQESGYITNQLRQAASIARKRGNAIAICHP 260

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +I+ ++  L +     ++ V +S L +
Sbjct: 261 HPATIQTLAVELPRLRDEGITFVTVSRLVR 290


>gi|157964031|ref|YP_001504065.1| hypothetical protein Spea_4220 [Shewanella pealeana ATCC 700345]
 gi|157849031|gb|ABV89530.1| protein of unknown function DUF610 YibQ [Shewanella pealeana ATCC
           700345]
          Length = 251

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 103/232 (44%), Gaps = 4/232 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             ++   ++IAI++  +G  Q  + +A+  LPANITL+   +         +A  +G E 
Sbjct: 13  PSASVFASQIAIIIDDIGYRQ--SDKAVLSLPANITLSILPHTPLGKDLASKAYIQGNEI 70

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQA +          L  T +  +   ++  S+       G  N+ G+ L    E
Sbjct: 71  LVHLPMQALNGKTI--GPGALTNTMSEIKFKAQVEDSINSVPHASGANNHMGSFLTQLNE 128

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               + +   +  + F D  ++      ++A  + +P +  +++LD+   +  + ++ K 
Sbjct: 129 PMRWVMESLRQHNIYFIDSMTTKYTRAGIVAESMGIPILRREIFLDNDRSQSGLEKQFKH 188

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
              +A   G+ + +A  + E+I  +++ LQ+    ++ +V  S L      S
Sbjct: 189 AISLAHAKGKIVVIAHPYPETIAFLTKNLQRLANANIELVHTSQLVSPHVNS 240


>gi|160873170|ref|YP_001552486.1| hypothetical protein Sbal195_0044 [Shewanella baltica OS195]
 gi|160858692|gb|ABX47226.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS195]
 gi|315265395|gb|ADT92248.1| protein of unknown function DUF610 YibQ [Shewanella baltica OS678]
          Length = 251

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 48/227 (21%), Positives = 96/227 (42%), Gaps = 4/227 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S +  A+IA+++  +G     T +A+  LP+ +TL+   +            KKG E +L
Sbjct: 15  SQSHAAQIALIIDDIGYR--HTDQAVLALPSTVTLSVLPHTPLGKELANAGHKKGHEIML 72

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PMQA +          L  T T  Q+   +  ++       G  N+ G++L    +  
Sbjct: 73  HLPMQALNGKA--LGLGGLTNTMTEVQIRASVVDAINSVPFAKGANNHMGSLLTQLDDPM 130

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             + +   ++ L F D  ++        A +L +P +   L+LD+ +    +  +   + 
Sbjct: 131 LWVMETLKQKHLYFVDSMTTRFTKAGETADQLGVPLLKRQLFLDNDISAKALERQFSLMI 190

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             A T G  + +A  + E++  +   LQ+     + +VP S L  + 
Sbjct: 191 SEAHTQGNLVAIAHPYPETMRFLKANLQRLKTEGIDLVPASSLLPIG 237


>gi|170767013|ref|ZP_02901466.1| polysaccharide deacetylase family protein [Escherichia albertii
           TW07627]
 gi|170124451|gb|EDS93382.1| polysaccharide deacetylase family protein [Escherichia albertii
           TW07627]
          Length = 319

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 90/228 (39%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            +     ++AIV+   G  +   +  +  +P+ I++A   +         +A   G E +
Sbjct: 18  STPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMATKAHNSGHEVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + SN   
Sbjct: 77  IHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +  A+  L F D  +         A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALARYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|298505881|gb|ADI84604.1| divergent polysaccharide deacetylase domain protein [Geobacter
           sulfurreducens KN400]
          Length = 295

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 51/270 (18%), Positives = 111/270 (41%), Gaps = 2/270 (0%)

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
                   P +E   +     ++ +A           PA  +          +A+++  +
Sbjct: 28  PVVQQTPPPVVERHKLPPREPEQPVAHEDYTGV-IHHPAEPQRAQRPTGPGTLAVIIDDM 86

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           G       RA+  +   +T A       + R  +EA+++G E ++ +PM+         +
Sbjct: 87  GKGLPE-ARALMDIGIPLTFAIIPGLPKVRRVAEEARQRGIEVMVHLPMEPKGYPERRLE 145

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
           +  L ++Q   ++  R+   L       G  N+ G+    N++   V+     +RGL F 
Sbjct: 146 ANGLLLSQGDDEIAGRVNGYLNEIPQAVGANNHMGSGFTENRQKMAVVMGVLKERGLFFV 205

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           D  +SP ++   +A ++ +   V +++LD+  +   I  +L+    IAR  G AI +   
Sbjct: 206 DSKTSPVSVGDAVAREMGVRTAVRNVFLDNIQESGYITNQLRQAASIARKRGNAIAICHP 265

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +I+ ++  L +     ++ V +S L +
Sbjct: 266 HPATIQTLAVELPRLRDEGITFVTVSRLVR 295


>gi|308188636|ref|YP_003932767.1| hypothetical protein Pvag_3176 [Pantoea vagans C9-1]
 gi|308059146|gb|ADO11318.1| Uncharacterized protein yibQ precursor [Pantoea vagans C9-1]
          Length = 300

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 46/232 (19%), Positives = 96/232 (41%), Gaps = 4/232 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++AIV+  +G  +   +  +  +P  I++A   N         +A + G E 
Sbjct: 16  FSYAAQAGKLAIVIDDVGY-RPAEENKVLQMPQAISVAVLPNAPHAHEMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL    + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLE--KDTLTPEMSSEEVTRIMRNAVNNVPYAVGLNNHMGSRMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  D + IR++   
Sbjct: 133 GMQKVMQALNHYNLYFLDSMTIANSQAIPAAQGTQVKVLKRRVFLDDSQDINAIRQQFSR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             ++A+  G AI +      ++ V+ Q L      D+++V  S L   S  S
Sbjct: 193 AVKLAQRDGYAIAIGHPHPTTVRVLQQMLPTLPA-DITLVRPSQLLNESLRS 243


>gi|15603373|ref|NP_246447.1| hypothetical protein PM1508 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12721894|gb|AAK03592.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 280

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 100/229 (43%), Gaps = 4/229 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G  Q      I  LP  I++A   +     +  ++A ++G++ ++ +
Sbjct: 25  AQPAKLAIVIDDIGYHQKE-DAQIYALPKEISVAIIPSAPHARQRNEQAYQQGRDILIHM 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ       E     L V    + +  R++ +    +   G+ N+ G+   ++ E    
Sbjct: 84  PMQPLSHQRIEAG--GLHVGMRQEDVQQRVQTAKAIVSHAIGMNNHMGSAATADAELMHK 141

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +E   + L F D  +  R++   +A +  +  +   ++LDD+     +  + +     
Sbjct: 142 LMQELKVQDLFFLDSRTIGRSVAGKIAKEYGVQSLDRHIFLDDKDTYADVERQFQRAVHY 201

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           A+  G AI +      ++ V+   L+     +V +V +  L +  + ++
Sbjct: 202 AQKHGTAIAIGHPRKNTVAVLQAGLKHLPD-NVQLVGMGRLWRSETETA 249


>gi|315618682|gb|EFU99268.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 3431]
          Length = 319

 Score =  250 bits (638), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 41/238 (17%), Positives = 89/238 (37%), Gaps = 4/238 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  + 
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNE 184

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             IR +     ++AR     I +      ++ V+ Q +      D+++V  S L    
Sbjct: 185 ADIRVQFNRAIDLARRNSSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 241


>gi|288959172|ref|YP_003449513.1| hypothetical protein AZL_023310 [Azospirillum sp. B510]
 gi|288911480|dbj|BAI72969.1| hypothetical protein AZL_023310 [Azospirillum sp. B510]
          Length = 391

 Score =  249 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 79/383 (20%), Positives = 140/383 (36%), Gaps = 36/383 (9%)

Query: 18  SFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNI 77
                    L    L      GL  ++ ++                              
Sbjct: 38  PRKPPSKPLLAAVALVAAIYAGLGGWLALNGD---------------------------A 70

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLIL 137
             +   +   + TV           + +         +           +        ++
Sbjct: 71  TREAWRASIPSTTVAIAPLPPPPAPEPKAAAPAVPPPLPTDAAPLPLPGAPAA--AVTLV 128

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKNFCSNASG-------ARIAIVVSGLGISQTGTQRA 190
                 L+  ++ G          K +   A          R+AIV+S LG+S   T  A
Sbjct: 129 PAPVPGLVEDSRNGPLPRIAQDGRKPWQVYARPFPATDKRPRVAIVMSDLGLSGVTTGNA 188

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  LP  ITLAF      LD W++ A+ KG E +L +PM+      ++     L      
Sbjct: 189 LAKLPPGITLAFLPYAERLDDWVERARTKGHEVMLSLPMEPLTYPRDDPGPNALLTMLGP 248

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            + + RL +SL +  GY GV +  G    +N  + + +      RGLL  D   +P+++ 
Sbjct: 249 DRNIERLEWSLGKAVGYVGVTSTTGGKFTANPTAMQPVIDALKARGLLLVDSRVNPKSVA 308

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
             LA    +P  + D  +D  + R  I ++L+ LEE+ART G A+G A  +  +IE ++ 
Sbjct: 309 GPLAMLAGVPRALGDRVIDRDLSRGAIDDQLRELEELARTNGAAVGFASPYPTTIERLNL 368

Query: 371 WLQQEHVRDVSVVPLSCLAKLSS 393
           WL     R +++ P+S +  +  
Sbjct: 369 WLTALADRGIALAPVSAVVNIQK 391


>gi|152994760|ref|YP_001339595.1| hypothetical protein Mmwyl1_0726 [Marinomonas sp. MWYL1]
 gi|150835684|gb|ABR69660.1| protein of unknown function DUF610 YibQ [Marinomonas sp. MWYL1]
          Length = 392

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 57/282 (20%), Positives = 111/282 (39%), Gaps = 12/282 (4%)

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS---------GA 171
               +++       ++  L             +   +    K     A            
Sbjct: 106 PQPLLETAEPWSPAIVPFLDAPIESKPAGGFPKPDALSKSSKKEVVPAKILAVDVHPKMP 165

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           RIAI++  LG ++ G   ++  LP  + LA   +          A+K+ +  +L  PM+ 
Sbjct: 166 RIAILIDDLGYNRHGMDSSLM-LPVEVALAILPSTPFAMETALTAQKQKRITLLHAPME- 223

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            ++   +     L    T  +L   L   L    G  GV N+ G++L +  +S + + + 
Sbjct: 224 -NQRELKLGPGGLYAKMTEHELKATLSKDLDGLPGIQGVNNHMGSLLTTKADSMKWVMET 282

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
              R L F D  +SP+++ +  A +  L  +  D++LD+      I ++   L ++AR  
Sbjct: 283 LKGRSLFFIDSLTSPKSVAKKTAQEYGLETVSRDVFLDNIRTEQAIDKQFSRLLKLARLH 342

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           G A+ +   + E++  + + L       V +V LS L   SS
Sbjct: 343 GSALAIGHPYPETMAYLKKRLNHLEQDGVRLVRLSDLLTASS 384


>gi|114321714|ref|YP_743397.1| protein of unknown function DUF610, YibQ [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114228108|gb|ABI57907.1| protein of unknown function DUF610, YibQ [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 264

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 49/232 (21%), Positives = 95/232 (40%), Gaps = 4/232 (1%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
                S     R+A+V+  LG      QR +  LP  +T +   +     R  +   + G
Sbjct: 27  QAQARSADEPVRVAVVIDDLGDHLASGQRTV-DLPGPVTCSVLPHTPHARRLAEACHRSG 85

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           +E +L +PMQA +    +     + +      +   +R  L       GV N+ G++   
Sbjct: 86  KEVMLHMPMQAKNG--ADRGPGGVDIHMDRTAVEAAVRKDLDAVPHARGVNNHMGSLYTR 143

Query: 281 NKESAEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           +  +   +       G   F D  ++ R++   +A +  +P     ++LD   D + IR 
Sbjct: 144 HPGNLRWVMDALRGEGDYYFVDSRTTARSVAEQVAREAGVPATRRHVFLDHDRDPEMIRH 203

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            L+ L   AR  G  + +   + E++ V+ + L +     + +VP S L +L
Sbjct: 204 HLERLVRHARRHGYGLAIGHPYPETLAVLEEVLPEWARAGIKLVPASRLVEL 255


>gi|95928784|ref|ZP_01311530.1| protein of unknown function DUF610, YibQ [Desulfuromonas
           acetoxidans DSM 684]
 gi|95135129|gb|EAT16782.1| protein of unknown function DUF610, YibQ [Desulfuromonas
           acetoxidans DSM 684]
          Length = 328

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 56/249 (22%), Positives = 99/249 (39%), Gaps = 2/249 (0%)

Query: 149 KVGREDTEVPAMDKN-FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
            +     EV               ++AI++  +GI++     A   L   + LA      
Sbjct: 70  PMEEYPAEVDKPQPPQITPPDHVPKVAIIMDDIGINRAAALDA-LQLQMPLALAIIPGEA 128

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
                M  A ++  E ++ IPM+      N      L V Q+  Q+  R+   +      
Sbjct: 129 HSTEIMNLAYQQHSEILIHIPMEPVSYPKNNPGPLGLFVHQSDSQIKRRIDDIITALPYA 188

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            G  N+ G+    + +    +     + GL F D  +S  ++    A KL L   + D++
Sbjct: 189 IGGNNHMGSEFTQHADKLRPVLLALKQSGLFFVDSLTSKDSVAYQQAQKLGLSCALRDVF 248

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           LD+    + I  +L  L  +A   G AI +   + ++IE + Q++      DV +VP+S 
Sbjct: 249 LDNVRQVEPILFQLDRLVTLAHRHGSAIAICHPYPQTIEALQQFIADPQRFDVEIVPISQ 308

Query: 388 LAKLSSPSS 396
           L     PSS
Sbjct: 309 LVHPPVPSS 317


>gi|227328077|ref|ZP_03832101.1| hypothetical protein PcarcW_12385 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 315

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 45/222 (20%), Positives = 97/222 (43%), Gaps = 4/222 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E    TL+   +  ++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLE--RDTLRPDMSSDEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A   N+  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTNVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           G AI +      +I V+ Q L      D+ +V  S L    +
Sbjct: 202 GSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPT 242


>gi|326796766|ref|YP_004314586.1| hypothetical protein Marme_3537 [Marinomonas mediterranea MMB-1]
 gi|326547530|gb|ADZ92750.1| protein of unknown function DUF610 YibQ [Marinomonas mediterranea
           MMB-1]
          Length = 344

 Score =  249 bits (635), Expect = 7e-64,   Method: Composition-based stats.
 Identities = 51/302 (16%), Positives = 117/302 (38%), Gaps = 7/302 (2%)

Query: 92  CNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKV- 150
               K  +S       + +     V+        ++       +  G  +  ++  +   
Sbjct: 44  VTAPKATTSISSPAEIDWLPNDLYVSNVDGLFDEEAPADASSPVGSGSLEPFIVPFSPFY 103

Query: 151 ---GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
                             S     RI+I++  LG ++ G + +   LP  + LA   +  
Sbjct: 104 QRVRLTPPSEVIRKDKVKSREQLPRISIIIDDLGYNRRGMESS-LNLPVEVALAILPHTP 162

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
              +   ++ ++ +  +L  PM+  ++   +     L  +   ++  + LR  L    G 
Sbjct: 163 FGKKTALKSIEQNRVTLLHAPME--NQRELKLGPGGLYASMGEEEFKSVLRDDLASLPGI 220

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            GV N+ G++L ++ ++   + +    R L F D  +S  ++   +A + ++     D++
Sbjct: 221 KGVNNHMGSLLTTDSQAMNWVMQVIGDRSLFFVDSVTSADSVAYTMALRHSINTTKRDVF 280

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           LD+     KI ++   L ++A   G AI +   + E++  +S+ L       V +VP+  
Sbjct: 281 LDNIRSEKKIEQQFLKLIQLAHQNGHAIAIGHPYPETMAYLSKRLADLSKLSVRLVPIDE 340

Query: 388 LA 389
           L 
Sbjct: 341 LM 342


>gi|188581495|ref|YP_001924940.1| hypothetical protein Mpop_2243 [Methylobacterium populi BJ001]
 gi|179344993|gb|ACB80405.1| protein of unknown function DUF610 YibQ [Methylobacterium populi
           BJ001]
          Length = 399

 Score =  248 bits (634), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 97/390 (24%), Positives = 169/390 (43%), Gaps = 10/390 (2%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
              L  PL       +   +   S           +V L+  I ++    G         
Sbjct: 6   DDILTKPLGVADKAARRRLALRPSAGVAAGAAALALVLLAGGIALTGDPRGGEPRASATI 65

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT-VVNKPT 120
            IRE      T    + D   P+ +       +++  S     +     +    V+ +  
Sbjct: 66  EIRE------TPAPRVADAAPPAPKGPVQSAGEVEQASGVSVYRPDGSTAPDAPVIIRVP 119

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
            +T +   P  + RL     +       ++G        +        +G RIA++VSGL
Sbjct: 120 NTTQVKLAPAPDPRLT---ERGRHGPLPRLGEGRLRPLDVYARPDEPGTGPRIAVLVSGL 176

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GI +  T  AI  LPA ++LA +  G+ L++    A++ G E +LQ+PM+ FD   ++  
Sbjct: 177 GIGENATLGAIARLPAAVSLALSPYGSDLEKTAARAREAGHEVLLQLPMEPFDYPDSDPG 236

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  +    + L+R  +++ R  G+ G +N+ GA L+S+  + E + K+ A RGL F 
Sbjct: 237 PQTLLASSRPGENLDRTAWAMSRFPGFVGAVNFMGAKLMSDPTALEPVLKDLAARGLGFV 296

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDG++  +    +A K  LP   AD+ +D     D I  +L  LE +AR  G  +  A A
Sbjct: 297 DDGAASASQVAGVAAKTKLPTARADIVVDAVARPDAIDAELARLETLARRNGLVLASASA 356

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              SI+ +S+W +    R + +VP+S + +
Sbjct: 357 SPLSIDRLSRWSRDLEARGIRLVPVSAVLR 386


>gi|284008837|emb|CBA75621.1| exported polysaccharide deacetylase [Arsenophonus nasoniae]
          Length = 319

 Score =  248 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 100/223 (44%), Gaps = 4/223 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
             + +++AIV+  +G  +      I  LP  I++A   +        ++A ++G+E ++ 
Sbjct: 19  QVNASKLAIVIDDIGY-RKKEDNQILALPVAISIAILPDSPYGREMAEKANQQGREILIH 77

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+   +   E    TL    +  ++  ++  ++++     G+ N+ G+ + +N  + +
Sbjct: 78  MPMKPISQQPLE--KNTLTPQMSASEIEQKIIAAIKQVPHAKGMNNHMGSAMTANLVAMK 135

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +    +   L F D  +         A    LP +  +++LDD     +IR++      
Sbjct: 136 NVMHVLSHYDLYFLDSVTIANTKVNEAAKFFALPTLRRNVFLDDVKTEAQIRKQFAHAIS 195

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            AR  G +I +   +  +I+V+ Q L +    D+ +V +S L 
Sbjct: 196 FARKQGSSIVIGHPYPATIQVLHQTLFELPS-DIELVAVSKLL 237


>gi|323697918|ref|ZP_08109830.1| protein of unknown function DUF610 YibQ [Desulfovibrio sp. ND132]
 gi|323457850|gb|EGB13715.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           desulfuricans ND132]
          Length = 410

 Score =  248 bits (634), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 70/390 (17%), Positives = 139/390 (35%), Gaps = 24/390 (6%)

Query: 19  FYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIE 78
              +    + LF L    + GL  ++L++         + P +  R   P P  +   + 
Sbjct: 22  RIYRPGPLIFLFTLAFLALAGL-GWMLLTKQTPPPQV-ITPVAEERREEPQPDKVYEEVT 79

Query: 79  DKQSPSKRDNNTVCNQLKNDSSQH----------DGQIQNDISGKTVVNKPTRSTSIDSL 128
                  +  +    +   D                + +       V+  P  +     L
Sbjct: 80  SDMEDQVKQADLAIIETMRDLDLKMHDLDLVDVEQRRFEGSGYHYQVLQFPKVTDRNRFL 139

Query: 129 PTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN----------FCSNASGARIAIVVS 178
            T+  RL   L    LL                                A G ++ +V+ 
Sbjct: 140 VTLRRRLFDRLPDAVLLDNGDTEAAIEIRGQRTHRLLLEATPQIIARPEAKGPKLVVVID 199

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
            +G       + +  L   +T A   + +     ++   K   + ++  PM+       +
Sbjct: 200 DVGEDY-RVLKGLAGLDLPLTFAVWPHASHTRECVEWIAKTHHDLLIHFPMEPMGYPQVK 258

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
                L V+ T  Q+  R+  +L R     GV N+ G+   ++K    V   EF + GL 
Sbjct: 259 PGDDALFVSMTPDQVRQRVADNLARIPEAIGVNNHMGSRFTADKAGMAVALTEFKRHGLF 318

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F D  +S +++ R  A  + +P+   D +LD+  D + I  +L+  E +A+  G+AI + 
Sbjct: 319 FLDSLTSGKSVGRATAKTVGIPFYERDTFLDNVKDVNAILLQLRKTERVAQRQGRAIAIG 378

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             + ++++ +  W Q      + V+ LS L
Sbjct: 379 HPYRQTLDALRAW-QDSRDPAIQVITLSKL 407


>gi|294638294|ref|ZP_06716547.1| YibQ protein [Edwardsiella tarda ATCC 23685]
 gi|291088547|gb|EFE21108.1| YibQ protein [Edwardsiella tarda ATCC 23685]
          Length = 294

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 94/229 (41%), Gaps = 5/229 (2%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A   ++AIV+   G  +   ++ +  LP  IT+A   N          A  +G+E +
Sbjct: 2   AAPAQAGKLAIVIDDFGY-RPHEEKQVLALPLPITIAVLPNAPHAREMALRAHAQGREIL 60

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+ T +  ++   +  ++       G+ N+ G+ + SN   
Sbjct: 61  IHLPMAPLSKQPLE--RNTLQPTMSEAEIQRIIHQAVDNVPYAVGMNNHMGSAMTSNLAG 118

Query: 285 AEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
            + + +   +   L F D  +   +     A    +  +   ++LDD  +   IR +L  
Sbjct: 119 MQKVMRALEQYHFLYFLDSVTIAHSQVSNAAQGTGVKVIKRKVFLDDAQNESAIRAQLNR 178

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             ++AR  G AI +      ++ V+ Q L      D+ +V  S L   S
Sbjct: 179 AIQLARRNGSAIAIGHPHPTTVRVLQQMLPNLPA-DIVLVKPSALLNES 226


>gi|253690446|ref|YP_003019636.1| hypothetical protein PC1_4085 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251757024|gb|ACT15100.1| protein of unknown function DUF610 YibQ [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 315

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 44/222 (19%), Positives = 96/222 (43%), Gaps = 4/222 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E    TL+   +  ++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLE--RDTLRPDMSSDEIQRIIRQSVNNVPHAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           G AI +      +I V+ Q L      D+ +V  S L    +
Sbjct: 202 GSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPT 242


>gi|167621981|ref|YP_001672275.1| hypothetical protein Shal_0040 [Shewanella halifaxensis HAW-EB4]
 gi|167352003|gb|ABZ74616.1| protein of unknown function DUF610 YibQ [Shewanella halifaxensis
           HAW-EB4]
          Length = 230

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 47/223 (21%), Positives = 98/223 (43%), Gaps = 4/223 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AI++  LG  Q  + +A+  LPANITL+   +        +EA  +G E ++ +PMQA 
Sbjct: 1   MAIIIDDLGYRQ--SDKAVLSLPANITLSILPHTPLGQSLAREAYLQGNEVLVHLPMQAL 58

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           +          L  T +  +L  ++  S+       G  N+ G++L         + +  
Sbjct: 59  NGKAI--GPGALTNTMSETELKTQIADSINSVPNASGANNHMGSLLTQLNSPMRWVMESL 116

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +  L F D  ++       +A  + +P +  +++LD+      + ++      +A T  
Sbjct: 117 QQHNLYFIDSMTTKYTRAGAIAESMGVPLLRREIFLDNDRSPAGLEKQFNYAISLAHTKR 176

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             + +A  + E+IE +++ L +    ++ +VP S L      +
Sbjct: 177 NIVVIAHPYPETIEFLNENLHRLQSSNIDLVPTSQLLPQRVAT 219


>gi|317050088|ref|YP_004117736.1| hypothetical protein Pat9b_3890 [Pantoea sp. At-9b]
 gi|316951705|gb|ADU71180.1| protein of unknown function DUF610 YibQ [Pantoea sp. At-9b]
          Length = 301

 Score =  248 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 91/225 (40%), Gaps = 4/225 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G      +  +  +PA I++A   N         +A + G E ++ +
Sbjct: 20  AHAGKLSIVIDDFGYRPVE-ENKVLQMPAAISVAVLPNATYAREMATKAHQSGHEVLIHL 78

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E    TL    +  ++   +  ++ +     G+ N+ G+ + S+    + 
Sbjct: 79  PMAPLSKQPLE--KDTLTPEMSSAEIERIIHDAVGKVPYAVGLNNHMGSKMTSSLPGMQK 136

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +        F D  +   + +   A   ++  +   ++LDD  +   IR++     ++
Sbjct: 137 VMQVLNHYNFYFLDSMTIGNSQSVPAAQGTHVKVLKRRVFLDDSQNDAAIRQQFTRAVKL 196

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           A+  G AI +      ++ V+ Q L      D+++V  S L    
Sbjct: 197 AQRDGYAIAIGHPHPNTVRVLQQMLPTLPA-DITLVRPSQLLNEP 240


>gi|170718741|ref|YP_001783929.1| protein of unknown function DUF610 YibQ [Haemophilus somnus 2336]
 gi|168826870|gb|ACA32241.1| protein of unknown function DUF610 YibQ [Haemophilus somnus 2336]
          Length = 285

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 101/219 (46%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G         I  LP  +++A   +     +  ++AK++ ++ ++ +PMQ 
Sbjct: 32  KLAIVIDDIGYRLKE-DNQIYSLPKEVSVAIIPSAPHAKQRDQQAKQQNRDILIHLPMQP 90

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            ++   ED    +K+  +  ++  R+R +        G+ N+ G+   ++K+    +   
Sbjct: 91  LNQQKIEDG--GIKLGMSQPEVYQRVRNAKSILPNAIGMNNHMGSAATADKDLMNKLMTA 148

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  R++   +A +  +P +   ++LDD      ++ +     + AR  
Sbjct: 149 LLQQNLFFLDSRTIGRSVAGKIAREFGIPTLERHIFLDDSDKLSDVQRQWNAAIQYARKR 208

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   ++Q   +D+ +V +  L +
Sbjct: 209 GTAIVIGHPRKNTIAVLQMGIKQLP-KDIQLVGIGSLWR 246


>gi|291619436|ref|YP_003522178.1| YibQ [Pantoea ananatis LMG 20103]
 gi|291154466|gb|ADD79050.1| YibQ [Pantoea ananatis LMG 20103]
          Length = 303

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 42/224 (18%), Positives = 94/224 (41%), Gaps = 4/224 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
             A++AIV+   G   T  +  +  +P  I++A   +     +   +A + G+E ++ +P
Sbjct: 22  QAAKLAIVIDDFGYRPTE-ENKVLQMPQAISVAVLPDAPYARQMAIKAHQGGREVLIHLP 80

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M    +   E    TL    +  ++   +R ++       G+ N+ G+ + S+    + +
Sbjct: 81  MAPLSKQPLE--KNTLTPEMSRAEIDRIIRSAVNNVPYAVGLNNHMGSKMTSSLPGMQKV 138

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            +   +  L F D  +   + +   A   ++  +   ++LDD  D + IR++      +A
Sbjct: 139 MQALNQYNLYFLDSMTIGNSQSLQAAQGTHVRVLKRRVFLDDSQDINAIRQQFNRAVTLA 198

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +  G AI +      ++ V+ Q L      D+++V    L    
Sbjct: 199 QRDGYAIAIGHPHPNTVRVLQQMLPSLPA-DITLVTPGQLLNEP 241


>gi|227114297|ref|ZP_03827953.1| hypothetical protein PcarbP_15088 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 315

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 46/225 (20%), Positives = 99/225 (44%), Gaps = 4/225 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +PM  
Sbjct: 25  KLSIVIDDFGY-RPHNENQILAMPTAISIAVLPNAPYAREMATKAHQQGREVLIHLPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E    TL+   + +++   +R S+       G+ N+ G+ + ++    + + + 
Sbjct: 84  MSKQPLE--RDTLRPDMSSEEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
            +   L F D  +   + +   A   N+  +   ++LDD  +  +IR++     +IAR +
Sbjct: 142 LSAYQLYFLDSMTIGSSQSSQAAAGTNVKVIKRKVFLDDSQNEAEIRKQFTRAVQIARRS 201

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           G AI +      +I V+ Q L      D+ +V  S L    +  S
Sbjct: 202 GSAIAIGHPHPSTIRVLQQMLPTLDT-DIVLVRPSQLLNEPTRQS 245


>gi|224368263|ref|YP_002602426.1| hypothetical protein HRM2_11500 [Desulfobacterium autotrophicum
           HRM2]
 gi|223690979|gb|ACN14262.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 349

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 68/307 (22%), Positives = 122/307 (39%), Gaps = 8/307 (2%)

Query: 86  RDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELL 145
                    +   +     + +   S K V  KP  S   D   T   +  +     +  
Sbjct: 50  PVAKREAAPVARTTPDRP-EPEPVQSKKRVSIKPEPSRKPDKKATTSRKHPVFEVFDDSD 108

Query: 146 AKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASN 205
              K   E   VP             R+AI++  +G  +  +  AI+ L  +ITL+    
Sbjct: 109 ETPKQRPEPAAVPP-----VLQDKTPRVAIIIDDIGFDKKISL-AISGLDPHITLSILPY 162

Query: 206 GNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGT 265
                       ++G E +L +PM+  +    +     L  T T  +LL++LR  L    
Sbjct: 163 APHAKAIALLLHQRGTETLLHLPMEPMEYPKIDPGPGALLSTMTPDELLDQLRLDLDIIP 222

Query: 266 GYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
              GV N+ G+ + S       IF    +R L F D  ++  +L R  A  L +P+   D
Sbjct: 223 FVAGVNNHMGSRMTSLSPQMNQIFTVLKQRNLFFIDSLTAKGSLCRQSARLLRIPFAQRD 282

Query: 326 LYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
           ++LD+  D D I+++L  L  +A+  G AIG+   +  +   +   +++   + + +VP 
Sbjct: 283 VFLDNVQDADYIKKQLAQLLAVAQRHGTAIGIGHPYRATYLTLKSEMERLKKK-IRIVPA 341

Query: 386 SCLAKLS 392
           S L  + 
Sbjct: 342 SALVAIP 348


>gi|254360760|ref|ZP_04976908.1| hypothetical protein MHA_0322 [Mannheimia haemolytica PHL213]
 gi|153091330|gb|EDN73304.1| hypothetical protein MHA_0322 [Mannheimia haemolytica PHL213]
          Length = 281

 Score =  246 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 42/231 (18%), Positives = 96/231 (41%), Gaps = 4/231 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F      A++AIV+  +G  +    R I  LP  +++A            K+A  + ++ 
Sbjct: 21  FTPLVQAAQMAIVIDDVGY-RIKEDREILALPKAVSVAIIPVAPYATERAKDAYNQKRDI 79

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E+    + +    +++   +  S  +     G+ N+ G+   S+  
Sbjct: 80  LIHLPMEPKSKQPIEEG--GIHIGDNEEKIRKLIHTSRGQVPYAIGLNNHMGSGATSDSA 137

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + K   +  L F D  +   ++    A +  +  +  D++LDD      ++++   
Sbjct: 138 TMQHLLKVLKENTLFFLDSKTIGSSVAAKTARQFGINTLERDIFLDDSDLLADVQKQFAH 197

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
               AR  G A+ +      +I V+ Q L Q   +D+ +V +  L +    
Sbjct: 198 AINHARKNGVAVVIGHPRKNTISVLKQNLAQLP-QDIELVSVGNLWRNEKT 247


>gi|227354766|ref|ZP_03839183.1| protein of hypothetical function DUF610, YibQ [Proteus mirabilis
           ATCC 29906]
 gi|227165084|gb|EEI49915.1| protein of hypothetical function DUF610, YibQ [Proteus mirabilis
           ATCC 29906]
          Length = 304

 Score =  246 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 50/233 (21%), Positives = 98/233 (42%), Gaps = 5/233 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F + A  A++AIV+   G  +      I  LP  +++A   N         +A  +G+E 
Sbjct: 7   FSAPAFSAKLAIVIDDFGY-RKKEDNQILQLPTAVSIAILPNSPHGKEMATKAHAQGREI 65

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TLK +    ++   ++ ++ R     G+ N+ G+ + S+++
Sbjct: 66  LIHMPMAPISKQPLE--KDTLKPSMDQAEINRIIQNAINRVPYAVGMNNHMGSAMTSDRQ 123

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + K      L F D  +         A    +P +   ++LD+     + R++L  
Sbjct: 124 AMDRVIKALNHSDLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLNR 183

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
              +AR  G AI +      ++  + Q L      D+ +V  S L    SP S
Sbjct: 184 AINLARKNGFAIAIGHPHPSTVRALQQQLPLLPA-DIQLVAPSGLL-TPSPDS 234


>gi|317051484|ref|YP_004112600.1| hypothetical protein Selin_1309 [Desulfurispirillum indicum S5]
 gi|316946568|gb|ADU66044.1| protein of unknown function DUF610 YibQ [Desulfurispirillum indicum
           S5]
          Length = 426

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 48/263 (18%), Positives = 106/263 (40%), Gaps = 6/263 (2%)

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
                G+   E +          E   +++ +   A   RIAI++   G +    ++A+ 
Sbjct: 153 PAEPEGVPMDE-IPVPPRPGTPLEPLQVEEPWEKPA---RIAIILDDAGDNFQLAKQAV- 207

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
            +   +TL+            +   + G E +L  PM+A +          L  T   ++
Sbjct: 208 QIHPAVTLSILPKRPFSREISQLLDRMGLEYMLHQPMEAQN-PLINPGWAALLTTMDEEE 266

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
           + +    +L    G  G+ N+ G+    + +   ++ +  A+R L F D  ++  +    
Sbjct: 267 IRSTFTAALESLPGVAGINNHMGSRFTQDPDRLRIVMEMIAERDLYFIDSYTTSDSQAYA 326

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           +A +  +     D+++D++ D + I  +L  L   A+  G AIG+      +IE + ++ 
Sbjct: 327 VATEFQVSSGFRDVFIDNESDVEAILRQLDILVRDAQRYGSAIGIGHVRSRTIEALEEFT 386

Query: 373 QQEHVRDVSVVPLSCLAKLSSPS 395
            +    +V +V  S +     P+
Sbjct: 387 GRLEEMNVELVTPSVIVSHRKPA 409


>gi|304398998|ref|ZP_07380867.1| protein of unknown function DUF610 YibQ [Pantoea sp. aB]
 gi|304353458|gb|EFM17836.1| protein of unknown function DUF610 YibQ [Pantoea sp. aB]
          Length = 300

 Score =  246 bits (627), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 46/229 (20%), Positives = 97/229 (42%), Gaps = 4/229 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           FCS A   +++IV+  +G  +   +  +  +P  I++A   N         +A + G E 
Sbjct: 16  FCSAAQAGKLSIVIDDVGY-RPAEENKVLQMPQAISVAVLPNAPHAREMAIKAHQGGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL    + +++   +R ++       G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLE--KDTLTPEMSSEEVARIMRNAVNNVPYAVGLNNHMGSRMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +      L F D  +   +     A    +  +   ++LDD  D + IR++   
Sbjct: 133 GMQKVMQALNHYNLYFLDSMTIANSQAIPAAQGTQVKVLKRRVFLDDSQDINAIRQQFSR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             ++A+  G AI +      ++ V+ Q L      D+++V  S L   S
Sbjct: 193 AVKLAQRDGYAIAIGHPHPNTVRVLQQMLPTLPA-DITLVRPSELLNES 240


>gi|253573367|ref|ZP_04850710.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251846895|gb|EES74900.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 307

 Score =  246 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 47/270 (17%), Positives = 105/270 (38%), Gaps = 9/270 (3%)

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA--RIAIVVSGLGISQTGTQRAI 191
                 +   L         + +    D         A  ++A+++  LG    GT+  I
Sbjct: 29  SGQAAPTANNLAENPGTESSELKSETQDHKAALKPRSASHKVAVIIDDLGNGMAGTEE-I 87

Query: 192 NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQ 251
             LP  +T+A      +     + A + G + I+ +PM+             +  + T +
Sbjct: 88  LNLPIKLTVAVMPFLETTQEDARRAHEYGHDVIIHMPMEPKQGKAEWLGPGAILSSMTDE 147

Query: 252 QLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
           ++  R+  ++ +     G+ N+ G+ +  ++    VI +   +RGL F D  ++ R++  
Sbjct: 148 EIRQRVEAAIDQVPYAIGMNNHMGSKVTEDERVMSVILEVCRERGLFFIDSKTNSRSVVP 207

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI--ARTTGQAIGVAVA---FDESIE 366
            L+ K+ LP +  D++LDD      + ++L+ +  I         + +        ++  
Sbjct: 208 RLSEKMGLPRLENDIFLDDVGSEAHVTKQLRQVLNILNKGKRNSCVTIGHVGVQGKKTAA 267

Query: 367 VISQWLQQEHVRDVSVVPLSCLA-KLSSPS 395
            + + +       V  +  S L  +  SPS
Sbjct: 268 ALQKNIPILQAVGVQFIGTSELVWEQISPS 297


>gi|50119129|ref|YP_048296.1| hypothetical protein ECA0169 [Pectobacterium atrosepticum SCRI1043]
 gi|49609655|emb|CAG73088.1| putative exported protein [Pectobacterium atrosepticum SCRI1043]
          Length = 315

 Score =  246 bits (627), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 45/228 (19%), Positives = 97/228 (42%), Gaps = 4/228 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +
Sbjct: 21  ALAGKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E    TL+   +  ++   +R S+       G+ N+ G+ + ++    + 
Sbjct: 80  PMAPMSKQPLE--RDTLRPDMSSDEIQLIIRQSVSNVPYAVGLNNHMGSAMTASLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +I
Sbjct: 138 VMQALSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFTRAVQI 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           AR +G AI +      +I V+ Q L      D+ +V  S L    +  
Sbjct: 198 ARRSGSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPTQH 244


>gi|260914710|ref|ZP_05921175.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631214|gb|EEX49400.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 280

 Score =  245 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 44/223 (19%), Positives = 103/223 (46%), Gaps = 4/223 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G  Q      I  +P  I++A   +     +  ++AK++G++ ++ +
Sbjct: 25  AQSAKLAIVIDDIGYHQKE-DAQIYAMPTEISVAIIPSAPHARQRNEQAKQQGRDVLIHM 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ   +   E     LK+  +  ++ +R++ + R  +   G+ N+ G+   S+      
Sbjct: 84  PMQPLGQQKIETG--GLKLGLSQDEVNDRVQTAKRIVSHAIGMNNHMGSAATSDSALMTK 141

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +   ++ L F D  +  R++   +A +  +  +   ++LDD      ++ + +     
Sbjct: 142 LMRSLKEQHLFFLDSRTIGRSVAGKIAKEYGVKSLDRHIFLDDSDLYADVQRQFQNAVRY 201

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           A+  G AI +      ++ V+   L+    +DV +V +  L +
Sbjct: 202 AQKNGTAIVIGHPRKNTVAVLQAGLKNLP-KDVQLVGIGSLWR 243


>gi|222055713|ref|YP_002538075.1| protein of unknown function DUF610 YibQ [Geobacter sp. FRC-32]
 gi|221565002|gb|ACM20974.1| protein of unknown function DUF610 YibQ [Geobacter sp. FRC-32]
          Length = 314

 Score =  245 bits (626), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 45/268 (16%), Positives = 107/268 (39%), Gaps = 1/268 (0%)

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLG 181
               +   ++E + +      +    +             +          +AI++  +G
Sbjct: 47  PGKQERQGSVERQKMPARPAAKPGKHDIYTAAKARPVPQARTRPHLTGPGTVAIIIDDMG 106

Query: 182 ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDS 241
              T    ++  +   IT A            + A  +G E ++ IPM+       + + 
Sbjct: 107 -RSTREADSLLAINLPITFAIIPGYAKARAVAEIAHGRGGEVMVHIPMEPQGYPEKKMEK 165

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
             L + ++ +Q+ ++++  L+      G  N+ G+    ++E  + + +   ++GL F D
Sbjct: 166 NGLLLGESNEQIASKVKGYLQEIPYAVGANNHMGSRFTESEEKMQPVLQILQEKGLFFVD 225

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF 361
             +SP++    LA K+ L      ++LD+  +   I  +L+ + + AR  G AI +    
Sbjct: 226 SMTSPKSAGFRLARKMGLKSGTRQVFLDNVQNVQAINAQLQQVADAARRRGSAIAICHPH 285

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +I+ +S  + Q   + ++ V  S + 
Sbjct: 286 RTTIQALSGMMPQLKKQGITFVYASQIV 313


>gi|303246510|ref|ZP_07332789.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           fructosovorans JJ]
 gi|302492220|gb|EFL52095.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           fructosovorans JJ]
          Length = 374

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 66/376 (17%), Positives = 124/376 (32%), Gaps = 18/376 (4%)

Query: 13  TPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT 72
             K       ++       +    ++ +S+ +L    F G    +    V+R      + 
Sbjct: 13  RAKAGGKRKVVLPGRPYIAVIAGLVLAISLGVLAMLLF-GPFPPLPLDHVVRNAKAGHVR 71

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
            P+    K     +  +       +                  +       S ++ P   
Sbjct: 72  QPVAATVKPRHPSKPPHEARAVAHDAQP-------------AALPFEEHLPSTETPPNGS 118

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
           +  I           +    E        +     A G R+ +V+  +G       R + 
Sbjct: 119 QVRIKVEPAAPAAPPSPPAAEPATQSP--QPAEDTAKGPRMVVVIDDIG-DNPVMARRLM 175

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
            LP  +TLA   N         E    G E IL  PMQ             L      ++
Sbjct: 176 ELPFPVTLAILPNRPHTRSLAAEIAAHGNETILHQPMQPISYPRVNPGPGALFTDMDTRR 235

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
           +   L  ++ +     G+ N+ G+   S++   + +       GL F D  +SP +    
Sbjct: 236 IQTTLSENIAQLPHIVGINNHMGSAFTSDQAGMDAVMPVLKAHGLFFMDSVTSPASAAAE 295

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
            A K  + Y    ++LD+  +   I  +LK  E  A   G+AI +   ++E+ E +  W 
Sbjct: 296 AARKAGVHYYRRAVFLDNVRNVRTILGQLKTAERHALKHGRAIAIGHPYNETYEALLLWA 355

Query: 373 QQEHVRDVSVVPLSCL 388
           ++     VS+V L+ L
Sbjct: 356 KE-RDPHVSLVTLTEL 370


>gi|156936214|ref|YP_001440130.1| hypothetical protein ESA_04113 [Cronobacter sakazakii ATCC BAA-894]
 gi|156534468|gb|ABU79294.1| hypothetical protein ESA_04113 [Cronobacter sakazakii ATCC BAA-894]
          Length = 313

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 43/218 (19%), Positives = 88/218 (40%), Gaps = 4/218 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IV+   G  + GT+  +  +PA +++A   N         +A  +G + ++ +PM    +
Sbjct: 28  IVIDDFGY-RPGTENQVLAMPAEVSVAVLPNAPHAREMATKAHNQGHDVLIHLPMAPLSK 86

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              E    TL+   +  ++   +R ++       G+ N+ G+ + S+    + +    A 
Sbjct: 87  QPLE--KDTLRPDMSADEIARIIREAVNSVPYAIGMNNHMGSAMTSSLPGMQKVMASLAH 144

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
             L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G A
Sbjct: 145 YNLFFLDSMTIGNSQAMRAAAGTGVKVIKRKVFLDDTQNDADIRYQFNRAVALARRNGSA 204

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I +      ++ V+ Q L      D+++V  S L    
Sbjct: 205 IAIGHPHPSTVRVLQQMLYNLPP-DITLVRASSLLNEP 241


>gi|319652983|ref|ZP_08007088.1| hypothetical protein HMPREF1013_03703 [Bacillus sp. 2_A_57_CT2]
 gi|317395332|gb|EFV76065.1| hypothetical protein HMPREF1013_03703 [Bacillus sp. 2_A_57_CT2]
          Length = 257

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 98/230 (42%), Gaps = 5/230 (2%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             +      +AIV+  LG +  GT   +  LP  +T+A      +     + A + G E 
Sbjct: 21  ISAAPLKPELAIVIDDLGNNMKGTAE-MMELPVTLTVAIMPFMPTTKEDAELASENGHEV 79

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+ +PM+      +      +    T +++ +R+  +++      G+ ++ G+    N+ 
Sbjct: 80  IVHMPMEPKRGKRSWLGPGAITTDLTDEEIRSRVESAIKEVPHAVGMNHHMGSRATENER 139

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
              ++ K   + GL + D  ++ +++   LA ++ +PY+  +++ DD      I ++   
Sbjct: 140 VMRIVLKVCKEHGLFYLDSKTTGKSVVGKLAKEIGVPYVENNIFFDDIYTTAHITKQADR 199

Query: 344 LEEIARTTGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           L E      + I +        + + V+ +++     +   +VPLS L  
Sbjct: 200 LAEKLVKNERIIAIGHVGITGTKMVNVLKEYIPVYKEKA-EIVPLSELIP 248


>gi|228990430|ref|ZP_04150395.1| hypothetical protein bpmyx0001_11920 [Bacillus pseudomycoides DSM
           12442]
 gi|228768956|gb|EEM17554.1| hypothetical protein bpmyx0001_11920 [Bacillus pseudomycoides DSM
           12442]
          Length = 255

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 97/237 (40%), Gaps = 5/237 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F + A   ++AIV+   G +  GT+R +  LP  +T+A      S  +    A +KG E
Sbjct: 18  PFQTYAHTNKVAIVIDDFGNNMKGTER-MLSLPIPLTVAVMPFLPSTKQDAVAAHQKGHE 76

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+             +    +  ++ +R+  +++      G+ N+ G+ + +++
Sbjct: 77  VIIHMPMEPIKGKKEWLGPKAITTDLSDHEIESRVEQAIQEVPHAIGMNNHMGSKVTADE 136

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ +
Sbjct: 137 RIMRIILSVCKKHGLFYLDSKTNPNSVVPKIGKELGVPIVENQLFFDDVYTSSHITKQAQ 196

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            L +  +     + +         +  VI   + +        + LS L     P S
Sbjct: 197 LLLQKIKEKPVVVAIGHVGPPGEITSRVIESTIPKVREHA-DFIFLSDLVLSPPPVS 252


>gi|261823559|ref|YP_003261665.1| hypothetical protein Pecwa_4366 [Pectobacterium wasabiae WPP163]
 gi|261607572|gb|ACX90058.1| protein of unknown function DUF610 YibQ [Pectobacterium wasabiae
           WPP163]
          Length = 313

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 97/226 (42%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   +++IV+   G  +   +  I  +P  I++A   N         +A ++G+E ++ +
Sbjct: 21  ALAGKLSIVIDDFGY-RPHNENQILAMPTAISVAVLPNAPYAREMATKAHQQGREVLIHL 79

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM    +   E    TL+   +  ++   +R S+       G+ N+ G+ + ++    + 
Sbjct: 80  PMAPMSKQPLE--RDTLRPDMSSDEIQRIIRQSVNNVPYAVGLNNHMGSAMTASLPGMQK 137

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + +  +   L F D  +   + +   A    +  +   ++LDD  +  +IR++     +I
Sbjct: 138 VMQALSAYQLYFLDSMTIGSSQSSQAAAGTGVKVIKRKVFLDDSQNEAEIRKQFARAVQI 197

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AR +G AI +      +I V+ Q L      D+ +V  S L    +
Sbjct: 198 ARRSGSAIAIGHPHPSTIRVLQQMLPTLDA-DIVLVRPSQLLNEPT 242


>gi|219870484|ref|YP_002474859.1| hypothetical protein HAPS_0219 [Haemophilus parasuis SH0165]
 gi|219690688|gb|ACL31911.1| conserved hypothetical protein [Haemophilus parasuis SH0165]
          Length = 281

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 99/230 (43%), Gaps = 4/230 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++ IV+  +G  +     AI  LP  + +A   +         +AK++G+E 
Sbjct: 21  FAPLAYANKLVIVIDDIGY-RIKEDNAIYTLPKEVNVAIIPSAPYATARANKAKEQGREI 79

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQ   +   E     L V     ++   +  + ++      + N+ G+   ++K 
Sbjct: 80  LIHLPMQPKVKQPIEAG--ALLVGMGESEVSELIHQAQQQVPYAIALNNHMGSKATADKT 137

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + K  +++GL F D  ++  ++    A    L  +   ++LD+      ++ + + 
Sbjct: 138 TMQHLMKALSQQGLGFLDSKTAGDSVAYQTAKAYGLNALERHIFLDNSDVFADVQRQFQH 197

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             + AR  G AI +      SI V+ Q +      D+ +V LS L K  +
Sbjct: 198 AVQYARKHGIAIMIGHPRKHSIAVLEQGIANLPA-DIQLVSLSSLWKTEN 246


>gi|118580822|ref|YP_902072.1| hypothetical protein Ppro_2408 [Pelobacter propionicus DSM 2379]
 gi|118503532|gb|ABL00015.1| protein of unknown function DUF610, YibQ [Pelobacter propionicus
           DSM 2379]
          Length = 342

 Score =  244 bits (623), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 65/378 (17%), Positives = 125/378 (33%), Gaps = 40/378 (10%)

Query: 13  TPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLT 72
            P RK+             +    I+ +  Y+L++                R+    PL+
Sbjct: 5   RPNRKNQSRGGGPTYAALAILAVVILAVIGYLLLT---------------PRKRPFQPLS 49

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
            P+  ++ +    R                                     + ++LP   
Sbjct: 50  PPVAGKESRPKVHRPGQRADLPA------------------------PPRVTPETLPATP 85

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
             +      K  L         +EV              R+AI++  +G       R++ 
Sbjct: 86  PSVPPETPVKPPLKPEYPAEPPSEVEKAPLPAVVPGGKGRLAIIIDDMGAGM-REARSLA 144

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
            +   +T A      S       A   G E ++ +PMQ+        +S  L V      
Sbjct: 145 AIGVPLTFAIIPGLRSCREVAAFAAGNGIETMIHLPMQSKGWPQQRLESNGLLVAMEEAD 204

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
           +  R+    R      G  N+ G+    ++     +      RGL F D  ++PR++ + 
Sbjct: 205 IRERMEGFARDVPHAVGANNHMGSEFTEHEPQMSTVLGVLKGRGLFFIDSVTTPRSVGQR 264

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
           LA ++ +      ++LD++ +   IR +L      AR  G AI +      +I  ++  L
Sbjct: 265 LAREMGVRSGRRSVFLDNEQNGAYIRGQLNQAVRQARKNGGAIAICHPHPATIATLAAAL 324

Query: 373 QQEHVRDVSVVPLSCLAK 390
                + V++VP S L +
Sbjct: 325 PTLQQQGVTLVPASRLVR 342


>gi|238921665|ref|YP_002935180.1| hypothetical protein NT01EI_3821 [Edwardsiella ictaluri 93-146]
 gi|238871234|gb|ACR70945.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 312

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 94/229 (41%), Gaps = 5/229 (2%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A   ++AIV+   G  +   +  +  +P  +T+A   N        + A  +G+E +
Sbjct: 18  TAPAQAGKLAIVIDDFGY-RPREENKVLEMPLPVTIAVLPNAPHAREMAQRAHAQGREIL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+ T +  ++   +R ++       G+ N+ G+ + S+   
Sbjct: 77  IHLPMAPLSKQPLE--RDTLQPTMSEAEIQRIIRQAVGNVPYAVGMNNHMGSAMTSSLTG 134

Query: 285 AEVIFKEFAKRG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
            + + +   +   L F D  +   +     A    +  +   ++LDD      IR +L  
Sbjct: 135 MQKVMRALEQYHFLYFLDSMTISHSQVSNAAQGTGIRVIKRKVFLDDTQSESAIRTQLNR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
              +AR  G AI +      ++ V+ Q L      D+++V  S L   +
Sbjct: 195 AITLARRNGSAIAIGHPHPATVRVLQQMLHTLPP-DITLVRPSTLLNEA 242


>gi|54307443|ref|YP_128463.1| hypothetical protein PBPRA0222 [Photobacterium profundum SS9]
 gi|46911863|emb|CAG18661.1| hypothetical protein PBPRA0222 [Photobacterium profundum SS9]
          Length = 271

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 100/220 (45%), Gaps = 4/220 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
             A++AIV+  LG         ++ LP  +T++   N         +AKK+ +E +L +P
Sbjct: 52  HAAQLAIVIDDLGY--QAMPELLSNLPPEVTISILPNTPFDLAVAAQAKKQHRETLLHMP 109

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+    +  E    TL    + Q L + LR +L R      + N+ G+ L  + ++   I
Sbjct: 110 MEPEHLAPLEV--NTLTSAMSQQTLQHTLRQALTRVPNAIAINNHMGSALSQDTQAMGWI 167

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
             E  +  L + D  ++ +++ +  A   ++  +   ++LD    ++ + ++L    + A
Sbjct: 168 MAELKQHNLYYLDSRTTAKSIAQQQATSHHVLSLRRHVFLDHYQTKEFVTKQLMSAIKRA 227

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G AI +      ++  +++ L      D+++V LS L
Sbjct: 228 KQYGYAIAIGHPHPVTLSTLNELLPNLTEEDITLVRLSTL 267


>gi|78777856|ref|YP_394171.1| hypothetical protein Suden_1659 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498396|gb|ABB44936.1| Protein of unknown function DUF610, YibQ [Sulfurimonas
           denitrificans DSM 1251]
          Length = 364

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 65/378 (17%), Positives = 149/378 (39%), Gaps = 24/378 (6%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPI 69
           RKK   +KS      +   L  +       ++ Y  I H       + +     +E    
Sbjct: 4   RKKASPKKSSNFLSYTVWSLAFVAIVLSSFVAGY-YIGHD--SAKDDALKKEQSKEKTKQ 60

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
            +   L  E  +  S  D  +V ++LK    +     +                S +S  
Sbjct: 61  SMIKKLEQESIKKKSLEDEQSVSDRLKEVLKKEPAVAETL------------KDSNESNK 108

Query: 130 TIEERLILGLSKKELLAK----NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQT 185
           + +  +   L  KE++++    +    E     A+++    +    ++AI++    +S  
Sbjct: 109 SNDSNVTSSLPIKEVVSEYENASHEIEEAVLPKAVERKIVKSLKRPKLAIIIDD--VSVK 166

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
               AI  L   IT++F     +       A ++    ++ +PM+A      E    TL+
Sbjct: 167 SHVNAIKGLHLPITMSFLPPSKARPSSHILASQESF-YMVHLPMEAQSFKSEE--PLTLR 223

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
           V  + ++++ R+    +       + N+ G+   +++ + + +     K  ++F D  ++
Sbjct: 224 VDDSNEKIVQRVVEIKKLFPKVKYINNHTGSKFTADEAAMDRLISALKKSDIIFVDSRTT 283

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESI 365
             +  + ++ K  L Y+  D++LD ++D+  I  ++K   E+A+  G AI +      +I
Sbjct: 284 GESKAQKISKKYALEYIGRDVFLDHKMDKAYILSQIKKAIEVAKKHGSAIAIGHPHANTI 343

Query: 366 EVISQWLQQEHVRDVSVV 383
             I++  +     D+ +V
Sbjct: 344 AAINESKKLFADVDLVLV 361


>gi|197286993|ref|YP_002152865.1| exported polysaccharide deacetylase [Proteus mirabilis HI4320]
 gi|194684480|emb|CAR46240.1| putative exported polysaccharide deacetylase [Proteus mirabilis
           HI4320]
          Length = 321

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 49/231 (21%), Positives = 97/231 (41%), Gaps = 5/231 (2%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           + A  A++AIV+   G  +      I  LP  +++A   N         +A  +G+E ++
Sbjct: 26  APAFSAKLAIVIDDFGY-RKKEDNQILQLPTAVSIAILPNSPHGKEMATKAHAQGREILI 84

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM    +   E    TLK +    ++   ++ ++ R     G+ N+ G+ + S++++ 
Sbjct: 85  HMPMAPISKQPLE--KDTLKPSMDQAEINRIIQNAINRVPYAVGMNNHMGSAMTSDRQAM 142

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + + K      L F D  +         A    +P +   ++LD+     + R++L    
Sbjct: 143 DRVIKALNHSDLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLNRAI 202

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            +AR  G AI +      ++  + Q L      D+ +V  S L    SP S
Sbjct: 203 NLARKNGFAIAIGHPHPSTVRALQQQLPLLPA-DIQLVAPSGLL-TPSPDS 251


>gi|228996531|ref|ZP_04156170.1| hypothetical protein bmyco0003_11180 [Bacillus mycoides Rock3-17]
 gi|229004182|ref|ZP_04161983.1| hypothetical protein bmyco0002_11470 [Bacillus mycoides Rock1-4]
 gi|228757043|gb|EEM06287.1| hypothetical protein bmyco0002_11470 [Bacillus mycoides Rock1-4]
 gi|228763163|gb|EEM12071.1| hypothetical protein bmyco0003_11180 [Bacillus mycoides Rock3-17]
          Length = 255

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 97/237 (40%), Gaps = 5/237 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
            F + A   ++AIV+   G +  GT+R +  LP  +T+A      S  +    A +KG E
Sbjct: 18  PFQTYAHTNKVAIVIDDFGNNMKGTER-MLSLPIPLTVAVMPFLPSTKQDAVAAHQKGHE 76

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+             +    +  ++ +R+  +++      G+ N+ G+ + +++
Sbjct: 77  VIIHMPMEPIKGKKEWLGPKAITTDLSDHEIESRVEQAIQEVPHAIGMNNHMGSKVTADE 136

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ +
Sbjct: 137 RIMRIILSVCKKHGLFYLDSKTNPNSIVPKIGKELGVPIVENQLFFDDVYTSSHITKQAQ 196

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            L +  +     + +         +  VI   + +        + LS L     P S
Sbjct: 197 LLLQKIKEKPVVVAIGHVGPPGEITSRVIESTIPKVREHA-DFIFLSDLVLSPPPVS 252


>gi|78356483|ref|YP_387932.1| hypothetical protein Dde_1438 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78218888|gb|ABB38237.1| conserved hypothetical protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 488

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 55/288 (19%), Positives = 106/288 (36%), Gaps = 8/288 (2%)

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
            +  +   +  V+   R TS    P  E +   G     +  + + G   T++   + + 
Sbjct: 205 AVLQEQEPQLPVDGQHRGTSEAGTPLPEAQDDAGSPDAAVTGRPESGAAATQIQERENDL 264

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                  R+AIV+  +G S    +R +  L   +TL+         R      + G E +
Sbjct: 265 ------PRLAIVIDDIGESMRAVER-LVALEYPVTLSIWPRATYARRAADYGWQHGCEIM 317

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +  PM+             L V+ T  Q+   L  +L       G+ N+ G+    +   
Sbjct: 318 IHQPMEPVGYPRVNPGPGALFVSMTPDQIHTVLGENLGMVPHAVGINNHMGSRFTQDDAG 377

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + +  E   R L   D  +   ++    A    L      ++LD   D+  I  +L   
Sbjct: 378 VQAVVDELRGRKLFVLDSVTHGGSVLYRKAAAAGLHAFRRSVFLDVVRDKKSIMHQLDKA 437

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             +A   G AI +     E++  + +W Q+   R + +V ++ L K+ 
Sbjct: 438 AGVALRQGTAIAIGHPTPETLAALEEW-QRVRSRKIQIVSVAGLDKVR 484


>gi|311277460|ref|YP_003939691.1| hypothetical protein Entcl_0129 [Enterobacter cloacae SCF1]
 gi|308746655|gb|ADO46407.1| protein of unknown function DUF610 YibQ [Enterobacter cloacae SCF1]
          Length = 313

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 97/228 (42%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A   ++AIV+  +G  +   +  +  LP NI++A   N         +A   G+E +
Sbjct: 18  SAPAWAGKLAIVIDDVGY-RPQQENQVLALPVNISVAVLPNAPHAREMATKAHNGGREVL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++ +     G+ N+ G+ + SN   
Sbjct: 77  IHMPMAPLSKQPLE--KDTLRPDMSSDEIERIIRDAVSKVPYAVGMNNHMGSAMTSNLFG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +  ++  L F D  +   +     A    +  +   ++LDD  +   IR +    
Sbjct: 135 MQKVMQALSRYNLYFLDSMTIGNSQATRAAAGTGVKVIKRKVFLDDTQNEADIRFQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++AR TG AI +      ++ V+ Q +      D+++V  S L    
Sbjct: 195 IQLARRTGSAIAIGHPHPSTVRVLQQMVYNLPP-DITLVRPSSLLNEP 241


>gi|240138873|ref|YP_002963348.1| hypothetical protein MexAM1_META1p2287 [Methylobacterium extorquens
           AM1]
 gi|240008845|gb|ACS40071.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 409

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 93/390 (23%), Positives = 167/390 (42%), Gaps = 8/390 (2%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
              L  PL       +  ++   S      +    +  L+  I ++    G         
Sbjct: 14  DDILTKPLGVADKAARPRFALRPSAGAAAGVGALVVALLAGGIALTGDPRGGEPRAQALI 73

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT-VVNKPT 120
            IRE           I D   P+ +      ++++  S     +     +    V+ +  
Sbjct: 74  EIREAPA----SVPRIADAAPPAAKGPAQSASEVEQASGVSVFRPDGSTAPDAPVIIRVP 129

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
            +  +   P  + RL     +       ++G        +        +G RIA++VSGL
Sbjct: 130 NAAQVKLAPAPDARLT---ERGRHGPLPRIGEGRLRPLDVYARPDEPGTGPRIAVLVSGL 186

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+PM+ FD   ++  
Sbjct: 187 GIGEMATLGAIARLPAAVSLALSPYGTDLEKTATRAREAGHEILLQLPMEPFDYPDSDPG 246

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E + K+ + RGL F 
Sbjct: 247 PQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPVLKDLSARGLGFV 306

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDG++P      +A K  LP   A++ +D     D I  +L  LE +AR  G  +  + A
Sbjct: 307 DDGAAPGTQVATVAAKTKLPSARAEIVIDAVARPDAIDAELARLETLARQKGLVLASSSA 366

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +IE +S+W +    R + +VP+S + +
Sbjct: 367 SPLTIERLSRWSRDLEARGIRLVPVSAILR 396


>gi|13473411|ref|NP_104978.1| hypothetical protein mll3999 [Mesorhizobium loti MAFF303099]
 gi|14024160|dbj|BAB50764.1| mll3999 [Mesorhizobium loti MAFF303099]
          Length = 247

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 100/243 (41%), Positives = 144/243 (59%), Gaps = 3/243 (1%)

Query: 147 KNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNG 206
           ++  GR       +     S A GAR+AIV+ GL +SQTGTQ AI  LPA +TLAFA  G
Sbjct: 2   RSADGRRPF---DVYARPWSGARGARVAIVIGGLAVSQTGTQAAIAKLPAEVTLAFAPQG 58

Query: 207 NSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTG 266
           NS+ RWM+ A++ G E ++Q+P++ FD         TL V  + ++ L  L ++L R T 
Sbjct: 59  NSIGRWMQAARQGGHEIVMQVPLEPFDYPNVNPGRNTLTVAGSAEENLKNLHWALSRTTN 118

Query: 267 YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADL 326
           Y GVMNY GA   ++K + E    E  KRGL + DDGSS R+L   LA K  +P++  D 
Sbjct: 119 YTGVMNYMGARFSADKAAMEPFMAELGKRGLAYIDDGSSARSLAPDLALKDGVPFVAGDT 178

Query: 327 YLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
            +D   DR  I +KL GLE  AR  G A+G+  AFD +++++S W+ +   R + +VP+S
Sbjct: 179 AIDAVQDRGAILKKLDGLEATARAKGTAVGIGSAFDLTVDIVSSWIAEAKKRGIEIVPIS 238

Query: 387 CLA 389
            +A
Sbjct: 239 AVA 241


>gi|254561481|ref|YP_003068576.1| hypothetical protein METDI3068 [Methylobacterium extorquens DM4]
 gi|254268759|emb|CAX24720.1| conserved hypothetical protein [Methylobacterium extorquens DM4]
          Length = 409

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 93/390 (23%), Positives = 168/390 (43%), Gaps = 8/390 (2%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
              L  PL       +  ++   S      +    +  L+  I ++    G         
Sbjct: 14  DDILTKPLGVADKAARPRFALRPSAGAAAGVGALVVALLAGGIALTGDPRGGEPRAQALI 73

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT-VVNKPT 120
            IRE           I +   P+ +      ++++  S     +     +    V+ +  
Sbjct: 74  EIREAPA----SVPRIAEAAPPAAKGPAQSASEVEQASGVSVFRPDGSTAPDAPVIIRVP 129

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
            +T +   P  + RL     +       ++G        +        +G RIA++VSGL
Sbjct: 130 NATQVKLAPAPDARLT---ERGRHGPLPRIGEGRLRPLDVYARPDEPGTGPRIAVLVSGL 186

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+PM+ FD   ++  
Sbjct: 187 GIGEMATLGAIARLPAAVSLALSPYGTDLEKTAARAREAGHEILLQLPMEPFDYPDSDPG 246

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E + K+ + RGL F 
Sbjct: 247 PQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPVLKDLSARGLGFV 306

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDG++P      +A K  LP   A++ +D     D I  +L  LE +AR  G  +  + A
Sbjct: 307 DDGAAPGTQVATVAAKSKLPSARAEIVIDAVARPDAIDAELARLETLARQKGLVLASSSA 366

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +IE +S+W +    R + +VP+S + +
Sbjct: 367 SPLTIERLSRWSRDLEARGIRLVPVSAILR 396


>gi|226326856|ref|ZP_03802374.1| hypothetical protein PROPEN_00716 [Proteus penneri ATCC 35198]
 gi|225204693|gb|EEG87047.1| hypothetical protein PROPEN_00716 [Proteus penneri ATCC 35198]
          Length = 300

 Score =  243 bits (619), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 45/229 (19%), Positives = 94/229 (41%), Gaps = 4/229 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            +    A++AIV+   G  +      I  LP  +++A   +          A  +G+E +
Sbjct: 8   STPVFAAKLAIVIDDFGY-RKKEDNQILQLPTAVSIAILPDSPHGKEIATRAHAQGREIL 66

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TLK +    ++   +++++       G+ N+ G+ + S++++
Sbjct: 67  IHMPMAPISKQPLE--RDTLKPSMDQAEINRIIQHAINNVPYAVGMNNHMGSAMTSDRQA 124

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + K      L F D  +         A    +P +   ++LD+     + R++L   
Sbjct: 125 MDRVIKALNHSNLYFLDSVTIGNTQAATAAKAAGVPSLRRHVFLDNVQTEAETRQQLNRA 184

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             +AR  G AI +      ++  + Q L      D+ +V  S L K  S
Sbjct: 185 IALARKNGSAIAIGHPHPSTVRALQQQLPLLPA-DIQLVAPSTLLKPQS 232


>gi|311030007|ref|ZP_07708097.1| divergent polysaccharide deacetylase [Bacillus sp. m3-13]
          Length = 257

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 44/234 (18%), Positives = 104/234 (44%), Gaps = 5/234 (2%)

Query: 159 AMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
              K+     S  ++AIV+   G +  GT+  I  LP  +T+A     ++ ++  + A +
Sbjct: 18  PSVKSSAEVHSSNKVAIVIDDFGNNMKGTEE-ILHLPVPLTVAVMPFLSTTEQDAEMAHR 76

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
            G E IL +PM+      +      +    T +++  R+  ++       G+ N+ G+ +
Sbjct: 77  LGHEVILHLPMEPLKGKSSWLGPGAITSNLTDKEIYKRVNDAIDSVPYAVGINNHMGSKI 136

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIR 338
            ++K    +I     +R L + D  ++ +++   LA +L +P++  +L+ D+    + I 
Sbjct: 137 TADKRIMRIILGICKERNLYYLDSKTTKKSVVAELATELGVPFLENELFFDEVYSTNHIV 196

Query: 339 EKLKGLEEIARTTGQAIGVAV---AFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           ++   L +        I +       +++  V+ Q++ +   +   +V LS + 
Sbjct: 197 KQTNHLIKKTEVDDSIIAIGHVGVVGEKTAGVLKQYIPKLQEKA-EIVTLSNIL 249


>gi|293393596|ref|ZP_06637906.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291423931|gb|EFE97150.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 316

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 43/221 (19%), Positives = 92/221 (41%), Gaps = 4/221 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+  +G  +   + A+  +P  I++A   N          A  +G+E ++ +PM  
Sbjct: 25  KLSIVIDDVGY-RPHEENAVLQMPLAISVAVLPNAPHAHLMATRAHSQGREVLIHMPMAP 83

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E    TL+ + +  ++   +R ++       G+ N+ G+ + S+  + + + + 
Sbjct: 84  LSKQPLE--RDTLQPSMSSDEVQRIIRNAVNNVPYAVGMNNHMGSAMTSSLPAMQKVMQA 141

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
                L F D  +   +     A    +  +   ++LDD      IR +     E+AR  
Sbjct: 142 LESYNLYFLDSMTIGNSQATRAAAGTGVKVIKRRVFLDDTASEADIRHQFNRAVELARRN 201

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           G AI +      +++V+ Q L      D+ +V  S L    
Sbjct: 202 GSAIAIGHPRPATVKVLRQMLATLPS-DIVLVRPSSLLNAP 241


>gi|113461585|ref|YP_719654.1| hypothetical protein HS_1442 [Haemophilus somnus 129PT]
 gi|112823628|gb|ABI25717.1| conserved hypothetical protein [Haemophilus somnus 129PT]
          Length = 270

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 101/219 (46%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G         I  LP  +++A   +     +  ++AK++ ++ ++ +PMQ 
Sbjct: 17  KLAIVIDDIGYRLKE-DNQIYSLPKEVSVAIIPSAPHAKQRDQQAKQQDRDILIHLPMQP 75

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            +    ED    +K+  +  ++ +R+R +        G+ N+ G+   ++K+    +   
Sbjct: 76  LNLQKIEDG--GIKLGMSQPEVYHRVRNAKSILPNAIGMNNHMGSAATADKDLMNKLMTA 133

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  R++   +A +  +P +   ++LDD      ++ +     + AR  
Sbjct: 134 LLQQDLFFLDSRTIGRSVAGKIAREFGIPTLERHIFLDDSDKLSDVQRQWNAAIQYARKR 193

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   ++Q   +D+ +V +  L +
Sbjct: 194 GTAIVIGHPRKNTIAVLQMGIKQLP-KDIQLVGIGSLWR 231


>gi|260599915|ref|YP_003212486.1| hypothetical protein CTU_41230 [Cronobacter turicensis z3032]
 gi|260219092|emb|CBA34447.1| Uncharacterized protein yibQ [Cronobacter turicensis z3032]
          Length = 286

 Score =  243 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 41/217 (18%), Positives = 87/217 (40%), Gaps = 4/217 (1%)

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           V+   G   + T+  +  +PA +++A   N         +A  +G + ++ +PM    + 
Sbjct: 2   VIDDFGYRPS-TENQVLAMPAEVSVAVLPNAPHAREMATKAHNQGHDVLIHLPMAPLSKQ 60

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
             E    TL+   + +++   +R ++       G+ N+ G+ + S+    + +    A  
Sbjct: 61  PLE--KDTLRPDMSSEEIARIIREAVNDVPYAIGMNNHMGSAMTSSLPGMQKVMAALAHY 118

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAI 355
            L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G AI
Sbjct: 119 NLFFLDSMTIGNSQAMRAAAGTGVKVIKRKVFLDDIQNEADIRYQFNRAVALARRNGSAI 178

Query: 356 GVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            +      ++ V+ Q L      D+++V  S L    
Sbjct: 179 AIGHPHPSTVRVLQQMLYSLPA-DITLVRASSLLNEP 214


>gi|254292534|ref|YP_003058557.1| hypothetical protein Hbal_0158 [Hirschia baltica ATCC 49814]
 gi|254041065|gb|ACT57860.1| protein of unknown function DUF610 YibQ [Hirschia baltica ATCC
           49814]
          Length = 416

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 87/387 (22%), Positives = 157/387 (40%), Gaps = 22/387 (5%)

Query: 27  LGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPL--------------T 72
              F      +   + ++ ++               +   AP P+               
Sbjct: 20  AAGFAAIAVVVGLSAGFVQLTGNEDAGSPHASVGLFVDRNAPAPVLKTRLADQPLIHDIP 79

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
              ++E         +  V +      S  +    +  SG+ V              + E
Sbjct: 80  TEHHVETASHEDTEPSLPVSDPTHQAPSYAEYAETD--SGEDVRITRLSQAEKIQPVSEE 137

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSGLGISQTG 186
            + ++    + L     VGR         +     A         ++A++V GLGI ++ 
Sbjct: 138 RKALVRAPIQGLYENGAVGRLPKIADDGRRPADIYARPHTPNGKPQVALIVGGLGIKRSL 197

Query: 187 TQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKV 246
           T +AIN LP  +TL+F    + L  W+  A+  G E +L++PM+ +D    +    TL  
Sbjct: 198 TMQAINDLPPEVTLSFVPYSSDLQTWVNRARDAGHEVLLEVPMEPYDYPNVDTGPDTLLT 257

Query: 247 TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
           T + Q+   RL+  L + TGYFGV+NY+GA L +       I +E   RGL    DG++ 
Sbjct: 258 TLSAQENERRLKVILGQTTGYFGVINYQGARLATESRVLSPIMREIHNRGLAMIYDGAAN 317

Query: 307 RNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIE 366
           R++   +A ++N+ ++ AD  +D     D I + L  +E +A     A+GV  AF  +++
Sbjct: 318 RSVFPSVAKEINMNFVEADRIVDTVPSADAIDKNLLHIEALALQNKAALGVGFAFPVTVD 377

Query: 367 VISQWLQQEHVRDVSVVPLSCLAKLSS 393
              QW     ++   +VP S L  + +
Sbjct: 378 QFKQWSDTLDMKGYELVPASVLTGIQT 404


>gi|300714671|ref|YP_003739474.1| conserved uncharacterized protein YigQ [Erwinia billingiae Eb661]
 gi|299060507|emb|CAX57614.1| conserved uncharacterized protein YigQ [Erwinia billingiae Eb661]
          Length = 302

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 41/231 (17%), Positives = 93/231 (40%), Gaps = 4/231 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
              A   +++IV+   G  +   +  +  +P NI++A   N         +A + G E +
Sbjct: 11  ACTAHAGKLSIVIDDFGY-RPKEENQVLQMPKNISVAVLPNATHAREMATKAHQLGHEVL 69

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+   
Sbjct: 70  IHLPMAPLSKQPLE--KDTLRPDMSSSEIARIIREAVADVPFAVGLNNHMGSAMTSSLPG 127

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +        F D  +   + +   A   ++  +   ++LDD  +   IR++    
Sbjct: 128 MQKVMQVLDHYNFYFLDSMTIGNSQSTRAAAGTSVKVLKRRVFLDDTQNEADIRKQFTRA 187

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             +A+  G AI +      ++ V+ + L      DV++V  S L      +
Sbjct: 188 VRLAQRDGSAIAIGHPHPTTVRVLQEMLPTLPA-DVTLVRPSQLLNEPQST 237


>gi|197117641|ref|YP_002138068.1| divergent polysaccharide deacetylase domain-containing protein
           [Geobacter bemidjiensis Bem]
 gi|197087001|gb|ACH38272.1| divergent polysaccharide deacetylase domain protein [Geobacter
           bemidjiensis Bem]
          Length = 317

 Score =  242 bits (618), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 50/279 (17%), Positives = 102/279 (36%), Gaps = 2/279 (0%)

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
           +        P     +++       L L    K +       +     P +     ++  
Sbjct: 39  LEKSRKEPAPAAPAKVEAPAVTSPHLPLPEHAKPVQQNLSTAQAPAPKPHVAVVPRAHGP 98

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           G R+AI++  +G S    Q  +  +   IT +   +     +    A   G E ++ +PM
Sbjct: 99  G-RVAIIIDDMGSSMQELQ-TLQSIGLPITYSIIPSLPRARQVADSAHAAGAEVMVHMPM 156

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +       + +S  L VT    ++  R+     R     G  N+ G+    + +  E   
Sbjct: 157 EPEGYPKQKMESIGLLVTMDDAEIAKRVSDYFSRVPHAVGANNHMGSRFTQHADKMEAAL 216

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
               ++G+ F D  +SP ++    A  L +      ++LD+  D   I ++L     +AR
Sbjct: 217 GVLKEKGVFFIDSRTSPASVGYQTARALGIKAGTRQVFLDNVQDEGAIGKQLLEAAAVAR 276

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             G AI +      ++  +  +L +     ++ V  S L
Sbjct: 277 KRGGAIAICHPHPATLRALKAYLPELAKTGITFVYASAL 315


>gi|271498745|ref|YP_003331770.1| hypothetical protein Dd586_0167 [Dickeya dadantii Ech586]
 gi|270342300|gb|ACZ75065.1| protein of unknown function DUF610 YibQ [Dickeya dadantii Ech586]
          Length = 309

 Score =  242 bits (617), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 44/225 (19%), Positives = 95/225 (42%), Gaps = 4/225 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++A+V+   G  +   +  +  +P  I++A   N         +A  +G+E ++ +PM
Sbjct: 22  AGKLALVIDDFGY-RPHNENQVLAMPTAISVAVLPNAPYAREMATKAHAQGREVLIHLPM 80

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E    TL+   + +++   LR ++ +     G+ N+ G+ + ++    + + 
Sbjct: 81  APMSKQPLE--RDTLRPDMSSEEIARILRDAVNKVPYAVGLNNHMGSAMTASLPGMQKVM 138

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  +   L F D  +   +     A    +  +   ++LDD  +   IR +     EIA+
Sbjct: 139 QAMSAYHLYFLDSMTIGSSQASQAAAGTGIKVLKRKVFLDDTQNVADIRRQFSRAVEIAQ 198

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
            +G AI +      +I+V+ Q L      D+ +V  S L     P
Sbjct: 199 RSGYAIAIGHPHPTTIQVLQQMLPTLPA-DIVLVRPSQLLNEPEP 242


>gi|218530515|ref|YP_002421331.1| hypothetical protein Mchl_2561 [Methylobacterium chloromethanicum
           CM4]
 gi|218522818|gb|ACK83403.1| protein of unknown function DUF610 YibQ [Methylobacterium
           chloromethanicum CM4]
          Length = 401

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 92/390 (23%), Positives = 167/390 (42%), Gaps = 8/390 (2%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
              L  PL          ++   S      +    +  L+  I ++    G         
Sbjct: 6   DDILTKPLGVADKAAHPRFALRPSAGAAAGVGALVVALLAGGIALTGDPRGGEPRAQALI 65

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT-VVNKPT 120
            IRE           I +   P+ +      ++++  S     +     +    V+ +  
Sbjct: 66  EIREAPA----SVPRIAEAAPPAAKGPAQSASEVEQASGVSVFRPDGSTAPDAPVIIRVP 121

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
            +  +   P  + RL     +       ++G        +        +G RIA++VSGL
Sbjct: 122 NAAQVKLAPAPDARLT---ERGRHGPLPRIGEGRLRPLDVYARPDEPGTGPRIAVLVSGL 178

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+PM+ FD   ++  
Sbjct: 179 GIGEMATLGAIARLPAAVSLALSPYGTDLEKTAARAREAGHEILLQLPMEPFDYPDSDPG 238

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E + K+ + RGL F 
Sbjct: 239 PQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPVLKDLSARGLGFV 298

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDG++P      +A K  LP + A++ +D     D I  +L  LE +AR  G  +  + A
Sbjct: 299 DDGAAPGTQVATVAAKTKLPSVRAEIVIDAVARPDAIDAELARLETLARQKGLVLASSSA 358

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +IE +S+W +    R + +VP+S + +
Sbjct: 359 SPLTIERLSRWSRDLEARGIRLVPVSAILR 388


>gi|242237635|ref|YP_002985816.1| hypothetical protein Dd703_0176 [Dickeya dadantii Ech703]
 gi|242129692|gb|ACS83994.1| protein of unknown function DUF610 YibQ [Dickeya dadantii Ech703]
          Length = 319

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 93/226 (41%), Gaps = 4/226 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             ++++V+   G  +   +  +  +P  I++A   N         +A  +G+E ++ +PM
Sbjct: 23  AGKLSLVIDDFGY-RPHNENQVLAMPVAISVAVLPNAPYARDMATKAHAQGREVLIHLPM 81

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
               +   E    TL+   + +++   LR ++ +     G+ N+ G+ + ++    + + 
Sbjct: 82  APMSKQPLE--RDTLRPDMSSEEIARILRDAVGKVPYAVGLNNHMGSAMTASLPGMQKVM 139

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +      L F D  +   +     A    +  +   ++LDD  +   IR +     E+AR
Sbjct: 140 QAMTTYRLYFLDSMTIGSSQASRAAAGTGIRVLKRKVFLDDTQNTADIRRQFNRAVELAR 199

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             G AI +      +I+V+ Q L      D+ +V  S L      +
Sbjct: 200 RDGVAIAIGHPHPTTIQVLQQMLPTLPP-DIELVRPSQLLNEPESA 244


>gi|159795367|pdb|2QV5|A Chain A, Crystal Structure Of Uncharacterized Protein Atu2773 From
           Agrobacterium Tumefaciens C58
 gi|159795368|pdb|2QV5|B Chain B, Crystal Structure Of Uncharacterized Protein Atu2773 From
           Agrobacterium Tumefaciens C58
          Length = 261

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 104/247 (42%), Positives = 145/247 (58%)

Query: 143 ELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAF 202
            L     VG +            S A G R+AIVV GLG+SQTG+Q+AI  LP  +TL F
Sbjct: 2   SLGQLPVVGADGLRPMEQYARPWSGARGTRVAIVVGGLGLSQTGSQKAIRDLPPEVTLGF 61

Query: 203 ASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLR 262
           A++GNSL RWM++A+++G E +LQIP++ F          TL      +  ++RL  S+ 
Sbjct: 62  AASGNSLQRWMQDARREGHEILLQIPLEPFGYPGTNPGPDTLLAGDPAKVNIDRLHRSMA 121

Query: 263 RGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYM 322
           + T Y GVMNY G   L+ + + E + ++  KRGLLF DDGSS ++L+  +A  ++ P  
Sbjct: 122 KITNYTGVMNYLGGRFLAEQSALEPVMRDIGKRGLLFLDDGSSAQSLSGGIAKAISAPQG 181

Query: 323 VADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
            AD+ LD +V    I  KL  LE IAR  GQAIGVA AFDESI  IS+W ++   R + +
Sbjct: 182 FADVLLDGEVTEASILRKLDDLERIARRNGQAIGVASAFDESIAAISKWSREAGGRGIEI 241

Query: 383 VPLSCLA 389
           V +S L 
Sbjct: 242 VGVSALV 248


>gi|163795616|ref|ZP_02189582.1| hypothetical protein BAL199_26487 [alpha proteobacterium BAL199]
 gi|159179215|gb|EDP63748.1| hypothetical protein BAL199_26487 [alpha proteobacterium BAL199]
          Length = 264

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 66/255 (25%), Positives = 121/255 (47%), Gaps = 3/255 (1%)

Query: 142 KELLAKNKVGREDTEVPAMDKNFCSNASG-ARIAIVVSGLGISQTGTQRAINLLPANITL 200
              L +                    A+G   IAIV+  LGI +  + RAI  LPA +TL
Sbjct: 4   PPELQRAPPPDGIVPAWRRFAAVAEPANGRPMIAIVLDDLGIDKRRSGRAI-DLPAPLTL 62

Query: 201 AFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYS 260
           AF +  N L      A+ +G E ++ +PMQ       +     L +   ++++  R+ +S
Sbjct: 63  AFLAYANELPEQTGRARSRGHELLVHLPMQP-HGHDADPGPNVLDMELGLEEVARRVDWS 121

Query: 261 LRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLP 320
           L++  G+ GV N+ G++   N +   ++ +     GLLF D  ++P+++   +A  L +P
Sbjct: 122 LKQFDGFVGVNNHMGSLFTENADGMRIVAEAMRNNGLLFLDSVTTPKSVGEQVARSLGVP 181

Query: 321 YMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDV 380
               D++LD+     ++  +L   E +ARTTG AI +    D ++ V+  W+ +      
Sbjct: 182 ATKRDVFLDNTDTAAEVELRLAQTERLARTTGTAIAIGHPRDATLNVLEAWIPKAKADGF 241

Query: 381 SVVPLSCLAKLSSPS 395
            +VPL+ + +  + S
Sbjct: 242 VLVPLTAVLQARTGS 256


>gi|163851709|ref|YP_001639752.1| protein of unknown function DUF610 YibQ [Methylobacterium
           extorquens PA1]
 gi|163663314|gb|ABY30681.1| protein of unknown function DUF610 YibQ [Methylobacterium
           extorquens PA1]
          Length = 418

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 93/390 (23%), Positives = 166/390 (42%), Gaps = 8/390 (2%)

Query: 2   SIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYS 61
              L  PL       +   +   S      +    +  L+  I ++    G         
Sbjct: 23  DDILTKPLGVADKATRPRLALRPSAGAAAGVGALVVALLAGGIALTGDPRGGEPRAQALI 82

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT-VVNKPT 120
            IRE           I D   P+ +      ++++  S     +     +    V+ +  
Sbjct: 83  EIREAPA----SVPRIADAAPPAAKGPAQSASEVEQASGVSVFRPDGSTAPDAPVIIRVP 138

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGL 180
            +  +   P  + RL     +       ++G        +        +G RIA++VSGL
Sbjct: 139 NAAQVKLAPAPDARLT---ERGRHGPLPRIGEGRLRPLDVYARPDEPGTGPRIAVLVSGL 195

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           GI +  T  AI  LPA ++LA +  G  L++    A++ G E +LQ+PM+ FD   ++  
Sbjct: 196 GIGEMATLGAIARLPAAVSLALSPYGTDLEKTATRAREAGHEILLQLPMEPFDYPDSDPG 255

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
             TL  +    + L+R  +++ R  G+ G +N+ GA L+S   + E + K+ + RGL F 
Sbjct: 256 PQTLLASARPGENLDRAAWAMSRFPGFVGAVNFMGAKLMSEAGALEPVLKDLSARGLGFV 315

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           DDG++P      +A K  LP   A++ +D     D I  +L  LE +AR  G  +  + A
Sbjct: 316 DDGAAPGTQVATVAAKTKLPSARAEIVIDAVARPDAIDAELARLETLARQKGLVLASSSA 375

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              +IE +S+W +    R + +VP+S + +
Sbjct: 376 SPLTIERLSRWSRDLEARGIRLVPVSAILR 405


>gi|329296461|ref|ZP_08253797.1| hypothetical protein Pstas_07378 [Plautia stali symbiont]
          Length = 301

 Score =  241 bits (615), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 90/226 (39%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   ++AIV+   G      +  +  +PA I++A   N         +A + G E ++ 
Sbjct: 19  AAHAGKLAIVIDDFGY-HPAEENKVLQMPAAISVAVLPNAPHARDMATKAHQGGHEVLIH 77

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL    + +++   +R +  +     G+ N+ G+ + S+    +
Sbjct: 78  LPMAPLSKQPLE--KDTLTPKMSSEEIARIVRDASNKVPYAVGLNNHMGSKMTSSLPGMQ 135

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +        F D  +   + +   A    +  +   ++LDD  +   IR +     +
Sbjct: 136 KVMQVLNHYNYYFLDSMTIGNSQSVPAAQGTQVKVLKRRVFLDDSQNESAIRTQFTRAVK 195

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +A+  G AI +      ++ V+ Q L      D+++V  S L    
Sbjct: 196 LAQRDGYAISIGHPHPTTVRVLQQMLPTLPG-DITLVRPSQLLNEP 240


>gi|90414915|ref|ZP_01222879.1| hypothetical protein P3TCK_22160 [Photobacterium profundum 3TCK]
 gi|90323971|gb|EAS40567.1| hypothetical protein P3TCK_22160 [Photobacterium profundum 3TCK]
          Length = 241

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 48/220 (21%), Positives = 102/220 (46%), Gaps = 4/220 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
             A++AI++  LG         ++ LP  +T++   N         +AKK+ +E +L +P
Sbjct: 22  HAAQLAIIIDDLGY--QAMPELLSKLPPEVTISILPNTPYDLTVAAQAKKQHRETLLHMP 79

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M+    +  E    TL  T + Q L + LR +L R      + N+ G+ L  N ++   I
Sbjct: 80  MEPEHLAPLEV--NTLTSTMSQQTLQHTLRQALTRVPDAIAINNHMGSALSQNIQAMGWI 137

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
             E  +  L + D  ++ +++ +  A   ++  +   ++LD    ++ + ++L    + A
Sbjct: 138 MAELKQHNLYYLDSRTTAKSIAQQQATSHSVLSLRRHVFLDHYQTKEFVTKQLTSAIKRA 197

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +T G AI +      ++  +++ L      ++++V LS L
Sbjct: 198 KTYGYAIAIGHPHPITLSTLNELLPNLTEEEITLVRLSTL 237


>gi|87120387|ref|ZP_01076282.1| hypothetical protein MED121_09348 [Marinomonas sp. MED121]
 gi|86164490|gb|EAQ65760.1| hypothetical protein MED121_09348 [Marinomonas sp. MED121]
          Length = 433

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 57/341 (16%), Positives = 125/341 (36%), Gaps = 11/341 (3%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
              E++  S +            ++   Q+      + V ++LK        Q++     
Sbjct: 91  AGPELVVDSEVNLPLDEADVETSDLIKVQTAEGAKTSEVNDELKLGPLLTAPQVKTSNDS 150

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKEL--------LAKNKVGREDTEVPAMDKNF 164
                      S     +++          E           K  +  ++       +  
Sbjct: 151 SLSGFPALNMPSEQEAMSLDLLWQKTFPTNEKSTQDVLIDTPKTPIVVDEAVNEIAAQEL 210

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
             N     I I++  LG ++ G + +   LP  + LA   +     +  + A ++ +  +
Sbjct: 211 VENDDRPSITIIIDDLGYNRRGMEES-LDLPVEVALAILPHTPFSKKTARAATEQARTIL 269

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM+  +E   +     L       +L   L+  +    G  G+ N+ G++L  + ES
Sbjct: 270 LHVPME--NERELKLGPGGLYKKMDEAELKKTLQEGIESVPGITGINNHMGSLLTQDVES 327

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +      L F D  +SP ++    A   +L     D++LD+  +   I ++ K L
Sbjct: 328 MQWVMEVIQPLELFFVDSLTSPNSVALSKALSFDLTTTRRDVFLDNIQEEKAIDKQFKRL 387

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
             IAR  G+A+ +   +  ++  +++ L Q     V ++ L
Sbjct: 388 LAIARKRGKALAIGHPYPATMNYLAKHLSQLEDEGVQLISL 428


>gi|330807031|ref|YP_004351493.1| hypothetical protein PSEBR_a348 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375139|gb|AEA66489.1| Conserved hypothetical protein; putative exported protein
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 260

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 41/221 (18%), Positives = 95/221 (42%), Gaps = 7/221 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +++++  LG +     R +  LP  +T A   +      + +EA + G+  +L +PM   
Sbjct: 33  LSLIIDDLGQNLPR-DRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKLVMLHMPMDPA 91

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
                    +       +++L  RL  +        G+ N+ G+ + +  ++   +    
Sbjct: 92  T------GPFAWHPELPIEELGKRLDAAFAAVPYTSGINNHMGSRMTAQPQAMAWLMANL 145

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +R   F D  +S + +    A K+ L  +  D++LDD+     I  +L+   ++AR  G
Sbjct: 146 QQRHKFFVDSRTSAQTVAAAEAQKIGLASVSRDVFLDDERTEAAIARQLQTAIDLARQQG 205

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            A+ +   + +++ V+ + L +   + V  + +  +  L S
Sbjct: 206 SAVMIGHPYPQTLAVLERELPKLKAQGVEWIDIKSMISLRS 246


>gi|70733871|ref|YP_257511.1| polysaccharide deacetylase family protein [Pseudomonas fluorescens
           Pf-5]
 gi|68348170|gb|AAY95776.1| polysaccharide deacetylase family protein [Pseudomonas fluorescens
           Pf-5]
          Length = 268

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 43/230 (18%), Positives = 101/230 (43%), Gaps = 7/230 (3%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             + A  A +++++  LG +     R +  LP  +T A   +      + +EA + G+  
Sbjct: 32  PTAAAPKAYLSLIIDDLGQNLPR-DRRVLALPGPVTTAIMPDTPHAAEFAREAHRAGKIV 90

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           IL +PM            +       +++L  RL  + +      G+ N+ G+ + +  +
Sbjct: 91  ILHMPMDPAT------GPFAWHPELPIEELQKRLEAAFQAVPYTSGINNHMGSRMTAQPQ 144

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   +  +  +R   F D  +S + +    A K+ L  +  D++LDD+     I ++L+ 
Sbjct: 145 AMAWLMADLQRRHKFFVDSRTSAQTVAAAEAQKIGLASVSRDVFLDDERTEAAISQQLQT 204

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             ++AR  G A+ +   + +++ V+ + L +   + +  + +  +  L S
Sbjct: 205 AIKLARKQGSAVMIGHPYPQTLAVLERELPRLKAQGIEWIDIKSMISLRS 254


>gi|104779656|ref|YP_606154.1| hypothetical protein PSEEN0377 [Pseudomonas entomophila L48]
 gi|95108643|emb|CAK13337.1| conserved hypothetical protein; putative signal peptide
           [Pseudomonas entomophila L48]
          Length = 254

 Score =  240 bits (613), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 48/225 (21%), Positives = 101/225 (44%), Gaps = 7/225 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            +    A ++I++  LG S     R    LP  +T+A   +      + ++A K G+  I
Sbjct: 17  QAAPGKAYMSIIIDDLGQSDERDSRT-LALPGPVTMAIMPDTPHATDFARQAHKAGRTVI 75

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       +++L  RL  +L +     G+ N+ G+ + + +E 
Sbjct: 76  LHMPMDPAT------GPYAWHPGTAIEELARRLDAALAKVPYAAGINNHMGSRMTAQREP 129

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S   +    A  + L ++  D++LDD    + I  +L+  
Sbjct: 130 MHWLMAELQRRHLFFVDSRTSAATVAAAEAQAVGLAHVSRDVFLDDVRTVEAINGQLQQG 189

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            ++AR  G A+ +   + ++++V+S+ + +   + + +V L  + 
Sbjct: 190 IDLARKQGSAVLIGHPYPQTLDVLSREIPKLKAQGIELVSLRQMI 234


>gi|85710828|ref|ZP_01041889.1| hypothetical protein OS145_02335 [Idiomarina baltica OS145]
 gi|85695232|gb|EAQ33169.1| hypothetical protein OS145_02335 [Idiomarina baltica OS145]
          Length = 235

 Score =  240 bits (613), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 44/206 (21%), Positives = 83/206 (40%), Gaps = 2/206 (0%)

Query: 183 SQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSY 242
                  A   LP +IT A          +  +A  +G++ +  +PMQA     N     
Sbjct: 15  GNHPEDLAAADLPGDITFAILPFTPYGRSFALKAHHQGKQIMAHVPMQALAG--NALGLG 72

Query: 243 TLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD 302
            L    +  ++  +LR  L       G+ N+ G+ L    +  + + +      L F D 
Sbjct: 73  ALTADMSSAEIKLKLRQVLDDIPYVAGINNHMGSQLTQLTQPMQAVMESLKNHDLYFIDS 132

Query: 303 GSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD 362
            ++   +   +A    +P     +++D++ D   + E+   L +IA   G AI +   + 
Sbjct: 133 RTTEYTVAEKMAQSYQVPVARRHVFIDNETDEQYLTEQFDELIQIAHAHGSAIAIGHPYP 192

Query: 363 ESIEVISQWLQQEHVRDVSVVPLSCL 388
           E+I+ + Q L+     DV +V  S L
Sbjct: 193 ETIKFLKQRLKSLKEDDVQLVFASEL 218


>gi|167854745|ref|ZP_02477524.1| hypothetical protein HPS_10725 [Haemophilus parasuis 29755]
 gi|167854159|gb|EDS25394.1| hypothetical protein HPS_10725 [Haemophilus parasuis 29755]
          Length = 281

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 45/230 (19%), Positives = 97/230 (42%), Gaps = 4/230 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F   A   ++ IV+  +G  +     AI  LP  + +A   +         +AK++G+E 
Sbjct: 21  FAPLAYANKLVIVIDDIGY-RIKEDNAIYTLPKEVNVAIIPSAPYATARANKAKEQGREI 79

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PMQ   +   E     L V     ++   +  + ++      + N+ G+   ++K 
Sbjct: 80  LIHLPMQPKVKQPIEAG--ALLVGMGESEVSELIHQAQQQVPYAIALNNHMGSKATADKT 137

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + K  +++GL F D  ++  ++    A    L  +   ++LD+      ++ + + 
Sbjct: 138 TMQHLMKALSQQGLGFLDSKTAGDSVAYQTAKAYGLNALERHIFLDNSDVFADVQRQFQH 197

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             + AR  G AI +      SI V+   +      D+ +  LS L K  +
Sbjct: 198 AVQYARKHGIAIMIGHPRKHSIAVLELGIANLPA-DIQLASLSSLWKTEN 246


>gi|229084421|ref|ZP_04216701.1| hypothetical protein bcere0022_10610 [Bacillus cereus Rock3-44]
 gi|228698961|gb|EEL51666.1| hypothetical protein bcere0022_10610 [Bacillus cereus Rock3-44]
          Length = 253

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 97/237 (40%), Gaps = 5/237 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              + A   ++AIV+   G +  GT+R +  LP  +T+A      S  +    A +KG E
Sbjct: 18  PLQTYAHTNKVAIVIDDFGNNMKGTER-MLSLPIPLTVAVMPFLPSTKQDAVAAHQKGHE 76

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            IL +PM+             +    + Q++  R+  +++      G+ N+ G+ + +++
Sbjct: 77  VILHMPMEPIKGKKEWLGPKAITTDLSDQEIEKRIEQAIQDVPHAIGMNNHMGSKVTADE 136

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K  L + D  ++P ++   +  +L +P +   L+ DD      I ++ +
Sbjct: 137 RIMRIILSVCKKHNLFYLDSKTNPNSVVPKIGKELGVPIVENQLFFDDVYTSSHITKQAQ 196

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            L +  +     + +         + +VI   + +        + LS LA    P S
Sbjct: 197 VLLQRIQEKPVVVAIGHVGPPGEITSQVIQSSIPKVREHA-DFIFLSDLALSPPPVS 252


>gi|94987564|ref|YP_595497.1| hypothetical protein LI1122 [Lawsonia intracellularis PHE/MN1-00]
 gi|94731813|emb|CAJ55176.1| uncharacterized protein conserved in bacteria [Lawsonia
           intracellularis PHE/MN1-00]
          Length = 445

 Score =  240 bits (612), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 48/233 (20%), Positives = 90/233 (38%), Gaps = 4/233 (1%)

Query: 155 TEVPAMDKNFCSN-ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
             +P  +K          RI IV+  +G S       +  L   ITL+   + +      
Sbjct: 197 IFIPTGEKFIQCPIDEKPRITIVIDDIGES-IEAANQLIKLDFPITLSILPHTHYAKSIA 255

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
                 G E ++  PM++    Y       +    + +++ N L  ++ +     G+ N+
Sbjct: 256 MLTHSTGNEVLIHQPMESIQSPYVSAGPGEIHTKMSAEEISNILCKNIEKIPYASGLNNH 315

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD-QV 332
            G+    N++    + K  A +GL   D  + P +    +A    LP      ++D    
Sbjct: 316 MGSCFTCNEKGNHTVCKILASKGLFVLDSKTHPSSSFYNIAKGKGLPAYYRTHFIDHGHH 375

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
               I  +LK  E+ A   GQAI +   + E+I  + +W+       + +VPL
Sbjct: 376 TESSILNQLKKAEKYAIEKGQAIVIGHPYPETISALKKWI-SLRDTSIHIVPL 427


>gi|253701628|ref|YP_003022817.1| hypothetical protein GM21_3030 [Geobacter sp. M21]
 gi|251776478|gb|ACT19059.1| protein of unknown function DUF610 YibQ [Geobacter sp. M21]
          Length = 316

 Score =  239 bits (611), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 49/279 (17%), Positives = 100/279 (35%), Gaps = 2/279 (0%)

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
           +        P     +++       L +    K +  K    +     P       ++  
Sbjct: 38  LEKSRKEPAPAAPAKVEAPAVTSPHLPIPEHAKPVQQKLSTAQVPAPKPHAAALPKAHGP 97

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           G R+AI++  +G S    Q  +  +   IT +   +     +    A   G E ++ +PM
Sbjct: 98  G-RVAIIIDDMGSSMQELQ-TLQSIGLPITYSIIPSLPRARQVADSAHAAGAEVMVHMPM 155

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +       + +S  L V     ++  R+     R     G  N+ G+    + +  E   
Sbjct: 156 EPEGYPKQKMESIGLLVAMDDAEIAKRVSGYFSRVPHAVGANNHMGSRFTQHGDKMEAAL 215

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
               ++G+ F D  +SP ++    A  L +      ++LD+  D   I  +L     +AR
Sbjct: 216 GVLKEKGVFFIDSRTSPASVGYRTARALGMKAGTRQVFLDNVQDEGAIGRQLFEAAAVAR 275

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             G AI +      ++  +  +L +     ++ V  S L
Sbjct: 276 KRGGAIAICHPHPATLRALKAYLPELAKTGITFVYASAL 314


>gi|118475284|ref|YP_892284.1| putative periplasmic protein [Campylobacter fetus subsp. fetus
           82-40]
 gi|118414510|gb|ABK82930.1| putative periplasmic protein [Campylobacter fetus subsp. fetus
           82-40]
          Length = 387

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 68/387 (17%), Positives = 146/387 (37%), Gaps = 19/387 (4%)

Query: 15  KRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV--IREIAPIPLT 72
            ++S      ++ G FL++    V L     + +A  G+  +    S   I++I     T
Sbjct: 2   AKRSRKKAPKTKKGAFLVYIGIAVCLLAIFGVIYAVSGSKKDPNLDSQKTIKKIERYLDT 61

Query: 73  IPLNIEDKQSPSKRDN----NTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSL 128
               I   ++ S        +   ++L            +D      V  P         
Sbjct: 62  QKNEISKDKNISFNRPNLKKDKNISELFETLKFKVDSNISDSDKNITVALPKEQIVSPLK 121

Query: 129 PTIEERLILGLSKK---ELLAKNKVGREDTEVPAMDKNFCSNA----SGARIAIVVSGLG 181
           P +++ + + + +    +L   +       E   ++K             ++ I++  L 
Sbjct: 122 PNLKKEISMFVDQNITSKLDENSSNSSLKYEQKNIEKIVKKQDIHKFEKPKLVIIIDDL- 180

Query: 182 ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDS 241
            S     R I  L   IT +     +     +K +K+     ++ +P++A     NE   
Sbjct: 181 -STMAQARDIKSLGLKITPSIFPPTDFYPDSVKISKQFEF-YMVHLPLEAIFFKKNE--Q 236

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
            TL V  T  ++ NR+    ++      + N+ G+   S+  S +++ K      +LF D
Sbjct: 237 NTLNVGDTKDKIENRISTIKKQFGNVSYINNHTGSKFTSDYSSMKMLLKSMKNHNILFVD 296

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF 361
             +S  +  + +  ++ L Y+  D+++D+      I ++L+   + A+  G AI +   +
Sbjct: 297 SLTSKGSKAKQVTKEMGLKYVFRDVFIDNDQSSVAIFKQLEIAIKKAKKNGFAIAIGHPY 356

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSCL 388
             + E I    +    +DV VV L  +
Sbjct: 357 KVTFETIKVAKKTIL-KDVEVVYLKDI 382


>gi|251797981|ref|YP_003012712.1| hypothetical protein Pjdr2_3996 [Paenibacillus sp. JDR-2]
 gi|247545607|gb|ACT02626.1| protein of unknown function DUF610 YibQ [Paenibacillus sp. JDR-2]
          Length = 275

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 43/245 (17%), Positives = 97/245 (39%), Gaps = 6/245 (2%)

Query: 154 DTEVPAMDKNFCSNASGAR-IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRW 212
                 +       A  AR  AIV+   G    GT+  +  LPA  T+A      +  + 
Sbjct: 23  PAGAGRVMAAEEEQAKSARQFAIVIDDFGNGMNGTEE-MLQLPAKFTVAIMPFMPTTKKD 81

Query: 213 MKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMN 272
            +EA + G + I+ +PM+      N      +    + +++  R+  ++       G+ N
Sbjct: 82  AEEAHRLGHDVIVHMPMEPNKGQKNWLGPGAITADLSDEEIKKRVEDAIDDVPYAVGMNN 141

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+ + +++    ++     +RGL F D  ++ + +   +  +L +P +  +++LDD  
Sbjct: 142 HMGSKITADERIMRIVLSVCKERGLFFLDSRTTFKTVVPKVTEELGVPALANNVFLDDVY 201

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAV---AFDESIEVISQWLQQEHVRD-VSVVPLSCL 388
               + +++   ++   +    I +        ++  V+   +        V  V LS L
Sbjct: 202 TEQHVSKQMTIAKKHLESHDTCIVIGHVGPPGKKTAAVLKASIPAMQSDGQVQFVKLSEL 261

Query: 389 AKLSS 393
               S
Sbjct: 262 VPSLS 266


>gi|254788252|ref|YP_003075681.1| polysaccharide deacetylase family protein [Teredinibacter turnerae
           T7901]
 gi|237685753|gb|ACR13017.1| polysaccharide deacetylase family protein [Teredinibacter turnerae
           T7901]
          Length = 275

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 51/228 (22%), Positives = 95/228 (41%), Gaps = 4/228 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A+   +AI++  LG  +      I  LP  +T A            + A   G+E ++  
Sbjct: 41  ANAPEVAIIIDDLGYKRKLGTE-ILALPWPLTAAIIPFTPYATTLAESAHVAGKEVMVHA 99

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+             L ++Q   +   R    L       G+ N+ G+ L ++ +    
Sbjct: 100 PMEPVAPR---PWEQGLAISQDETEFRERCGAMLDAVPYAVGLNNHGGSRLTASSDHMHW 156

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  E   +   F D  +S  ++   +A  + L     +++LD+  D + I  +L  LE I
Sbjct: 157 LMAELDAKRFYFIDSRTSADSIAEDIAQTMGLATASRNVFLDNTRDPEAILAQLGKLETI 216

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           AR  G AIG+   + E+++ +   L     R +++VP+S L    S +
Sbjct: 217 ARQHGYAIGIGHPYPETLQALQLGLGAMANRGITLVPVSRLLAQKSAA 264


>gi|291287716|ref|YP_003504532.1| hypothetical protein Dacet_1812 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884876|gb|ADD68576.1| protein of unknown function DUF610 YibQ [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 399

 Score =  239 bits (609), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 54/369 (14%), Positives = 118/369 (31%), Gaps = 14/369 (3%)

Query: 23  IISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQS 82
               +   +LF    + ++     +        E +    I     +             
Sbjct: 43  GGLAVLAVMLFAVAFLFMARGSSGNVDPAQGAPETV-RKQITNEQVLDAVYVSLFTYGLD 101

Query: 83  PSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKK 142
            S     T          +     Q+    +       +   +    T +E + +  S  
Sbjct: 102 KSSIKEQTEVESDGKTEIKMTIDPQDIEETELKQTLTEKLNELGLEVTGDEVVSVENSTI 161

Query: 143 ELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAF 202
           +L  +    +   +                IA V+   G S+      +   P  +T+A 
Sbjct: 162 KLDLQFSKPKAVLKPKPNS-----------IAFVIDDCGYSEEL-AEKLAAFPYPMTMAI 209

Query: 203 ASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLR 262
             +     +  + A K G+   L  PMQ       +     + +    + +   L  ++ 
Sbjct: 210 IPHTEYAKKTAEIAYKAGKVVFLHQPMQPLSYPKTDPGKGAVLLNMPEKIIQTSLNSNVA 269

Query: 263 RGTG-YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPY 321
              G   G  N+ G+ +  ++E  + +FK   K    F D  +S   +         +  
Sbjct: 270 SLGGKIDGFNNHMGSAITQDREKMKQVFKVMKKYTDTFLDSYTSRDTVAFDQCKAEGMKC 329

Query: 322 MVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVS 381
            +   ++D++ D   IR K+    EIART G  I +    + ++  + + L +      +
Sbjct: 330 AINRKFIDNESDYSYIRSKIIEGAEIARTDGSVIMIGHLRESTVHALEKILPELEKAGYN 389

Query: 382 VVPLSCLAK 390
           +VP++ L +
Sbjct: 390 IVPVTELTQ 398


>gi|118589439|ref|ZP_01546845.1| hypothetical protein SIAM614_07838 [Stappia aggregata IAM 12614]
 gi|118438139|gb|EAV44774.1| hypothetical protein SIAM614_07838 [Stappia aggregata IAM 12614]
          Length = 370

 Score =  238 bits (608), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 96/382 (25%), Positives = 172/382 (45%), Gaps = 26/382 (6%)

Query: 14  PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTI 73
            +R       +  +G+       +    ++I +    +G      P +V+   A +    
Sbjct: 3   KRRLVRLPFGLIGVGI---LSVIVTSTLVWITVVDDPLGGE----PVAVLPLDAIVEGVT 55

Query: 74  PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEE 133
             +IE  +     D +   N     S        + +  +  +         ++  T   
Sbjct: 56  SQDIEVVEIRPGIDGDLGPNLRPESSK-------DLLGPRYDMVMRPDGLGPNAPVT--- 105

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------ARIAIVVSGLGISQT 185
             +       +  ++  G       A  +   + +           +IA++V+GLG+S+T
Sbjct: 106 -SLSINPDSRVSERSDFGFLPKISDAGVRPLDAYSRPVVREFTSIPKIAVIVTGLGLSET 164

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
           GTQ AI  LPA+ T A A  G  LD WM++A+ KG E +LQ+P++ FD   N+   +TL 
Sbjct: 165 GTQNAITRLPADTTFALAPYGGDLDVWMQQARTKGHELLLQLPLEPFDFPDNDPGPHTLL 224

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
           V+    ++++RL + L R T Y GV+   GA   + K S E + ++   RGL+F D+G+S
Sbjct: 225 VSLRPNEMMDRLGFLLTRATNYVGVIPEMGARFTATKPSMEFLLEKLKARGLMFADNGTS 284

Query: 306 PRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESI 365
            R++   +A +  +P+   D+ LD+    D I  KL  LE +AR  G A+  A A   ++
Sbjct: 285 SRSIADEVAKEKRIPFSGVDVVLDEVPREDDIDAKLLQLESVARARGVAVATASALPVTV 344

Query: 366 EVISQWLQQEHVRDVSVVPLSC 387
             + +W+Q    R + +VP+S 
Sbjct: 345 RQLEKWVQDLEERGLQLVPVSA 366


>gi|303239963|ref|ZP_07326485.1| protein of unknown function DUF610 YibQ [Acetivibrio cellulolyticus
           CD2]
 gi|302592442|gb|EFL62168.1| protein of unknown function DUF610 YibQ [Acetivibrio cellulolyticus
           CD2]
          Length = 282

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 98/228 (42%), Gaps = 5/228 (2%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            S+    +IAIV+   G  + G +  +  +  ++T A            K+A +KG E I
Sbjct: 54  QSDKPAGKIAIVIDDFGQDRNGVKE-MMSINRHLTFAVMPFLTYSQSDAKDAFEKGFEVI 112

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM+      +      +  T +  ++      +L       G   + G+ + +N   
Sbjct: 113 VHLPMEPVSGKISWLGPKPILSTLSDTEVYEITSEALTNVPYAVGANIHMGSKISTNDRI 172

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +     + G+ F D  +S +++ + +A +  + +   +++LD Q  ++ ++E+L+  
Sbjct: 173 MSDVLDIIKQNGIYFLDSKTSAKSVAKKIAAEKAVAFYERNVFLDGQTSKEHVKEQLRKA 232

Query: 345 EEIARTTGQAIGVAVA----FDESIEVISQWLQQEHVRDVSVVPLSCL 388
             IA   G++I +          + + I + L +   +++ +V +S L
Sbjct: 233 GAIALKDGKSIAIGHVGIEGGKVTAQAIIEMLPEFDEKNIQLVFVSEL 280


>gi|328545770|ref|YP_004305879.1| Divergent polysaccharide deacetylase family [polymorphum gilvum
           SL003B-26A1]
 gi|326415510|gb|ADZ72573.1| Divergent polysaccharide deacetylase family [Polymorphum gilvum
           SL003B-26A1]
          Length = 375

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 88/385 (22%), Positives = 162/385 (42%), Gaps = 26/385 (6%)

Query: 14  PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTIS-EMIPYSVIREIAPIPLT 72
            ++       +   G   LF   I    ++I +     G     +IP     E       
Sbjct: 3   KRKFFRLPFGLIGAG---LFTVMITTALVWIGVVDDPFGGEPIAVIPLEKTVEGLSSRDI 59

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
             + ++ + +      +   +  +               G     +              
Sbjct: 60  AVVELKPEFADGPLGPDASRSARQGALGPRF-------EGAEAQGEAGSGEGPGVA---- 108

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG--------ARIAIVVSGLGISQ 184
              +       +  +   G          +     A           +IAIV+ G+G+S+
Sbjct: 109 ---LSTTPDSRVTERTDYGLLPKIGDNGLRPLDVYAKRVTAELGSTPKIAIVIGGIGLSE 165

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
            G++ A++ LPA++TLA A  GN ++ WM+EA++ G E +LQ+P++ FD   N+   +TL
Sbjct: 166 AGSRNALDSLPADVTLALAPYGNEIEGWMQEARQAGHELLLQLPLEPFDFPDNDPGPHTL 225

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
            V+    + ++RL + L R T Y GV+N+ GA   S + S + + +E  +RGL++ DDGS
Sbjct: 226 LVSLRGAEFMDRLTWLLSRTTNYVGVVNFMGARFSSTEASMQYLLEEVTRRGLMYVDDGS 285

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
           S R++ + +A     P+   D+ LD     D+I  +L  LE +AR  G A+    A   +
Sbjct: 286 SSRSVAQPVASAAQTPFSKVDVVLDAVPKPDEINARLLQLEALARARGIAVAAGSALPVT 345

Query: 365 IEVISQWLQQEHVRDVSVVPLSCLA 389
           +  ++ W +    R + +VP+S   
Sbjct: 346 VRQLADWSRDLEQRGLMLVPISATV 370


>gi|302187492|ref|ZP_07264165.1| hypothetical protein Psyrps6_14148 [Pseudomonas syringae pv.
           syringae 642]
          Length = 260

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 97/226 (42%), Gaps = 7/226 (3%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
               A +++++  LG +     R    LP  +TLA   +      + +EA + G+  +L 
Sbjct: 27  KPPKAYLSLIIDDLGQNPQRDSRT-LALPGPVTLAIMPDTPHATEFAREAHRAGKTVMLH 85

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +  
Sbjct: 86  MPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMT 139

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +
Sbjct: 140 WLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTAIK 199

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           IAR  G A+ +   +  +++V+ + L     + V  + L  +    
Sbjct: 200 IARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSMISER 245


>gi|109899910|ref|YP_663165.1| protein of unknown function DUF610, YibQ [Pseudoalteromonas
           atlantica T6c]
 gi|109702191|gb|ABG42111.1| protein of unknown function DUF610, YibQ [Pseudoalteromonas
           atlantica T6c]
          Length = 255

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 45/226 (19%), Positives = 101/226 (44%), Gaps = 3/226 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A  A+IAI++  +G + +    A   LP N+ ++   + +   ++   A ++ +E 
Sbjct: 19  PTSAALSAQIAIIIDDVG-NNSHRDAAALGLPINVAISILPHKHLSQKYALMAHEQHREF 77

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +L +PM++      E  S  L  + + ++++  L  +        G+ N+ G+ L   + 
Sbjct: 78  LLHMPMESMAGIKQE--SNVLLASMSDKRIVQTLNDAFASVPNALGLNNHMGSRLTQLET 135

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
                     + GL+F D  ++       +A +  +P +   ++LD+ +   KI  +   
Sbjct: 136 PMRTTMSYLHRHGLIFVDSRTTALTRAEAIAKQTKVPALRRHVFLDNDLSEAKIERQFNI 195

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           L + AR  G+++ +     ++I  + + L      DV ++PLS + 
Sbjct: 196 LVKRARKYGRSLAIGHPHMQTIAYLKKRLPTLAQDDVQLIPLSAML 241


>gi|312170645|emb|CBX78908.1| Uncharacterized protein yibQ precursor [Erwinia amylovora ATCC
           BAA-2158]
          Length = 308

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 90/218 (41%), Gaps = 4/218 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   ++ +  +PA I++A   +         +A + G E ++ +PM  
Sbjct: 24  KLSIVIDDFGY-RPAQEQQVLQMPAAISVAVLPHAPHAREMATKAHQSGHEVLIHLPMAP 82

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E    TL+   + +++   +R +        G+ N+ G+ + S+    + + + 
Sbjct: 83  LSKQPLE--KDTLRPDMSTEEIGRIIREAAATVPYAVGLNNHMGSAMTSSLPGMQKVMRV 140

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
                  F D  +   +     A   ++  +   ++LDD  +   IR +      +A+  
Sbjct: 141 LNHYQFYFLDSMTIGNSQATRAAAGTSVKVVKRRVFLDDSQNEADIRVQFTRAVRLAQRD 200

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           G AI +      ++ V+ Q L      D+++V  S L 
Sbjct: 201 GSAIAIGHPHPSTVRVLQQMLTTLPA-DITLVRPSQLL 237


>gi|312898727|ref|ZP_07758116.1| divergent polysaccharide deacetylase [Megasphaera micronuciformis
           F0359]
 gi|310620158|gb|EFQ03729.1| divergent polysaccharide deacetylase [Megasphaera micronuciformis
           F0359]
          Length = 425

 Score =  238 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 41/316 (12%), Positives = 113/316 (35%), Gaps = 15/316 (4%)

Query: 76  NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR--STSIDSLPTIEE 133
            +E     +         +  +  +++D  +   + G TV     +           + +
Sbjct: 123 ELEKSDGKAVLYRTEDVKKNGDTVTEYDIALCESVDGDTVSMVALKLYVPPKGKAAALAK 182

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINL 193
            L +  +        + GR                  AR+A+V+   G S        N 
Sbjct: 183 ELKVDKNSPSDGESGEDGRIRHPSQ----------IKARLAVVIDDCG-SNMEVLEGYNA 231

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP ++T A     +      +     G + I+ +PM+  +   +E     +      +++
Sbjct: 232 LPIHLTYAVMPFKSHTIDSAESGHNAGNKIIVHLPMEPLNTVSSE--EIFISSDMGDKKV 289

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
           +      + +     G+ N++G+   ++    + +      RGL+F D  ++  ++    
Sbjct: 290 IATTNELIDQVPYAVGINNHQGSKSTADTRLMKDVMSVLKSRGLVFLDSRTTAASVAEQT 349

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A  + +     +L++D+      I+E+++    +A   G A+ +      +++ + +  +
Sbjct: 350 AASMGVGTTRNNLFIDNDPSVSAIKERIRQAGRLALKNGTAVTIGHCRPATLQALKETYK 409

Query: 374 QEHVRDVSVVPLSCLA 389
           +     +  V ++ + 
Sbjct: 410 ELLDEGIDFVFVTQVM 425


>gi|310641393|ref|YP_003946151.1| protein [Paenibacillus polymyxa SC2]
 gi|309246343|gb|ADO55910.1| Putative uncharacterized protein [Paenibacillus polymyxa SC2]
          Length = 311

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 42/222 (18%), Positives = 92/222 (41%), Gaps = 5/222 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+A+++  LG +  GT+  I  LP  IT+A      +  +   EA  +G + I+ +PM+ 
Sbjct: 72  RVAVIIDDLGNNMKGTKE-ILNLPVKITVAVMPFLPTTKQDAMEAHNRGHDVIVHLPMEP 130

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                       +K   T +++  ++  +++      G+ N+ G+ + S+K    ++   
Sbjct: 131 KQGKPEWLGPGAIKANMTDEEVRAKVTAAIKDVPYAIGMNNHMGSKVTSDKRIMSIVLDV 190

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             + GL F D  ++  ++   LA K  +P +  D++LDD      +  +L  + E     
Sbjct: 191 CKEHGLFFVDSRTNYWSVVPELAAKKGMPPVRNDVFLDDVHTLAHVNRQLSKVVEWLAEH 250

Query: 352 GQAIGVAVAFDE---SIEVISQWLQQEHVRDVSVVPLSCLAK 390
              + +         +   +   + +        V +S L +
Sbjct: 251 NTCVTIGHVGVSGMYTSSGLHSSVPKLKEHA-QFVGISDLVR 291


>gi|251791501|ref|YP_003006222.1| hypothetical protein Dd1591_3943 [Dickeya zeae Ech1591]
 gi|247540122|gb|ACT08743.1| protein of unknown function DUF610 YibQ [Dickeya zeae Ech1591]
          Length = 309

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 44/245 (17%), Positives = 96/245 (39%), Gaps = 4/245 (1%)

Query: 150 VGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSL 209
                  +              ++A+V+   G  +   +  +  +PA I++A   N    
Sbjct: 2   HPLLSRSLALTGALLALPVWAGKLALVIDDFGY-RPHNENQVLAMPAAISVAVLPNAPYA 60

Query: 210 DRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
                +A  +G+E ++ +PM    +   E    TL+   + +++   LR ++ +     G
Sbjct: 61  REMAMKAHAQGREVLIHLPMAPMSKQPLE--RDTLRPDMSSEEIARILRDAVNKVPYAVG 118

Query: 270 VMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD 329
           + N+ G+ + ++    + + +      L F D  +   +     A    +  +   ++LD
Sbjct: 119 LNNHMGSAMTASLPGMQKVMQAMTTYRLYFLDSMTIGSSQASRAAAGTGIKVLKRKVFLD 178

Query: 330 DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           D  +   IR +     +IA+ +G AI +      +I+V+ Q L      D+ +V  S L 
Sbjct: 179 DTQNVADIRRQFSRAVDIAQRSGYAIAIGHPHPATIQVLQQMLPTLPA-DIVLVRPSQLL 237

Query: 390 KLSSP 394
               P
Sbjct: 238 NEPEP 242


>gi|170742352|ref|YP_001771007.1| hypothetical protein M446_4224 [Methylobacterium sp. 4-46]
 gi|168196626|gb|ACA18573.1| protein of unknown function DUF610 YibQ [Methylobacterium sp. 4-46]
          Length = 396

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 104/394 (26%), Positives = 164/394 (41%), Gaps = 12/394 (3%)

Query: 5   LNHPLR--KKTPKRKSFYSQIISRLGLFLLFCTFIVGLSI-YILISHAFVGTISEMIPYS 61
           L  PL    +TP R +     I    +       +VG    ++ ++   +G     +   
Sbjct: 8   LTRPLGMRDETPSRLARLRAAIPLRAILSAAAAVLVGAVAGFVALTEDPLGGEPHALVTI 67

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
             RE  P P +       +        +   ++++  S     + +      +VV +   
Sbjct: 68  TRREAPPGPPS------PRPPAPAEAGSRSASEVERASGVAVLRPEGSAVPDSVVIRVPG 121

Query: 122 STSIDSLPTIEERLILGLSK---KELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVS 178
            T I   P  +  L           L        +    P         A   RIA+VV+
Sbjct: 122 PTEIRLAPAPDPALSEKGRYGLLPRLGPDGARAVDVYARPEAPALPSGAAPAGRIALVVT 181

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
           GLGI    TQ A+  LP  +TLAFA  G  + R    A++ G E ++Q PM+ FD   N+
Sbjct: 182 GLGIGAAVTQDAVTRLPPAVTLAFAPYGADVGRQAARAREAGHEVMVQAPMEPFDYPDND 241

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
               TL       +  +RL + L R  G  GV+NY GA L +   + + I +E   RGL 
Sbjct: 242 PGPQTLLAGAKPAENADRLGFVLSRIPGAIGVVNYMGARLTAEAGALDPILREIGARGLG 301

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F DDG+SPR+L   +  +   P   AD+ +D     D +  +L  LEE AR  G A+G A
Sbjct: 302 FVDDGTSPRSLALDIGRRARAPVARADVVVDAAPLPDAVDRELARLEETARRKGFAMGSA 361

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +A   +I+ I++W +    R + +VP S   +  
Sbjct: 362 MALPLTIDRIARWSRDLEARGILLVPASRALRAR 395


>gi|261866855|ref|YP_003254777.1| divergent polysaccharide deacetylase superfamily protein
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|293391508|ref|ZP_06635842.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412187|gb|ACX81558.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290952042|gb|EFE02161.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 275

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 41/227 (18%), Positives = 98/227 (43%), Gaps = 4/227 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           +   A  A++AIV+  LG         I  LP  +++A         +  ++A ++G++ 
Sbjct: 17  WLPVAYSAKLAIVIDDLGY-HPKEDAQILALPKAVSVAIIPAAPYAKQRNQQAHQQGRDI 75

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM+   +   E     L +    +++ +R++ + +  +   G+ N+ G+   ++  
Sbjct: 76  LIHMPMETVSKMKIEGG--GLHLGMNQEEVNHRVQTAKKIVSHAIGMNNHMGSAATADVP 133

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
               +     +R L F D  +  R++   +A    +  +   ++LDD  D   ++ + + 
Sbjct: 134 LMTKLMTALRERHLFFLDSRTIGRSVAGKIAKAQGVLALDRHIFLDDSNDLADVQRQFRA 193

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             + A+  G AI +      +I V+   +      DV +V +  L +
Sbjct: 194 AVQYAQKHGTAIAIGHPRKNTIAVLQAGIINLPS-DVQLVSMGSLWR 239


>gi|209963454|ref|YP_002296369.1| hypothetical protein RC1_0107 [Rhodospirillum centenum SW]
 gi|209956920|gb|ACI97556.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 240

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 62/249 (24%), Positives = 115/249 (46%), Gaps = 10/249 (4%)

Query: 148 NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
               R     P  +          RI IV+  +G+    + R +  LP  +TLA+     
Sbjct: 2   PAWQRNAVPTPPAE-------GRPRIVIVIDDMGLDHRRSGRVV-ALPGPLTLAWLPYAR 53

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
            L    ++A ++G E I+ +PM+       +     L V Q+ +++ +RLR +L   +GY
Sbjct: 54  DLPIQTRQAHQRGHELIVHMPMEPAG--SGDPGPNALLVRQSPEEIRSRLRTNLDAFSGY 111

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            G+ N+ G+   ++  ++ V+ +E A+RGLL  D  ++  +  R  A + ++P    D++
Sbjct: 112 VGINNHMGSRFTADAAASAVVVEELARRGLLVLDSRTTADSRLRDEAVRRHVPSASRDVF 171

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
           LD       +   L+ +E  AR  G AI +    D + E +++WL     +   +VPLS 
Sbjct: 172 LDHVQTPAAVSAALEKVEATARRQGLAIAIGHPHDVTTEALARWLPTLAGKGFQLVPLSA 231

Query: 388 LAKLSSPSS 396
           + +     S
Sbjct: 232 VVRTGPSES 240


>gi|226310991|ref|YP_002770885.1| hypothetical protein BBR47_14040 [Brevibacillus brevis NBRC 100599]
 gi|226093939|dbj|BAH42381.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599]
          Length = 260

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 39/241 (16%), Positives = 102/241 (42%), Gaps = 5/241 (2%)

Query: 153 EDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRW 212
               V A      +      +A V+   G +  GT+  I  +P  +T+A      S  + 
Sbjct: 18  GAIPVTANSTPAPAPVVKKLMAFVIDDFGNNMQGTEE-ILAMPVPLTVAVMPFMPSTKQD 76

Query: 213 MKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMN 272
            + A +KG + ++ +PM+      +      +    +  ++ +R+  ++       G+ N
Sbjct: 77  AELAHQKGHDVLVHMPMEPMKGKRSWLGPGAITADLSDDEIRSRVEKAIDDVPHAIGMNN 136

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+ + +++    +I K   +RGL + D  ++ +++   +A ++ +P+ V  ++LDD  
Sbjct: 137 HMGSKITADERIMRIIMKVVKERGLFYLDSKTTDKSVAAKVAAEMGVPHAVNQIFLDDVY 196

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAV---AFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
               I ++++ + +        I +        ++  ++ Q++ +        V +S L 
Sbjct: 197 SVPHITKQMELVCKKIHNHPLCIAIGHVGPPGKKTASLLRQYIPRIQKEA-EFVTISKLI 255

Query: 390 K 390
           +
Sbjct: 256 Q 256


>gi|239906405|ref|YP_002953146.1| hypothetical protein DMR_17690 [Desulfovibrio magneticus RS-1]
 gi|239796271|dbj|BAH75260.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 390

 Score =  236 bits (603), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 54/315 (17%), Positives = 107/315 (33%), Gaps = 2/315 (0%)

Query: 74  PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEE 133
               +        +++ +        +Q   +             P  ++  +       
Sbjct: 74  AATPQGAPPAPTDEHDALTLARALSQAQAQAKGTPPPVHFEEHLPPQAASPENGNGNGNG 133

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINL 193
                   +  +      +     PA            R+ +V+  +G       + +  
Sbjct: 134 NGNGPHEVRGKVEPPAGAQPPPPEPAAPPVARDEGKNPRMVVVIDDIG-DHPVMAKNLTE 192

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP ++TLA   N          A  +  E IL  PMQ             L      +++
Sbjct: 193 LPFSVTLAILPNRPRTRSVEAMAASQHVEIILHQPMQPGTYPRVNPGPGALFTDMEPERV 252

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              L  +L +     G+ N+ G+   S+    + +     ++GL F D  +S  +     
Sbjct: 253 KEILADNLSQVPHVKGINNHMGSAFTSDPAGMDAVMAVLKQKGLFFLDSVTSAVSAAPEA 312

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A K  +P+    ++LD+  +   I  +LK  E  A   G+AI +   + E++E +  W +
Sbjct: 313 ARKHGVPFYRRAVFLDNVRNVRTILGQLKTAERNALKNGRAIAIGHPYGETLEALKIWAK 372

Query: 374 QEHVRDVSVVPLSCL 388
           +   R V VV L+ L
Sbjct: 373 ERDGR-VDVVTLTEL 386


>gi|301155117|emb|CBW14581.1| predicted polysaccharide deacetylase [Haemophilus parainfluenzae
           T3T1]
          Length = 280

 Score =  236 bits (603), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 91/219 (41%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G         I  +P  I++A            ++AK +  + ++ +PMQ 
Sbjct: 29  KLAIVIDDIGY-HPKEDAEILAMPKEISVAIIPAAPYAKIRNQQAKAQNHDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 E+    L +  +  Q+  R++ +        G+ N+ G+   ++      +   
Sbjct: 88  VSNIKIEEG--GLTLGLSEAQVNERVKKAKSIVPNAIGMNNHMGSAATADTTLMTYLMSA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + +   + AR  
Sbjct: 146 LREQHLFFLDSRTIGKSVAGKIAKEQGVRVLDRHIFLDDSDNLVDVQRQFQNAIQYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      ++ V+   ++     D+ +V +  L +
Sbjct: 206 GTAIAIGHPRPNTVAVLKSGIKNLPD-DIQLVGMGSLWR 243


>gi|192359430|ref|YP_001984003.1| Divergent polysaccharide deacetylase family [Cellvibrio japonicus
           Ueda107]
 gi|190685595|gb|ACE83273.1| Divergent polysaccharide deacetylase family [Cellvibrio japonicus
           Ueda107]
          Length = 290

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 50/227 (22%), Positives = 96/227 (42%), Gaps = 3/227 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +G +    +RA   L  + TLA            + A ++G+E +L  P
Sbjct: 33  QAGQLAIIIDDIGYNLDAGRRA-ADLSGDYTLAVLPFTPHGRELAERAYRRGKEIMLHAP 91

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           M   +E +       L+   + +  L  L  +L       GV N+ G+ L   +E    +
Sbjct: 92  M--SNEQHLPLGKGGLESGMSRETFLQVLERNLADIPHVRGVNNHTGSQLTQEEEPMRWL 149

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
             E  +RGL F D  ++ +   + +A    LP    D++LDD+ +   +  +L+     A
Sbjct: 150 MAELKQRGLYFVDSRTTAKTRAQAMAEAAGLPNRKRDVFLDDRPEPAHVASQLELAMATA 209

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           R  G A+ +   +  ++  + +         +++V  S L   S PS
Sbjct: 210 RRQGSAVAIGHPYPSTLAALEKIAPLLEKYAITLVKASLLMPSSRPS 256


>gi|239995835|ref|ZP_04716359.1| hypothetical protein AmacA2_15321 [Alteromonas macleodii ATCC
           27126]
          Length = 302

 Score =  236 bits (602), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 90/218 (41%), Gaps = 4/218 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            + I I++  LG     +  A   LP  IT +              A+++G+  +L +PM
Sbjct: 25  KSDIIIILDDLGYRP--SDVAAFSLPKEITFSILPQTPLASEIALRAEQEGRAVMLHMPM 82

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           QA      +     L        +   LR +++      GV N+ G+     ++  E + 
Sbjct: 83  QAQSGK--DMGPLGLTTDMFAGAITYNLRKAMKSVPNAVGVNNHMGSAFTGQQKGMEALL 140

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           KE  ++GL F D  ++       +A +L +P     ++LD +++   + ++   ++ IA+
Sbjct: 141 KEVKRQGLFFVDSRTTVLTKGEEIAQRLGVPSASRQVFLDHKLEPAFLLKQFNHMKRIAK 200

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
             G  + +     E+++ +   +       +++  ++ 
Sbjct: 201 KNGHVVVIGHPHPETVDFLKTHIPSLEKEGLTLTSVTD 238


>gi|292486586|ref|YP_003529454.1| hypothetical protein EAMY_0096 [Erwinia amylovora CFBP1430]
 gi|292897823|ref|YP_003537192.1| exported polysaccharide deacetylase [Erwinia amylovora ATCC 49946]
 gi|291197671|emb|CBJ44766.1| putative exported polysaccharide deacetylase [Erwinia amylovora
           ATCC 49946]
 gi|291552001|emb|CBA19038.1| Uncharacterized protein yibQ precursor [Erwinia amylovora CFBP1430]
          Length = 308

 Score =  236 bits (601), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 40/218 (18%), Positives = 90/218 (41%), Gaps = 4/218 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           +++IV+   G  +   ++ +  +PA I++A   +         +A + G E ++ +PM  
Sbjct: 24  KLSIVIDDFGY-RPAQEQQVLQMPAAISVAVLPHAPHAREMATKAHQSGHEVLIHLPMAP 82

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
             +   E    TL+   + +++   +R +        G+ N+ G+ + S+    + + + 
Sbjct: 83  LSKQPLE--KDTLRPDMSTEEIGRIIREAAAAVPYAVGLNNHMGSAMTSSLPGMQKVMRV 140

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
                  F D  +   +     A   ++  +   ++LDD  +   IR +      +A+  
Sbjct: 141 LNHYQFYFLDSMTIGNSQATRAAAGTSVKVVKRRVFLDDSQNEADIRVQFTRAVRLAQRD 200

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           G AI +      ++ V+ Q L      DV++V  S L 
Sbjct: 201 GSAIAIGHPHPSTVRVLQQMLTTLPA-DVTLVRPSQLL 237


>gi|322418639|ref|YP_004197862.1| hypothetical protein GM18_1111 [Geobacter sp. M18]
 gi|320125026|gb|ADW12586.1| protein of unknown function DUF610 YibQ [Geobacter sp. M18]
          Length = 318

 Score =  236 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 46/261 (17%), Positives = 101/261 (38%), Gaps = 2/261 (0%)

Query: 129 PTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA-RIAIVVSGLGISQTGT 187
           P+      L +  +    + K+                 A G  R+AI++  +G S    
Sbjct: 57  PSASAPKHLPVPPRPAPVQQKLSTASAPAQKTHPAALPKAQGPGRLAIIIDDMGTS-VQE 115

Query: 188 QRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT 247
            + +  +   +T +   +     +  + A   G E ++ +PM+       + +S  + V 
Sbjct: 116 LKTLQSIGLPLTYSVIPSLAHARQIAEGAHAAGAEVMIHMPMEPEGYPKQKLESIGVLVA 175

Query: 248 QTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPR 307
               ++ +R++   R      G  N+ G+    + +  +V+ +   ++GL F D  +SP 
Sbjct: 176 MNDGEIADRIKSYFRTVPYAVGANNHMGSRFTQHADKMQVVLQVLKEKGLFFVDSKTSPA 235

Query: 308 NLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
           ++    A  + L      ++LD+  D   I  +L     IAR  G AI +      ++  
Sbjct: 236 SVGYSEARGMGLKCASRQVFLDNVQDEAAIGRQLAQAAAIARKKGAAIAICHPHPATLRA 295

Query: 368 ISQWLQQEHVRDVSVVPLSCL 388
           +  ++ +     ++ V  S L
Sbjct: 296 LKLYMPELAKSGITFVHASDL 316


>gi|301169472|emb|CBW29073.1| predicted polysaccharide deacetylase [Haemophilus influenzae 10810]
          Length = 280

 Score =  236 bits (601), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 43/222 (19%), Positives = 94/222 (42%), Gaps = 4/222 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           G AI +      +I V+   L+     D+ +V +  L +   
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWRNQK 246


>gi|229016679|ref|ZP_04173614.1| hypothetical protein bcere0030_12500 [Bacillus cereus AH1273]
 gi|228744615|gb|EEL94682.1| hypothetical protein bcere0030_12500 [Bacillus cereus AH1273]
          Length = 256

 Score =  235 bits (600), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 96/237 (40%), Gaps = 5/237 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              +NA   ++AIV+   G +  GT R +  LP  +T+A      S  +    A KKG E
Sbjct: 21  PIQANAHTNKVAIVIDDFGNNMKGTDR-MLSLPIPLTIAVMPFLPSTKQDAIAAHKKGHE 79

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++
Sbjct: 80  VIIHMPMEPIRGKKEWLGPKAITTDLSDEEINNRLEQAIQEIPHAIGMNNHMGSKVTADE 139

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I  + +
Sbjct: 140 RIVRLILSACKKHGLFYLDSKTNPNSVVPKIGKELGVPVIENQLFFDDVYTASHISRQAQ 199

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            L +  +     + +         +  VI   + +        + LS L     P S
Sbjct: 200 LLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKVREHA-DFIFLSDLVLSPPPVS 255


>gi|319897746|ref|YP_004135943.1| hypothetical protein HIBPF15550 [Haemophilus influenzae F3031]
 gi|317433252|emb|CBY81627.1| conserved hypothetical protein [Haemophilus influenzae F3031]
          Length = 280

 Score =  235 bits (600), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARVRNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  ISAIKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GTAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|329122701|ref|ZP_08251279.1| divergent polysaccharide deacetylase superfamily protein
           [Haemophilus aegyptius ATCC 11116]
 gi|327472575|gb|EGF18005.1| divergent polysaccharide deacetylase superfamily protein
           [Haemophilus aegyptius ATCC 11116]
          Length = 280

 Score =  235 bits (600), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  ISAIKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|68249351|ref|YP_248463.1| hypothetical protein NTHI0914 [Haemophilus influenzae 86-028NP]
 gi|145632108|ref|ZP_01787843.1| hypothetical protein CGSHi3655_06634 [Haemophilus influenzae 3655]
 gi|68057550|gb|AAX87803.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP]
 gi|144987015|gb|EDJ93545.1| hypothetical protein CGSHi3655_06634 [Haemophilus influenzae 3655]
          Length = 280

 Score =  235 bits (600), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRQNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|1074506|pir||C64158 hypothetical protein HI0755 - Haemophilus influenzae (strain Rd
           KW20)
          Length = 284

 Score =  235 bits (600), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 33  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 91

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 92  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 149

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 150 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 209

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 210 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 247


>gi|229844623|ref|ZP_04464762.1| hypothetical protein CGSHi6P18H1_03404 [Haemophilus influenzae
           6P18H1]
 gi|229812337|gb|EEP48027.1| hypothetical protein CGSHi6P18H1_03404 [Haemophilus influenzae
           6P18H1]
          Length = 280

 Score =  235 bits (600), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 44/219 (20%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARVRNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  ISAIKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   I+ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTVGKSVAGKVAKEQGVRSLDRHIFLDDSNEFADIQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GTAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|283850893|ref|ZP_06368179.1| protein of unknown function DUF610 YibQ [Desulfovibrio sp. FW1012B]
 gi|283573816|gb|EFC21790.1| protein of unknown function DUF610 YibQ [Desulfovibrio sp. FW1012B]
          Length = 378

 Score =  235 bits (600), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 56/325 (17%), Positives = 108/325 (33%), Gaps = 4/325 (1%)

Query: 66  IAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSI 125
             P   T   +   K    +          +        ++      +  +         
Sbjct: 52  PFPPLPTDHPSPAAKAGDIRHLAAAASKPRRPAGEHGPARLAESTPRQAELPFEEHLAGR 111

Query: 126 DSLPTIEER--LILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGIS 183
           ++ P        +  + +    A           P           G R+ +V+  +G  
Sbjct: 112 ETPPPNPAPASEVRVVMEAAPPAGTAAPGPADTEPDAHPVPGDAGKGPRMVVVIDDIG-D 170

Query: 184 QTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT 243
                R +  LP  +TLA   N         +A + G E IL  PMQ             
Sbjct: 171 HPVMARNLMELPIPVTLAILPNRPRTRSIAAQAAEHGLEIILHQPMQPGSYPRVNPGPGA 230

Query: 244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDG 303
           L      +++   L  +L +     G+ N+ G+   S+      +      +GL F D  
Sbjct: 231 LFPDMDEKRIQATLTDNLSQLPHVVGINNHMGSAFTSDGPGMAAVMPILKAKGLFFMDSV 290

Query: 304 SSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDE 363
           +S  +     A +  +P+    ++LD+  +   I  +LK  E  A   G+AI +   + E
Sbjct: 291 TSATSAAPEAARRAGVPFYRRAVFLDNVRNTRTILGQLKTAERHALKHGRAIAIGHPYGE 350

Query: 364 SIEVISQWLQQEHVRDVSVVPLSCL 388
           + E +  W ++   R +++V L+ L
Sbjct: 351 TYEALKIWAKERDPR-IALVTLTEL 374


>gi|30995399|ref|NP_438914.2| hypothetical protein HI0755 [Haemophilus influenzae Rd KW20]
 gi|1176306|sp|P44863|Y755_HAEIN RecName: Full=Uncharacterized protein HI_0755; Flags: Precursor
          Length = 280

 Score =  235 bits (600), Expect = 9e-60,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|260579846|ref|ZP_05847676.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|260093130|gb|EEW77063.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
          Length = 281

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 30  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 88

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 89  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 146

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 147 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 206

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 207 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 244


>gi|152974861|ref|YP_001374378.1| protein of unknown function DUF610 YibQ [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023613|gb|ABS21383.1| protein of unknown function DUF610 YibQ [Bacillus cytotoxicus NVH
           391-98]
          Length = 256

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 41/230 (17%), Positives = 93/230 (40%), Gaps = 5/230 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
               +A   ++AIV+   G +  GT+  +  LP  +T+A      S  +    A KKG E
Sbjct: 20  PINIHAHTNKVAIVIDDFGNNMKGTKE-MLSLPIPLTVAVMPFLPSTKQDAIAAHKKGHE 78

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+  +          +    +  ++ +R+  ++       G+ N+ G+ + +++
Sbjct: 79  VIIHMPMEPINGKKEWLGPKAITTDLSDDEIKHRIEQAIEAVPYAIGMNNHMGSKVTADE 138

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++  ++   +  +L++P +   ++ DD      I ++ +
Sbjct: 139 RIMRIILTVCKKHGLFYLDSKTNSNSVVSRIGKELDVPIIENQMFFDDIYTSSHILKQAQ 198

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLA 389
            L +  R T   + +         +   I   + +        + LS L 
Sbjct: 199 FLLQKTRKTPVVVAIGHVGPPGETTSRAIQSTIPKVREHA-DFIFLSDLV 247


>gi|145628360|ref|ZP_01784161.1| hypothetical protein CGSHi22121_04945 [Haemophilus influenzae
           22.1-21]
 gi|144980135|gb|EDJ89794.1| hypothetical protein CGSHi22121_04945 [Haemophilus influenzae
           22.1-21]
          Length = 280

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSEAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L      D+ +V +  L +
Sbjct: 206 GSAIAIGHPRANTIAVLQAGLNNLPE-DIQLVGMGNLWR 243


>gi|66048112|ref|YP_237953.1| hypothetical protein Psyr_4888 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258819|gb|AAY39915.1| Protein of unknown function DUF610 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330970736|gb|EGH70802.1| hypothetical protein PSYAR_09607 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 260

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 47/233 (20%), Positives = 99/233 (42%), Gaps = 7/233 (3%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A         S A +++++  LG +     R    LP  +TLA   +      + ++A
Sbjct: 17  AHAAPAENSGKPSKAYLSLIIDDLGQNPQRDSRT-LALPGPVTLAIMPDTPHATEFARQA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            + G+  +L +PM            Y       + +L +RL  +L +     G+ N+ G+
Sbjct: 76  HRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGS 129

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + 
Sbjct: 130 RMTAEPVAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEA 189

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           I  +L+   +IAR  G A+ +   +  +++V+ + L     + V  + L  + 
Sbjct: 190 ITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSMI 242


>gi|256830630|ref|YP_003159358.1| hypothetical protein Dbac_2867 [Desulfomicrobium baculatum DSM
           4028]
 gi|256579806|gb|ACU90942.1| protein of unknown function DUF610 YibQ [Desulfomicrobium baculatum
           DSM 4028]
          Length = 433

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 46/237 (19%), Positives = 95/237 (40%), Gaps = 2/237 (0%)

Query: 139 LSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANI 198
           L    L            +    +     A   R+ I++  LG S    +R +  LP  +
Sbjct: 185 LEISILGEPTHHIFLPLALVPESEPEVQTAKAPRLVIIIDDLGESMAVAKR-LAALPFAV 243

Query: 199 TLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYN-EDDSYTLKVTQTVQQLLNRL 257
           + +   +     +    A+++  E +L +P +             TL+V  T   L   L
Sbjct: 244 SFSVLPHNTKARQVSNLARQENLELLLHLPCEPEGYPKTANSGPGTLRVNMTPADLEQTL 303

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
             +L R     GV N+ G+ L  +K++  ++      +G  F D  ++P++  R ++  L
Sbjct: 304 ADNLARLPDVDGVNNHMGSRLTQDKKAMTIVLGHLQGQGKFFVDSLTTPKSCVRDVSNTL 363

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
            + Y    ++LD+      +  +LK  E +A+ TG A+ +   +  ++  +  W + 
Sbjct: 364 GMRYYRRHIFLDNTAKEHAVLLQLKKAESLAKRTGLAVAIGHPYPATLSALESWAKS 420


>gi|145636690|ref|ZP_01792357.1| hypothetical protein CGSHiHH_03778 [Haemophilus influenzae PittHH]
 gi|229845802|ref|ZP_04465914.1| hypothetical protein CGSHi7P49H1_03098 [Haemophilus influenzae
           7P49H1]
 gi|145270216|gb|EDK10152.1| hypothetical protein CGSHiHH_03778 [Haemophilus influenzae PittHH]
 gi|229810806|gb|EEP46523.1| hypothetical protein CGSHi7P49H1_03098 [Haemophilus influenzae
           7P49H1]
          Length = 280

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|323141912|ref|ZP_08076773.1| divergent polysaccharide deacetylase [Phascolarctobacterium sp. YIT
           12067]
 gi|322413659|gb|EFY04517.1| divergent polysaccharide deacetylase [Phascolarctobacterium sp. YIT
           12067]
          Length = 423

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 45/237 (18%), Positives = 102/237 (43%), Gaps = 1/237 (0%)

Query: 153 EDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRW 212
              +    ++         ++AIV+   G       R +       + A           
Sbjct: 187 LPEQKAEEEQQGTVRQFRGKVAIVIDDCGYDMAPV-RKLLNTGLPFSYAILPYKQYSSDV 245

Query: 213 MKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMN 272
           ++  K KG+  +L +PM+  D S   + + T++   +  + L+  R +L    G  GV N
Sbjct: 246 LEMVKAKGRVPMLHLPMEPIDRSAMSEGAATIRTDLSAAEKLSLTRRALNSLPGVMGVNN 305

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           ++G+   ++K++  V+ +E  ++ L F D  ++  ++ R +A +L++     D++LD+  
Sbjct: 306 HQGSKATADKDTMRVVLQELRRQKLFFVDSRTNSASVARNMAQQLDVSTARNDIFLDNSS 365

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           D   IR+++     +A   G  I +  A   + +    +  +     ++ VP++ L 
Sbjct: 366 DVQAIRQQIYKAFAMAEKNGSVIAICHARPNTAKCWEMYAAEFKRTGITFVPVTELL 422


>gi|28872442|ref|NP_795061.1| hypothetical protein PSPTO_5330 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213971178|ref|ZP_03399296.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
 gi|301382306|ref|ZP_07230724.1| hypothetical protein PsyrptM_06718 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058523|ref|ZP_07250064.1| hypothetical protein PsyrptK_00941 [Pseudomonas syringae pv. tomato
           K40]
 gi|302132190|ref|ZP_07258180.1| hypothetical protein PsyrptN_12399 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|28855697|gb|AAO58756.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|213924047|gb|EEB57624.1| conserved hypothetical protein [Pseudomonas syringae pv. tomato T1]
          Length = 260

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 97/228 (42%), Gaps = 7/228 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
               S A   +++  LG +     R    LP  +TLA   +      + +EA + G+  I
Sbjct: 25  AEKTSKAYFTLIIDDLGQNPVRDSRT-LALPGPVTLAIMPDTPHATEFAREAHRAGKTVI 83

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +
Sbjct: 84  LHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVA 137

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+  
Sbjct: 138 MTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTA 197

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++A+  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 198 IKLAQKHGSAVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSMISER 245


>gi|145630498|ref|ZP_01786278.1| hypothetical protein CGSHi22421_04483 [Haemophilus influenzae
           R3021]
 gi|144983888|gb|EDJ91330.1| hypothetical protein CGSHi22421_04483 [Haemophilus influenzae
           R3021]
          Length = 280

 Score =  234 bits (598), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 44/219 (20%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPHARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  L  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGLRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|325576789|ref|ZP_08147404.1| divergent polysaccharide deacetylase [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160995|gb|EGC73113.1| divergent polysaccharide deacetylase [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 280

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 36/219 (16%), Positives = 91/219 (41%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G         +  +P  I++A            +EAK +  + ++ +PMQ 
Sbjct: 29  KLAIVIDDIGY-HPKEDAEVLAMPKEISVAIIPAAPYAKIRNQEAKAQNHDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 E+    L +  +  Q+  R++ +        G+ N+ G+   ++      +   
Sbjct: 88  VSNIKIEEG--GLTLGLSEAQVNERVKKAKAIVPNAIGMNNHMGSAATADATLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + +   + AR  
Sbjct: 146 LREQHLFFLDSRTIGKSVAGKIAKEQGVRVLDRHIFLDDSDNLVDVQRQFQSAIQYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      ++ V+   ++     D+ +V +  L +
Sbjct: 206 GTAIAIGHPRPNTVAVLKSGIKNLPD-DIQLVGMGSLWR 243


>gi|317128473|ref|YP_004094755.1| hypothetical protein Bcell_1761 [Bacillus cellulosilyticus DSM
           2522]
 gi|315473421|gb|ADU30024.1| protein of unknown function DUF610 YibQ [Bacillus cellulosilyticus
           DSM 2522]
          Length = 266

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 49/225 (21%), Positives = 97/225 (43%), Gaps = 5/225 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R AI++   G   TG  +        IT+A     +      K A + G E I+ +P++ 
Sbjct: 32  RAAIIIDDFG-GNTGGVKEFMNADVPITMAIMPFLDESTEQAKRANELGFEVIIHMPLEP 90

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +       ++  R+  ++       G+ N+ G+ ++ N+     I + 
Sbjct: 91  KKGKRSWLGPLPITADLETDEVKRRVEKAIENVPHAKGINNHMGSKIVGNERIVRAILEV 150

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIART 350
             K GL   D G+S  ++   +A +LN+PY + D +LDD    R+ + +++  L +I + 
Sbjct: 151 AKKHGLYVIDSGTSGDSVVPEIAEELNIPYGIRDTFLDDSFSSRNHVYKQMIKLCDIVKK 210

Query: 351 TGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            GQAI +       +++   I   L     +++ +VP+S L    
Sbjct: 211 HGQAIAIGHVGVKGNDTFNGIQDALPHLEEKNIQIVPMSHLLNTK 255


>gi|114571337|ref|YP_758017.1| hypothetical protein Mmar10_2797 [Maricaulis maris MCS10]
 gi|114341799|gb|ABI67079.1| protein of unknown function DUF610, YibQ [Maricaulis maris MCS10]
          Length = 445

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 88/381 (23%), Positives = 154/381 (40%), Gaps = 9/381 (2%)

Query: 16  RKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPL 75
           R   ++ + +   L L+     +  +  I +  A  G     +   V  ++         
Sbjct: 16  RAPLFAGLAAAAMLSLMIGGVALFGNGDIALPRAIGGVQPAPVEEQVASDMRGDTGDHGA 75

Query: 76  NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERL 135
            I     P      ++    ++  +      +   +  T  + P  + +  +        
Sbjct: 76  AI-RFLEPEGDGEVSLSGVREDFHAPAAATSREIAA-DTSGSDPADAEARVAAAATNPNA 133

Query: 136 ILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS-------GARIAIVVSGLGISQTGTQ 188
           +       L      G          +   + A           IA+VV G+G++ T TQ
Sbjct: 134 LAQAPIVGLTEPGPGGPLPVIAANGTRPSRAYARPYHGDPGAPTIAVVVGGMGLNSTVTQ 193

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
            AI+ LP  + L+FA+    L  W+  A+  G E +++ PM+ FD   N+   +TL    
Sbjct: 194 AAIDELPPEVALSFAAYARDLQVWIDRARAAGHEVLIEAPMEPFDYPNNDPGPHTLLADG 253

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
           T ++   RL + L R TGYFGV NY GA   +++++   +F     RG+ F  DG+  R+
Sbjct: 254 TAEENSRRLAWVLSRATGYFGVTNYLGARFSASQDAMRQVFGTLEGRGVAFLHDGAGRRS 313

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
                A   ++ Y VAD  LD+ +  D I E+L  LE +A   G A+G   A+  ++E I
Sbjct: 314 TIEAAAGATDIEYAVADRILDEDLSPDAIDERLLALEALAIQNGSALGTGFAYPATVEQI 373

Query: 369 SQWLQQEHVRDVSVVPLSCLA 389
             W     +R   + P S + 
Sbjct: 374 RDWAVSLDLRGYQLAPPSAVM 394


>gi|145634834|ref|ZP_01790542.1| hypothetical protein CGSHiAA_04498 [Haemophilus influenzae PittAA]
 gi|145640840|ref|ZP_01796422.1| hypothetical protein CGSHiR3021_07222 [Haemophilus influenzae
           R3021]
 gi|148826600|ref|YP_001291353.1| hypothetical protein CGSHiEE_08325 [Haemophilus influenzae PittEE]
 gi|145268000|gb|EDK07996.1| hypothetical protein CGSHiAA_04498 [Haemophilus influenzae PittAA]
 gi|145274354|gb|EDK14218.1| hypothetical protein CGSHiR3021_07222 [Haemophilus influenzae
           22.4-21]
 gi|148716760|gb|ABQ98970.1| hypothetical protein CGSHiEE_08325 [Haemophilus influenzae PittEE]
 gi|309973749|gb|ADO96950.1| Conserved hypothetical protein [Haemophilus influenzae R2846]
          Length = 280

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L      D+ +V +  L +
Sbjct: 206 GSAIAIGHPRANTIAVLQAGLNNLPE-DIQLVGMGNLWR 243


>gi|298484779|ref|ZP_07002879.1| Putative periplasmic protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|298160633|gb|EFI01654.1| Putative periplasmic protein [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
          Length = 260

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 99/236 (41%), Gaps = 7/236 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A           A +++++  LG +     R    LP  +TLA   +      + +EA
Sbjct: 17  AHAAPAENTGKPPKAYLSLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            + G+  +L +PM            Y       + +L +RL  +L +     G+ N+ G+
Sbjct: 76  HRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGS 129

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + 
Sbjct: 130 RMTAEPVAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEA 189

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I  +L+   +IAR  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 190 ITRQLQTAIKIARKHGSAVVIGHPYPVTLDVLERELPKLKDQGVEWIDLRSMISER 245


>gi|71736710|ref|YP_277009.1| yibQ gene product [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257483742|ref|ZP_05637783.1| yibQ gene product [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71557263|gb|AAZ36474.1| yibQ gene product [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320326473|gb|EFW82525.1| YibQ [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331766|gb|EFW87704.1| YibQ [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330872598|gb|EGH06747.1| YibO protein [Pseudomonas syringae pv. glycinea str. race 4]
 gi|331012105|gb|EGH92161.1| YibO protein [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 260

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 99/236 (41%), Gaps = 7/236 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A           A +++++  LG +     R    LP  +TLA   +      + +EA
Sbjct: 17  AHAAPAEDNGKPPKAYLSLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            + G+  +L +PM            Y       + +L +RL  +L +     G+ N+ G+
Sbjct: 76  HRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGS 129

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + 
Sbjct: 130 RMTAEPVAMAWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEA 189

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I  +L+   +IAR  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 190 INRQLQSAIKIARKHGSAVVIGHPYPVTLDVLERELPKLKDQGVEWIDLRSMISER 245


>gi|26991735|ref|NP_747160.1| hypothetical protein PP_5059 [Pseudomonas putida KT2440]
 gi|148550134|ref|YP_001270236.1| hypothetical protein Pput_4932 [Pseudomonas putida F1]
 gi|24986840|gb|AAN70624.1|AE016705_4 conserved hypothetical protein [Pseudomonas putida KT2440]
 gi|148514192|gb|ABQ81052.1| protein of unknown function DUF610, YibQ [Pseudomonas putida F1]
          Length = 255

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 47/225 (20%), Positives = 98/225 (43%), Gaps = 7/225 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A+ A ++I++  LG S     R    LP  +T+A   +      + ++A K G+  I
Sbjct: 18  AAPANKAYMSIIIDDLGQSPERDSRT-LALPGPVTMAIMPDTPHATDFARQAHKAGKTVI 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       +++L  RL  +L +     G+ N+ G+ + + +E 
Sbjct: 77  LHMPMDPAT------GPYAWHPGIAIEELARRLDAALVKVPYAAGINNHMGSRMTAQREP 130

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S   +    A   ++ ++  D++LDD    + I  +L+  
Sbjct: 131 MAWLMGELQRRHLFFVDSRTSAATVAAAEAQAHDVAHVSRDVFLDDVRTPEAIDAQLQQG 190

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +AR  G A+ +   + +++ V+   + +     + +V L  + 
Sbjct: 191 IALARKQGSAVLIGHPYPQTLAVLESQIPRLKQLGIELVTLQQMI 235


>gi|330874211|gb|EGH08360.1| hypothetical protein PSYMP_06329 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 260

 Score =  234 bits (596), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 98/228 (42%), Gaps = 7/228 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
               S A + +++  LG +     R    LP  +TLA   +      + +EA + G+  I
Sbjct: 25  AEKTSKAYLTLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREAHRAGKTVI 83

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +
Sbjct: 84  LHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVA 137

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+  
Sbjct: 138 MTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTA 197

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++A+  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 198 IKLAQKQGSAVVIGHPYPVTLDVLERELPRLKAQGVEWIDLRSMISER 245


>gi|260581569|ref|ZP_05849366.1| conserved hypothetical protein [Haemophilus influenzae NT127]
 gi|260095162|gb|EEW79053.1| conserved hypothetical protein [Haemophilus influenzae NT127]
          Length = 281

 Score =  234 bits (596), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 30  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 88

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 89  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 146

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 147 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 206

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 207 GSAIAIGHPRQNTIAVLQAGLRNLPE-DIQLVGMGNLWR 244


>gi|331017072|gb|EGH97128.1| hypothetical protein PLA106_13587 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 260

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 98/228 (42%), Gaps = 7/228 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
               S A + +++  LG +     R    LP  +TLA   +      + +EA + G+  I
Sbjct: 25  AEKTSKAYLTLIIDDLGQNPVRDSRT-LALPGPVTLAIMPDTPHATEFAREAHRAGKTVI 83

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +
Sbjct: 84  LHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVA 137

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+  
Sbjct: 138 MTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRICLASVSRDVFLDDERTAEAITRQLQTA 197

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++A+  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 198 IKLAQKHGSAVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSMISER 245


>gi|83644204|ref|YP_432639.1| hypothetical protein HCH_01349 [Hahella chejuensis KCTC 2396]
 gi|83632247|gb|ABC28214.1| uncharacterized protein conserved in bacteria [Hahella chejuensis
           KCTC 2396]
          Length = 286

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 53/261 (20%), Positives = 107/261 (40%), Gaps = 6/261 (2%)

Query: 135 LILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLL 194
                 +  +    +       + +             IAI++  +G  Q   +RAI  +
Sbjct: 4   TAANAEESAIAEPAQAAVTPAIINST---GAGEDHPPTIAIIIDDMGNYQNMGERAI-RI 59

Query: 195 PANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLL 254
           PA +TL+F       +   + A   G+E +L IPM+  +       +  L    + Q ++
Sbjct: 60  PAPLTLSFLPFRPHTNSQARLAYAAGKEIMLHIPME--NVKRIPLGASGLTSDMSSQNMV 117

Query: 255 NRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLA 314
              R +++      GV N+ G+ L  N+ +  ++  E     L F D  ++  ++   +A
Sbjct: 118 ATFRQAIKAIPYVSGVNNHMGSALTQNRAAMNLVMGELQGYPLYFVDSRTTASSVAHAVA 177

Query: 315 PKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
               +P +  D++LD  +    I  + K L +IAR  G AI +     E+IE + + L  
Sbjct: 178 ANHAIPTLNRDVFLDHVITTKAIDFQFKRLLDIARKKGTAIAIGHPHRETIEYLEKVLPS 237

Query: 375 EHVRDVSVVPLSCLAKLSSPS 395
              + V++  +  L  + + +
Sbjct: 238 LGEQGVAIATIKGLWAIRNNA 258


>gi|330987186|gb|EGH85289.1| yibQ gene product [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 260

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 98/226 (43%), Gaps = 7/226 (3%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
               A +++++  LG +     R    LP  +TLA   +      + +EA + G+  +L 
Sbjct: 27  KPPKAYLSLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREAHRAGKTVMLH 85

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +  
Sbjct: 86  MPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMA 139

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+   +
Sbjct: 140 WLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAINRQLQSAIK 199

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           IAR  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 200 IARKHGSAVVIGHPYPVTLDVLERELPKLKDQGVEWIDLRSMISER 245


>gi|289649391|ref|ZP_06480734.1| yibQ gene product [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 260

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 47/236 (19%), Positives = 99/236 (41%), Gaps = 7/236 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A           A +++++  LG +     R    LP  +TLA   +      + +EA
Sbjct: 17  AHAAPAEDNGKPPKAYLSLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            + G+  +L +PM            Y       + +L +RL  +L +     G+ N+ G+
Sbjct: 76  HRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGS 129

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + 
Sbjct: 130 RMTAEPVAMAWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEA 189

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I  +L+   +IAR  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 190 INRQLQSAIKIARKHGSAVVIGHPYPVTLDVLERELPKLKDQGVEWIDLRSMISER 245


>gi|152978251|ref|YP_001343880.1| protein of unknown function DUF610 YibQ [Actinobacillus
           succinogenes 130Z]
 gi|150839974|gb|ABR73945.1| protein of unknown function DUF610 YibQ [Actinobacillus
           succinogenes 130Z]
          Length = 294

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 40/224 (17%), Positives = 100/224 (44%), Gaps = 4/224 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A   ++AIV+  +G         I  +P  +++A         +  ++A ++G++ ++ 
Sbjct: 38  AAQPHKLAIVIDDIGY-HPKEDAQILAMPKAVSVAIIPVAPYAAQRNRQAWQQGRDILIH 96

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQ  +    E+    L V  + Q++  R++ + +  +   G+ N+ G+   ++     
Sbjct: 97  MPMQPVNNMKIEEG--GLSVGMSQQEVEQRVQRAKQIVSHAIGMNNHMGSAATADPTLMT 154

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +   ++GL F D  +  +++   +A    +  +   ++LDD  +   ++ + +   +
Sbjct: 155 RLMRILQRQGLFFLDSRTIGKSVAGKIAKLEGVSVLERHVFLDDSDNFGDVQRQFQRALQ 214

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AR  G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 215 HARQHGVAIVIGHPRKNTIAVLQAELRHLPA-DIQLVGMGQLWR 257


>gi|312958445|ref|ZP_07772965.1| protein of unknown function DUF610 [Pseudomonas fluorescens WH6]
 gi|311286988|gb|EFQ65549.1| protein of unknown function DUF610 [Pseudomonas fluorescens WH6]
          Length = 257

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 44/232 (18%), Positives = 94/232 (40%), Gaps = 7/232 (3%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
                    A + +++  LG +     R +  LP  +T A   +      + +EA K G+
Sbjct: 19  ATPAGEPHKAYLTLIIDDLGQNLPR-DRRVLALPGPVTTAIMPDTPHAAEFAREAHKAGK 77

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
             IL +PM            +      +V+ L  RL  +        G+ N+ G+ + + 
Sbjct: 78  IVILHMPMDPAT------GPFAWHPELSVEDLGKRLDAAFTAVPYTAGINNHMGSRMTAQ 131

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
             +   +  E  +R   F D  +S + +    A K+ L  +  D++LDD+     I  +L
Sbjct: 132 PAAMAWLMAELQRRHKFFVDSRTSAQTVAAAEAQKIGLASVSRDVFLDDERTEAAITTQL 191

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           +   ++A   G A+ +   + +++ V+ + L +   + V  + +  +  + S
Sbjct: 192 QTAIKLAHKQGSAVMIGHPYPQTLAVLERELPKLKAQGVEWIDIKLMISVRS 243


>gi|319775305|ref|YP_004137793.1| hypothetical protein HICON_06450 [Haemophilus influenzae F3047]
 gi|317449896|emb|CBY86108.1| conserved hypothetical protein [Haemophilus influenzae F3047]
          Length = 280

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  ISAIKIEDG--GLHLGMSAAQVNDRVNTAKSIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFSDVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRQNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|229095918|ref|ZP_04226896.1| hypothetical protein bcere0020_11690 [Bacillus cereus Rock3-29]
 gi|229114870|ref|ZP_04244283.1| hypothetical protein bcere0017_11670 [Bacillus cereus Rock1-3]
 gi|228668562|gb|EEL23991.1| hypothetical protein bcere0017_11670 [Bacillus cereus Rock1-3]
 gi|228687542|gb|EEL41442.1| hypothetical protein bcere0020_11690 [Bacillus cereus Rock3-29]
          Length = 256

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 47/230 (20%), Positives = 95/230 (41%), Gaps = 5/230 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              +NA   ++AIV+   G +  GT + +  LP  +T+A      S       A KKG E
Sbjct: 21  PIQANAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAAHKKGHE 79

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+             L    + +++ NRL  +++      G+ N+ G+ + +++
Sbjct: 80  VIIHMPMEPIKGKKEWLGPKALTTDLSDEEINNRLEQAIKEVPHAIGMNNHMGSKVTADE 139

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ +
Sbjct: 140 RIVRLILTACKKHGLFYLDSKTNPNSVVPQIGKELGVPIIENQLFFDDVYTAGHISKQAQ 199

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLA 389
            L +  +     + +         +  VI   + +        + LS LA
Sbjct: 200 LLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLA 248


>gi|308068509|ref|YP_003870114.1| hypothetical protein PPE_01740 [Paenibacillus polymyxa E681]
 gi|305857788|gb|ADM69576.1| Polysacc_deac_2 domain containing protein [Paenibacillus polymyxa
           E681]
          Length = 311

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 95/238 (39%), Gaps = 8/238 (3%)

Query: 156 EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
              A+DK          +A+++  LG +  GT   I  LP  IT+A      +  +   E
Sbjct: 59  VAKALDKQDVPQKM---VAVIIDDLGNNMKGT-EQILNLPVKITVAVMPFLPTTKQDAME 114

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A K+G + I+ +PM+             +K   T +++  ++  +++      G+ N+ G
Sbjct: 115 AHKRGHDVIVHLPMEPKQGKPEWLGPGAIKANMTDEEVRAKVTAAIKDVPYAIGMNNHMG 174

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           + + S+K    ++     + GL F D  ++  ++   LA K  +P +  D++LDD     
Sbjct: 175 SKVTSDKRIMSIVLDVCKEHGLFFVDSRTNYWSVVPELAAKKGMPPVRNDVFLDDVHTLA 234

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDE---SIEVISQWLQQEHVRDVSVVPLSCLAK 390
            +  +L  + E        + +         +   +   + +        V +S L +
Sbjct: 235 HVNRQLTKVVEWLDEHNTCVTIGHVGVSGMYTSSALHSSVPKLKEHA-KFVGISDLVR 291


>gi|145638449|ref|ZP_01794059.1| hypothetical protein CGSHiII_06744 [Haemophilus influenzae PittII]
 gi|145272778|gb|EDK12685.1| hypothetical protein CGSHiII_06744 [Haemophilus influenzae PittII]
 gi|309751584|gb|ADO81568.1| Conserved hypothetical protein [Haemophilus influenzae R2866]
          Length = 280

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRQNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|52426374|ref|YP_089511.1| hypothetical protein MS2319 [Mannheimia succiniciproducens MBEL55E]
 gi|52308426|gb|AAU38926.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 281

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 45/227 (19%), Positives = 98/227 (43%), Gaps = 4/227 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
            A  A++AIV+  LG        AI  +P  I++A   +     +  + A ++G++ ++ 
Sbjct: 25  PAFSAKLAIVIDDLGY-HPREDAAILAMPKEISVAIIPSAPYARQRNQLAYEQGRDILIH 83

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PMQ   +   E     L +    QQ+ + ++ +    +   G+ N+ G+   +++    
Sbjct: 84  MPMQPISQMNIEAG--GLSIGMDAQQVAHNVQQAKNIVSHAIGMNNHMGSAATADRPLMT 141

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E  K+ L F D  +  R++   +A +  +  +   ++LDD      ++ + +    
Sbjct: 142 ELMAELRKQHLFFLDSRTIGRSVAEKIAKESGVRALQRHIFLDDSDVYGDVQRQFQQAIH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            AR  G AI +      ++ V+ Q L      D+ +V +  L +   
Sbjct: 202 YARKHGTAIVIGHPRKNTVAVLRQGLANLPP-DIQLVSMGSLWRDEK 247


>gi|148827945|ref|YP_001292698.1| hypothetical protein CGSHiGG_07270 [Haemophilus influenzae PittGG]
 gi|148719187|gb|ABR00315.1| hypothetical protein CGSHiGG_07270 [Haemophilus influenzae PittGG]
          Length = 280

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 42/219 (19%), Positives = 95/219 (43%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G   +    A+  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGY-HSKEDAAVFAMPREISVAIIPAAPYARVRNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  ISAIKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRPNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|75759334|ref|ZP_00739431.1| Hypothetical exported protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218896364|ref|YP_002444775.1| hypothetical protein BCG9842_B3959 [Bacillus cereus G9842]
 gi|228900013|ref|ZP_04064249.1| hypothetical protein bthur0014_12220 [Bacillus thuringiensis IBL
           4222]
 gi|74493166|gb|EAO56285.1| Hypothetical exported protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|218540741|gb|ACK93135.1| conserved hypothetical protein [Bacillus cereus G9842]
 gi|228859627|gb|EEN04051.1| hypothetical protein bthur0014_12220 [Bacillus thuringiensis IBL
           4222]
          Length = 256

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|330961870|gb|EGH62130.1| hypothetical protein PMA4326_25287 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 258

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 97/226 (42%), Gaps = 7/226 (3%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
             + A +++++  LG +     R    LP  +TLA   +      + ++A + G+  +L 
Sbjct: 27  KPAKAYLSLIIDDLGQNPERDSRT-LALPGPVTLAIMPDTPHATDFARQAHRAGKTVMLH 85

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +  
Sbjct: 86  MPMDPAT------GPYAWHPELPLAELESRLNAALLKVPYAAGINNHMGSRMTAEPVAMA 139

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E  +R L F D  +S + +    A +  L  +  D++LDD+   + I  +L+   +
Sbjct: 140 WLMAELQRRHLFFVDSRTSAKTVAAAEAQRAGLASVSRDVFLDDERTAEAITRQLQTAVK 199

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +A   G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 200 LAHKQGSAVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSMISER 245


>gi|332139955|ref|YP_004425693.1| hypothetical protein MADE_1002730 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549977|gb|AEA96695.1| hypothetical protein MADE_1002730 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 313

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 40/216 (18%), Positives = 93/216 (43%), Gaps = 4/216 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
            + I I++  LG     +  A   LP  +T +            + A+K+G+  +L +PM
Sbjct: 25  KSDIIIILDDLGYRP--SDIAAFSLPKEVTFSILPQTPLASEIAQRAEKEGRAVMLHMPM 82

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           QA +          L        + + +R +++      G+ N+ G+     +E+ E + 
Sbjct: 83  QAQNGK--NMGPLGLSTDMYAGAITHNVRRAMKSVPNAVGINNHMGSAFTGQREAMEALL 140

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           KE  ++GL F D  ++  +  + +A +L +P     ++LD +++   + ++   ++ IA+
Sbjct: 141 KEVKRQGLFFVDSRTTVLSKGKEIAEQLGVPNASRQVFLDHRLEPAFLLQQFNEMKRIAK 200

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
             G+ + +      +I+ +   L        S+  +
Sbjct: 201 REGRVLVIGHPHPATIDFLQTHLPLLEKEGFSLASV 236


>gi|48243737|gb|AAT40842.1| hypothetical protein [Haemophilus influenzae]
          Length = 280

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 43/219 (19%), Positives = 94/219 (42%), Gaps = 4/219 (1%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+  +G        AI  +P  I++A            +EAK +G++ ++ +PMQ 
Sbjct: 29  KLAIVIDDVGYHLKE-DAAIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQP 87

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                 ED    L +  +  Q+ +R+  +        G+ N+ G+   ++ +    +   
Sbjct: 88  VSAVKIEDG--GLHLGMSAAQVNDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTA 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L F D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  
Sbjct: 146 LQEKHLFFLDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKH 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           G AI +      +I V+   L+     D+ +V +  L +
Sbjct: 206 GSAIAIGHPRQNTIAVLQAGLRNLPE-DIQLVGMGNLWR 243


>gi|269140804|ref|YP_003297505.1| hypothetical protein ETAE_3463 [Edwardsiella tarda EIB202]
 gi|267986465|gb|ACY86294.1| hypothetical protein ETAE_3463 [Edwardsiella tarda EIB202]
 gi|304560564|gb|ADM43228.1| Putative periplasmic protein [Edwardsiella tarda FL6-60]
          Length = 309

 Score =  233 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 89/220 (40%), Gaps = 5/220 (2%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           IV+   G  +   +  +  +P  +T+A   N          A  +G+E ++ +PM    +
Sbjct: 28  IVIDDFGY-RPREESQVLEMPLPVTIAVLPNAPHAREMALRAHAQGREILIHLPMAPISK 86

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              E    TL+ T +  ++   +R ++       G+ N+ G+ + S+    + + +   +
Sbjct: 87  QPLE--RDTLQPTMSEAEIQRIIRQAVGNVPYAVGMNNHMGSAMTSSLSGMQKVMRALEQ 144

Query: 295 RG-LLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
              L F D  +   +     A    +  +   ++LDD  +   IR +      +AR  G 
Sbjct: 145 YHFLYFLDSMTIGHSQVSNAALGTGIKVIKRKVFLDDAQNESAIRTQFNRAITLARRNGS 204

Query: 354 AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AI +      ++ V+ Q L+     D+ +V  S L   ++
Sbjct: 205 AIAIGHPHPATVRVLQQMLRTLPP-DIVLVRPSALLNEAT 243


>gi|323137511|ref|ZP_08072588.1| protein of unknown function DUF610 YibQ [Methylocystis sp. ATCC
           49242]
 gi|322397137|gb|EFX99661.1| protein of unknown function DUF610 YibQ [Methylocystis sp. ATCC
           49242]
          Length = 413

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 98/402 (24%), Positives = 165/402 (41%), Gaps = 9/402 (2%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M+ +LN PL     + K   ++     G        I  L++Y+       G     +  
Sbjct: 1   MTDELNAPLGSGASRPKPAVAKPRRAFGAAAGGLVAIGALALYLA-PRDPYGGEPHAVAR 59

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSK-----RDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
               +       +P                R+  +  ++ +  S     +      G   
Sbjct: 60  IEPAKAPEPAPPLPPVAVAAAGEPAPPPAGREQISTVSEFEQLSGVKVTRSGASEGGTAR 119

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRED--TEVPAMDKNFCSNASGARI 173
           + +    + +   P  + R++       L      G                  A   RI
Sbjct: 120 IIRIEPPSGVRLTPAPDRRVVEKGRYGLLPKIGADGARPMDVYARPFVTAPSLKADAPRI 179

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           A+V+ GLG++   +  AI+ LP  +TLAFA  G  LDR +  A+ +G EA+LQ PM+ FD
Sbjct: 180 ALVIGGLGLNAATSADAIDQLPEGVTLAFAPYGAELDRLVASARARGHEALLQAPMEPFD 239

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
              N    +TL          + L++ + R +GY GVMNY G    +++++      E A
Sbjct: 240 YPQNNPGPHTLVTGAPDGG-ADDLQWLMSRFSGYAGVMNYLGGRYTADEQALSGALAEIA 298

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
           +RGL F DD ++P++L   LAPK +LP+   D+ +D +     I   L  LE  AR  G 
Sbjct: 299 QRGLFFLDDRAAPQSLITALAPKFSLPHAKVDVVIDARNTPQSIDAALAQLETQARDKGV 358

Query: 354 AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           AIG A A   +I  ++++ +    R +++ P+S        S
Sbjct: 359 AIGFANAVPATISRVARFARDLERRGIALAPVSAALAPRGAS 400


>gi|34558176|ref|NP_907991.1| putative periplasmic protein [Wolinella succinogenes DSM 1740]
 gi|34483895|emb|CAE10891.1| PUTATIVE PERIPLASMIC PROTEIN [Wolinella succinogenes]
          Length = 366

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 60/379 (15%), Positives = 132/379 (34%), Gaps = 16/379 (4%)

Query: 12  KTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPL 71
           K P+  S       ++   +LF   I  L + I   +A     S   P   +      P 
Sbjct: 3   KNPRTASNPKNSPRKIDKGILFAIIISALLLGIFGGYALFNAFSAPAPKEKLEHP-KFPP 61

Query: 72  TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTI 131
             P   +   SP   +  T     +    ++   ++   S   +  +   +    S    
Sbjct: 62  ATPPKAQISPSPLAPEPKT-----EQLIDKNLALLEELASKN-LPKEEPHTPPSLSNEPD 115

Query: 132 EERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAI 191
           +  L+      ++           + P          S  R+AI++  +G         I
Sbjct: 116 KLALLTPAPPPKVSE--PQTLLAPKKPKAAPLALPLGSKPRLAIIIDDVGF--MPQAEEI 171

Query: 192 NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQ 251
             LP  +T +    G    +  + AK+     ++ +P++A +    E     L++    +
Sbjct: 172 KKLPFRVTPSIFPKGKFNPKSHEIAKEFDF-FMVHLPLEAREFYQKE--HEWLRIEDKEE 228

Query: 252 QLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
           ++  +++   R       + N+ G+    N  +     K   +  L F D  ++P +   
Sbjct: 229 KIEAKIKALKRDFPRLTHLNNHTGSKFTENLPAMRRFLKVLEEENLTFVDSRTTPYSKAP 288

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
            +  +     +  D++LD++     I+++L+   +IA+  G AI +     E+ + + + 
Sbjct: 289 QIFEEEGKLLLSRDVFLDNERSISYIKKQLQEAVKIAKKRGYAIAIGHPHAETFQAL-RG 347

Query: 372 LQQEHVRDVSVVPLSCLAK 390
                   V  V +  L K
Sbjct: 348 SSHLKEE-VEFVYVKDLFK 365


>gi|310765988|gb|ADP10938.1| conserved uncharacterized protein YigQ [Erwinia sp. Ejp617]
          Length = 304

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 92/231 (39%), Gaps = 4/231 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G      Q+ +  +PA I++A   N         +A + G E 
Sbjct: 16  IASPAWAGKLSIVIDDFGYRPALEQQ-VLQMPAAISVAVLPNAPHAREMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+   + +++   +R +        G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLE--KDTLRPDMSTEEIGRIIREAAAAVPYAVGLNNHMGSAMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +        F D  +   +     A   N+  +   ++LDD  +   IR +   
Sbjct: 133 AMQKVMQILNHYHFYFLDSMTIGNSQATRAAEGTNVKVVKRRVFLDDSQNEADIRVQFTR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
              +A+  G AI +      ++ V+ Q L      D+ +   S L   + P
Sbjct: 193 AVRLAQRDGSAIAIGHPHPSTVRVLQQMLPGLPA-DIILARPSQLLNAAQP 242


>gi|229102031|ref|ZP_04232744.1| hypothetical protein bcere0019_11960 [Bacillus cereus Rock3-28]
 gi|228681418|gb|EEL35582.1| hypothetical protein bcere0019_11960 [Bacillus cereus Rock3-28]
          Length = 256

 Score =  233 bits (593), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 48/236 (20%), Positives = 98/236 (41%), Gaps = 5/236 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             L    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKALTTDLSDEEINNRLEQAIKEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILTACKKHGLFYLDSKTNPNSVVPQIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLA 389
           I ++ + L +  +     + +         +  VI   + +        + LS LA
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLA 248


>gi|229043173|ref|ZP_04190897.1| hypothetical protein bcere0027_12270 [Bacillus cereus AH676]
 gi|228726180|gb|EEL77413.1| hypothetical protein bcere0027_12270 [Bacillus cereus AH676]
          Length = 256

 Score =  232 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAIMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|229108888|ref|ZP_04238492.1| hypothetical protein bcere0018_11640 [Bacillus cereus Rock1-15]
 gi|228674544|gb|EEL29784.1| hypothetical protein bcere0018_11640 [Bacillus cereus Rock1-15]
          Length = 256

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KITADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|30019484|ref|NP_831115.1| hypothetical protein BC1334 [Bacillus cereus ATCC 14579]
 gi|206967544|ref|ZP_03228500.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|228907064|ref|ZP_04070928.1| hypothetical protein bthur0013_12370 [Bacillus thuringiensis IBL
           200]
 gi|228951813|ref|ZP_04113911.1| hypothetical protein bthur0006_12270 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228957703|ref|ZP_04119448.1| hypothetical protein bthur0005_12190 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|229068983|ref|ZP_04202276.1| hypothetical protein bcere0025_11910 [Bacillus cereus F65185]
 gi|229078617|ref|ZP_04211174.1| hypothetical protein bcere0023_12820 [Bacillus cereus Rock4-2]
 gi|229126748|ref|ZP_04255760.1| hypothetical protein bcere0015_12050 [Bacillus cereus BDRD-Cer4]
 gi|229144036|ref|ZP_04272452.1| hypothetical protein bcere0012_11990 [Bacillus cereus BDRD-ST24]
 gi|229177839|ref|ZP_04305212.1| hypothetical protein bcere0005_12030 [Bacillus cereus 172560W]
 gi|229189514|ref|ZP_04316530.1| hypothetical protein bcere0002_11930 [Bacillus cereus ATCC 10876]
 gi|296502013|ref|YP_003663713.1| hypothetical protein BMB171_C1177 [Bacillus thuringiensis BMB171]
 gi|29895028|gb|AAP08316.1| hypothetical Exported Protein [Bacillus cereus ATCC 14579]
 gi|206736464|gb|EDZ53611.1| conserved hypothetical protein [Bacillus cereus AH1134]
 gi|228593959|gb|EEK51762.1| hypothetical protein bcere0002_11930 [Bacillus cereus ATCC 10876]
 gi|228605630|gb|EEK63078.1| hypothetical protein bcere0005_12030 [Bacillus cereus 172560W]
 gi|228639433|gb|EEK95847.1| hypothetical protein bcere0012_11990 [Bacillus cereus BDRD-ST24]
 gi|228656688|gb|EEL12514.1| hypothetical protein bcere0015_12050 [Bacillus cereus BDRD-Cer4]
 gi|228704687|gb|EEL57116.1| hypothetical protein bcere0023_12820 [Bacillus cereus Rock4-2]
 gi|228714095|gb|EEL65977.1| hypothetical protein bcere0025_11910 [Bacillus cereus F65185]
 gi|228801975|gb|EEM48847.1| hypothetical protein bthur0005_12190 [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228807736|gb|EEM54257.1| hypothetical protein bthur0006_12270 [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228852568|gb|EEM97358.1| hypothetical protein bthur0013_12370 [Bacillus thuringiensis IBL
           200]
 gi|296323065|gb|ADH05993.1| hypothetical protein BMB171_C1177 [Bacillus thuringiensis BMB171]
          Length = 256

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|228920144|ref|ZP_04083493.1| hypothetical protein bthur0011_11610 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228839600|gb|EEM84892.1| hypothetical protein bthur0011_11610 [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
          Length = 256

 Score =  232 bits (591), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTARH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|332703283|ref|ZP_08423371.1| protein of unknown function DUF610 YibQ [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553432|gb|EGJ50476.1| protein of unknown function DUF610 YibQ [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 505

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 50/222 (22%), Positives = 98/222 (44%), Gaps = 2/222 (0%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
            + AR+AIV+  LG S       ++ L   +  A   + ++  R    A+K   E +L  
Sbjct: 216 GAKARLAIVIDDLGESVEFASN-LSRLGIPVAFAIWPSASNSQRIAALARKAHMEVLLHQ 274

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+      ++     + ++     +   +  +L       G+ N+ G+    ++    V
Sbjct: 275 PMEPRSYPEDDPGKGAMFISMNEAAIRAVIMENLAHFPMAVGLNNHMGSRFTEDRRGMSV 334

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  E   RGL + D  +S +++   +  K   P +  D++LD+  D D I  +L+  E +
Sbjct: 335 VMDELRSRGLFYLDSMTSAKSVGTSVGKKAGTPVLRRDVFLDNVADVDAIFLQLRKAENV 394

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           A   G+A+ +   + E+++ +  W+ Q   R V  V LS L 
Sbjct: 395 ALKHGKAVAIGHPYPETLQALRTWVAQRDTR-VEAVTLSSLL 435


>gi|325289668|ref|YP_004265849.1| protein of unknown function DUF610 YibQ [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324965069|gb|ADY55848.1| protein of unknown function DUF610 YibQ [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 282

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 42/240 (17%), Positives = 96/240 (40%), Gaps = 7/240 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
               D+   +     +IA+++   G ++ G    I  +  ++T A             EA
Sbjct: 44  SNDSDEAVNAGKGKPKIAVIIDDFGEARDGVNE-IMKIKKHLTFAVMPFLTYTTSDATEA 102

Query: 217 KKKGQEAILQIPMQAFDESY-NEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
            K+G E I+ +PMQ+      N      + +  +  ++    + S+       GV  + G
Sbjct: 103 HKRGYEVIVHMPMQSQTVDNINWLGRRPIMLKTSNDEIKKIAKESIDSVPHAVGVNIHMG 162

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD-QVDR 334
           ++   N+     + +    R L F D  ++P  + + +A +  + ++  +++L+     +
Sbjct: 163 SLASQNERVISNVMEVVKARNLYFVDSRTTPNTVCKAVAKRFGVKFLQRNIFLEHSSKTK 222

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAK 390
             I  +L    E+A   G A+ +     E    + +V+ + + +   + +  V  S L K
Sbjct: 223 GYIEGQLVEAGELALKEGYAVVIGHVGAEGGAITAQVLEEMIPKLESKGIEFVYASELLK 282


>gi|188532247|ref|YP_001906044.1| Putative periplasmic protein of unknown function [Erwinia
           tasmaniensis Et1/99]
 gi|188027289|emb|CAO95132.1| Putative periplasmic protein of unknown function [Erwinia
           tasmaniensis Et1/99]
          Length = 310

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 43/229 (18%), Positives = 92/229 (40%), Gaps = 4/229 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A    ++IV+   G   T  ++ +  +PA I++A   N         +A + G E 
Sbjct: 18  ITSPAWAGNLSIVIDDFGYRPT-QEQQVLQMPAAISVAVLPNAPHAREMATKAHQSGHEV 76

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+   + +++   +R +        G+ N+ G+ + S+  
Sbjct: 77  LIHLPMAPLSKQPLE--KDTLRPDMSAEEIARIIREAAAAVPYAVGLNNHMGSAMTSSLP 134

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             + + +  +     F D  +   +     A    +  +   ++LDD  +   IR +   
Sbjct: 135 GMQKVMQVLSHYNFYFLDSMTIGNSQASRAAAGTGVKVVKRRVFLDDSQNEADIRVQFAR 194

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
              +A+  G AI +      ++ V+ Q L      D+++V  S L   +
Sbjct: 195 AVHLAQRDGSAIAIGHPHPSTVRVLQQMLPTLPA-DITLVRPSQLLNEA 242


>gi|163939239|ref|YP_001644123.1| protein of unknown function DUF610 YibQ [Bacillus
           weihenstephanensis KBAB4]
 gi|229010728|ref|ZP_04167925.1| hypothetical protein bmyco0001_11830 [Bacillus mycoides DSM 2048]
 gi|229166266|ref|ZP_04294025.1| hypothetical protein bcere0007_12400 [Bacillus cereus AH621]
 gi|163861436|gb|ABY42495.1| protein of unknown function DUF610 YibQ [Bacillus
           weihenstephanensis KBAB4]
 gi|228617211|gb|EEK74277.1| hypothetical protein bcere0007_12400 [Bacillus cereus AH621]
 gi|228750402|gb|EEM00231.1| hypothetical protein bmyco0001_11830 [Bacillus mycoides DSM 2048]
          Length = 256

 Score =  231 bits (590), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 49/236 (20%), Positives = 101/236 (42%), Gaps = 6/236 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              +NA   ++AIV+   G +  GT + +  LP  +T+A      S  +    A KKG E
Sbjct: 21  PIQANAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKQDAIAAHKKGHE 79

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++
Sbjct: 80  VIIHMPMEPIRGKKEWLGPKAITTDLSDEEINNRLEQAIQEIPHAIGMNNHMGSKVTADE 139

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ +
Sbjct: 140 RIVRLILSACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTVSHISKQAQ 199

Query: 343 GLEEIARTTGQAIGVAV---AFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            L +  +     + +       + +  +I   + +        + LS LA LS PS
Sbjct: 200 LLIKKIQDKPIMVAIGHVGAPGEITSRIIETSIPKIREHA-DFIFLSDLA-LSPPS 253


>gi|229149633|ref|ZP_04277864.1| hypothetical protein bcere0011_11920 [Bacillus cereus m1550]
 gi|228633843|gb|EEK90441.1| hypothetical protein bcere0011_11920 [Bacillus cereus m1550]
          Length = 256

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|229160384|ref|ZP_04288382.1| hypothetical protein bcere0009_11780 [Bacillus cereus R309803]
 gi|228623108|gb|EEK79936.1| hypothetical protein bcere0009_11780 [Bacillus cereus R309803]
          Length = 244

 Score =  231 bits (589), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 48/237 (20%), Positives = 97/237 (40%), Gaps = 5/237 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              +NA   ++AIV+   G +  GT + +  LP  +T+A      S       A KKG E
Sbjct: 9   PIQANAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAAHKKGHE 67

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            I+ +PM+             +    + +++ NRL  +++      G+ N+ G+ + +++
Sbjct: 68  VIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADE 127

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
               +I     K GL + D  ++P ++   +  +L +P +   L+ DD      I ++ +
Sbjct: 128 RIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGHISKQAQ 187

Query: 343 GLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
            L +  +     + +         +  VI   + +        + LS LA    P S
Sbjct: 188 LLIKKIQEKPIMVAIGHVGPPGEITSNVIETSIPKIREHA-DFIFLSDLALSPPPVS 243


>gi|330891664|gb|EGH24325.1| YibO protein [Pseudomonas syringae pv. mori str. 301020]
          Length = 260

 Score =  231 bits (589), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 46/236 (19%), Positives = 97/236 (41%), Gaps = 7/236 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A           A + +++  LG +     R    LP  +TLA   +      + +EA
Sbjct: 17  AHAAPAEDNGKPPKAYLNLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            + G+  +L +PM            Y       + +L +RL  +L +     G+ N+ G+
Sbjct: 76  HRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGS 129

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +  L F D  +S + +    A ++ L  +  D++LDD+   + 
Sbjct: 130 RMTAEPVAMAWLMAELQRCHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEA 189

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I  +L+   +IAR  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 190 INRQLQSAIKIARKHGSAVVIGHPYPVTLDVLERELPKLKDQGVEWIDLRSMISER 245


>gi|315497340|ref|YP_004086144.1| hypothetical protein Astex_0295 [Asticcacaulis excentricus CB 48]
 gi|315415352|gb|ADU11993.1| protein of unknown function DUF610 YibQ [Asticcacaulis excentricus
           CB 48]
          Length = 410

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 82/405 (20%), Positives = 144/405 (35%), Gaps = 27/405 (6%)

Query: 6   NHPLRKKTPKRKSFYSQIISR--------LGLFLLFCTFIVGLSIYILISHAFVGTISEM 57
           N PL +K+    S    I               L+     +G     L           +
Sbjct: 12  NSPLFRKSGGLMSRVKNIGPATLDILKKPYTAPLMALGLFIGGGALFLSLSDPEAGNPTI 71

Query: 58  IPYSVIREIAPIPLTIPLNIEDKQSPSKRDN---NTVCNQLKNDSSQHDGQIQNDISGKT 114
              +            P       + S       +++       + Q +   +   +  T
Sbjct: 72  QIAAATTAAPKADAHAPDIATADDAASGLQAFTLDSLGLFKDASADQFNANGEAGPADGT 131

Query: 115 VVNKPTRSTSI---DSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG- 170
            +       +     S   +    +       L      G              + A   
Sbjct: 132 AIITLPSDGAPVTVGSASKLPASPLAPAPIAGLSQNGPNGPLPAIATDGRVPASAYARPF 191

Query: 171 -----ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
                  ++++V GLG++ T T+ AI  LPA +TL+F  +   L  W+  A+ +G E ++
Sbjct: 192 KSNGKPMVSLIVGGLGLNPTTTKAAIEQLPAEVTLSFVPHAEGLQGWIDAARAQGHEVLI 251

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
           +IPM+  +    +    TL V Q    +   L + + R TGYFGVMNY+G+  L +K S 
Sbjct: 252 EIPMEPTNYPDTDPGPRTLLVGQRPDDMNASLNWLMARATGYFGVMNYQGSAYLRDKGSM 311

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
                    RGL F DDG +                  AD  +D Q++   I  +L  +E
Sbjct: 312 TAFLNVMKARGLAFIDDGQARD-------VGGGWTRASADRVIDAQINSQSINAQLAAIE 364

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             A+  G+A+G   A+  ++ V  +W Q    + + + P S + +
Sbjct: 365 AQAKARGRALGSGFAYPVTLAVAIKWTQSLEQKGLQLAPASAIMR 409


>gi|218235875|ref|YP_002366115.1| hypothetical protein BCB4264_A1385 [Bacillus cereus B4264]
 gi|218163832|gb|ACK63824.1| conserved hypothetical protein [Bacillus cereus B4264]
          Length = 256

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 98/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQATAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|324325449|gb|ADY20709.1| divergent polysaccharide deacetylase [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 256

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVEAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPLKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|117625892|ref|YP_859215.1| polysaccharide deacetylase [Escherichia coli APEC O1]
 gi|115515016|gb|ABJ03091.1| predicted polysaccharide deacetylase [Escherichia coli APEC O1]
          Length = 277

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRMQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|170719593|ref|YP_001747281.1| hypothetical protein PputW619_0406 [Pseudomonas putida W619]
 gi|169757596|gb|ACA70912.1| protein of unknown function DUF610 YibQ [Pseudomonas putida W619]
          Length = 259

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 46/217 (21%), Positives = 96/217 (44%), Gaps = 7/217 (3%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           ++I++  LG S     R    LP  +T+A   +      + ++A K G+  IL +PM   
Sbjct: 30  MSIIIDDLGQSTERDSRT-LALPGPVTMAIMPDTPHASEFARQAHKAGKTVILHMPMDPA 88

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
                    Y       + +L  RL  +L +     G+ N+ G+ + + + +   +  E 
Sbjct: 89  T------GPYAWHPDIALPELARRLDAALAKVPYAAGINNHMGSRMTAQRGAMTWLMGEL 142

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            +R L F D  +S   +    A    L ++  D++LDD    + I  +L+    +AR  G
Sbjct: 143 QRRHLFFVDSRTSAATVAAAEAQAQALGHVSRDVFLDDVRTTEAITTQLQQGVALARRQG 202

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            A+ +   + ++++V+ Q + +   + + +V L+ + 
Sbjct: 203 SAVLIGHPYPQTLQVLEQEMPRLRSQGIELVTLTQMI 239


>gi|229172071|ref|ZP_04299636.1| hypothetical protein bcere0006_11850 [Bacillus cereus MM3]
 gi|228611414|gb|EEK68671.1| hypothetical protein bcere0006_11850 [Bacillus cereus MM3]
          Length = 256

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|206977562|ref|ZP_03238456.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217958908|ref|YP_002337456.1| hypothetical protein BCAH187_A1488 [Bacillus cereus AH187]
 gi|229138118|ref|ZP_04266716.1| hypothetical protein bcere0013_12420 [Bacillus cereus BDRD-ST26]
 gi|206744280|gb|EDZ55693.1| conserved hypothetical protein [Bacillus cereus H3081.97]
 gi|217063675|gb|ACJ77925.1| conserved hypothetical protein [Bacillus cereus AH187]
 gi|228645463|gb|EEL01697.1| hypothetical protein bcere0013_12420 [Bacillus cereus BDRD-ST26]
          Length = 256

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVEAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|49479759|ref|YP_035558.1| divergent polysaccharide deacetylase [Bacillus thuringiensis
           serovar konkukian str. 97-27]
 gi|49331315|gb|AAT61961.1| conserved hypothetical protein, possible divergent polysaccharide
           deacetylase [Bacillus thuringiensis serovar konkukian
           str. 97-27]
          Length = 259

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPVKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|46143439|ref|ZP_00204471.1| COG2861: Uncharacterized protein conserved in bacteria
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208306|ref|YP_001053531.1| hypothetical protein APL_0830 [Actinobacillus pleuropneumoniae L20]
 gi|307247817|ref|ZP_07529853.1| hypothetical protein appser2_8060 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250063|ref|ZP_07532027.1| hypothetical protein appser4_8510 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307256881|ref|ZP_07538659.1| hypothetical protein appser10_8850 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307261313|ref|ZP_07542988.1| hypothetical protein appser12_8790 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|126097098|gb|ABN73926.1| hypothetical protein APL_0830 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306855619|gb|EFM87786.1| hypothetical protein appser2_8060 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857923|gb|EFM90015.1| hypothetical protein appser4_8510 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306864615|gb|EFM96520.1| hypothetical protein appser10_8850 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306869044|gb|EFN00846.1| hypothetical protein appser12_8790 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
          Length = 282

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 103/224 (45%), Gaps = 6/224 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +T    AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 26  AQAGKLAIVIDDIGY-RTKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 84

Query: 228 PMQAFD-ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           PMQ  +     E     L V  + + +   ++ +  +     G+ N+ G+   +++++ E
Sbjct: 85  PMQPKNRHQPIESG--ALMVGASKENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P ++   +A +L +  +  +L+LDD     +++ +      
Sbjct: 143 HLMTELSKQQLFFLDSKTGP-SVAAKVARELGVNALERNLFLDDNDALHEVQNQFHLALH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AR  G AI +      SIEV+ + L      D+ +V +  L +
Sbjct: 202 YARKHGSAILIGHPRKNSIEVLEKGLANLPE-DIQLVSMGSLWR 244


>gi|228938547|ref|ZP_04101155.1| hypothetical protein bthur0008_12120 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228971426|ref|ZP_04132052.1| hypothetical protein bthur0003_12060 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228978039|ref|ZP_04138418.1| hypothetical protein bthur0002_12430 [Bacillus thuringiensis Bt407]
 gi|228781700|gb|EEM29899.1| hypothetical protein bthur0002_12430 [Bacillus thuringiensis Bt407]
 gi|228788293|gb|EEM36246.1| hypothetical protein bthur0003_12060 [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228821145|gb|EEM67162.1| hypothetical protein bthur0008_12120 [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|326939056|gb|AEA14952.1| hypothetical protein CT43_CH1264 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 256

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQATAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|223041917|ref|ZP_03612102.1| hypothetical protein AM202_0513 [Actinobacillus minor 202]
 gi|223017271|gb|EEF15698.1| hypothetical protein AM202_0513 [Actinobacillus minor 202]
          Length = 282

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 100/226 (44%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G S    QR +  LP  I++A   +        + A  + ++ ++ +
Sbjct: 25  AQAAKLAIVIDDIGYSVREDQR-VYQLPKEISVAIIPSAPYAKVRAENAFAQKRDILIHL 83

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ  +     +    L V    ++  + L  + +R     G+ N+ G+   ++K +   
Sbjct: 84  PMQPQNAQQAIEKP-ALLVGDDFEKARSLLENARQRVPYAIGLNNHMGSGATADKATMRH 142

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
             +  A++ L F D  + P ++   +A +  +  +   ++LDD  +   +  + +  +  
Sbjct: 143 FMQALAEQKLFFLDSKTGP-SVATKVAVEFGISALERHVFLDDSNEYHDVLHQFQQAKAY 201

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AR  G AI +      SI+V+ + L+     D+ +V +  L +   
Sbjct: 202 ARKHGVAILIGHPRKNSIDVLEKELKTLPA-DIQLVSMGSLWRHEK 246


>gi|229154999|ref|ZP_04283113.1| hypothetical protein bcere0010_11930 [Bacillus cereus ATCC 4342]
 gi|228628557|gb|EEK85270.1| hypothetical protein bcere0010_11930 [Bacillus cereus ATCC 4342]
          Length = 256

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTTDERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|308051460|ref|YP_003915026.1| hypothetical protein Fbal_3759 [Ferrimonas balearica DSM 9799]
 gi|307633650|gb|ADN77952.1| protein of unknown function DUF610 YibQ [Ferrimonas balearica DSM
           9799]
          Length = 263

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 41/219 (18%), Positives = 91/219 (41%), Gaps = 4/219 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           G R+++++  +G       RA   LP  +TLAF  +         +A ++ +E +L +PM
Sbjct: 34  GPRLSLIIDDIG--AREADRAALTLPTEVTLAFLPHTPWGRELALQAWRQDRELMLHLPM 91

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
                       + ++  Q   Q+  R++ +L       GV N+ G+ +  + +    + 
Sbjct: 92  GTTG--PKSPGPWAIEPGQDRWQVQYRVKKALADIPFVTGVNNHMGSAVTPDPDRMAWVM 149

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +  + +GL F D  ++  +     A    +     D++LD       + ++       A 
Sbjct: 150 EVLSLKGLYFVDSVTTSDSRAYEQALAWGVATKKRDVFLDPDRAEGTLEKQWAEALRQAD 209

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             G+ + +   + E++  +   L     +++ +VPLS L
Sbjct: 210 KFGEVVVIGHPYPETLTFLEATLPTLAEQNIQLVPLSTL 248


>gi|77456558|ref|YP_346063.1| hypothetical protein Pfl01_0330 [Pseudomonas fluorescens Pf0-1]
 gi|77380561|gb|ABA72074.1| putative exported protein [Pseudomonas fluorescens Pf0-1]
          Length = 258

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 42/237 (17%), Positives = 97/237 (40%), Gaps = 7/237 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A  +        A + +++  LG +     R +  LP  +T A   +      + +EA
Sbjct: 15  GAAHAEPARPTPQKAYLTLIIDDLGQNLPR-DRRVLALPGPVTTAIMPDTPHATEFAREA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            + G+  IL +PM            +       +++L  RL  + +      G+ N+ G+
Sbjct: 74  HRAGKVVILHMPMDPAT------GPFAWHPELPIEELEKRLNAAFKMVPYTAGINNHMGS 127

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +R   F D  +S + +    A K++L  +  D++LDD+     
Sbjct: 128 RMTAQPVAMAWLMGELQRRHKFFVDSRTSAQTVAAQQAQKIDLASVSRDVFLDDERTEAA 187

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I  +L+    +A   G A+ +   + +++ V+ + L +   + +  + +  +  + S
Sbjct: 188 ILTQLQTAISLAHKQGSAVMIGHPYPQTLAVLERELPKLKAQGIEWIDIKQMISVRS 244


>gi|42780521|ref|NP_977768.1| hypothetical protein BCE_1447 [Bacillus cereus ATCC 10987]
 gi|42736441|gb|AAS40376.1| conserved hypothetical protein [Bacillus cereus ATCC 10987]
          Length = 256

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVEAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|74314149|ref|YP_312568.1| hypothetical protein SSON_3791 [Shigella sonnei Ss046]
 gi|73857626|gb|AAZ90333.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 277

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|30261433|ref|NP_843810.1| hypothetical protein BA_1349 [Bacillus anthracis str. Ames]
 gi|47777922|ref|YP_017970.2| hypothetical protein GBAA_1349 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184267|ref|YP_027519.1| hypothetical protein BAS1250 [Bacillus anthracis str. Sterne]
 gi|52144005|ref|YP_082824.1| divergent polysaccharide deacetylase [Bacillus cereus E33L]
 gi|65318702|ref|ZP_00391661.1| COG2861: Uncharacterized protein conserved in bacteria [Bacillus
           anthracis str. A2012]
 gi|118476904|ref|YP_894055.1| divergent polysaccharide deacetylase [Bacillus thuringiensis str.
           Al Hakam]
 gi|165870470|ref|ZP_02215125.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167639335|ref|ZP_02397607.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170686852|ref|ZP_02878072.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|170706221|ref|ZP_02896682.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|177651538|ref|ZP_02934327.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190568129|ref|ZP_03021039.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|196035274|ref|ZP_03102679.1| conserved hypothetical protein [Bacillus cereus W]
 gi|196040679|ref|ZP_03107978.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|196046501|ref|ZP_03113726.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|218902539|ref|YP_002450373.1| hypothetical protein BCAH820_1422 [Bacillus cereus AH820]
 gi|225863295|ref|YP_002748673.1| hypothetical protein BCA_1386 [Bacillus cereus 03BB102]
 gi|227815821|ref|YP_002815830.1| hypothetical protein BAMEG_3245 [Bacillus anthracis str. CDC 684]
 gi|228932713|ref|ZP_04095586.1| hypothetical protein bthur0009_11890 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228945030|ref|ZP_04107391.1| hypothetical protein bthur0007_11960 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|229090385|ref|ZP_04221628.1| hypothetical protein bcere0021_12140 [Bacillus cereus Rock3-42]
 gi|229602452|ref|YP_002865845.1| hypothetical protein BAA_1418 [Bacillus anthracis str. A0248]
 gi|254682505|ref|ZP_05146366.1| hypothetical protein BantC_01448 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254726167|ref|ZP_05187949.1| hypothetical protein BantA1_27540 [Bacillus anthracis str. A1055]
 gi|254733921|ref|ZP_05191635.1| hypothetical protein BantWNA_01941 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254753779|ref|ZP_05205814.1| hypothetical protein BantV_14988 [Bacillus anthracis str. Vollum]
 gi|254758876|ref|ZP_05210903.1| hypothetical protein BantA9_11259 [Bacillus anthracis str.
           Australia 94]
 gi|301052972|ref|YP_003791183.1| divergent polysaccharide deacetylase [Bacillus anthracis CI]
 gi|30255287|gb|AAP25296.1| conserved hypothetical protein [Bacillus anthracis str. Ames]
 gi|47551627|gb|AAT30445.2| conserved hypothetical protein [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178194|gb|AAT53570.1| conserved hypothetical protein [Bacillus anthracis str. Sterne]
 gi|51977474|gb|AAU19024.1| conserved hypothetical protein; possible divergent polysaccharide
           deacetylase [Bacillus cereus E33L]
 gi|118416129|gb|ABK84548.1| conserved hypothetical protein [Bacillus thuringiensis str. Al
           Hakam]
 gi|164713965|gb|EDR19487.1| conserved hypothetical protein [Bacillus anthracis str. A0488]
 gi|167512774|gb|EDR88148.1| conserved hypothetical protein [Bacillus anthracis str. A0193]
 gi|170128755|gb|EDS97621.1| conserved hypothetical protein [Bacillus anthracis str. A0389]
 gi|170669375|gb|EDT20118.1| conserved hypothetical protein [Bacillus anthracis str. A0465]
 gi|172082816|gb|EDT67879.1| conserved hypothetical protein [Bacillus anthracis str. A0174]
 gi|190560863|gb|EDV14838.1| conserved hypothetical protein [Bacillus anthracis Tsiankovskii-I]
 gi|195991951|gb|EDX55914.1| conserved hypothetical protein [Bacillus cereus W]
 gi|196022685|gb|EDX61367.1| conserved hypothetical protein [Bacillus cereus 03BB108]
 gi|196028469|gb|EDX67077.1| conserved hypothetical protein [Bacillus cereus NVH0597-99]
 gi|218538662|gb|ACK91060.1| conserved hypothetical protein [Bacillus cereus AH820]
 gi|225786406|gb|ACO26623.1| conserved hypothetical protein [Bacillus cereus 03BB102]
 gi|227004833|gb|ACP14576.1| conserved hypothetical protein [Bacillus anthracis str. CDC 684]
 gi|228692968|gb|EEL46686.1| hypothetical protein bcere0021_12140 [Bacillus cereus Rock3-42]
 gi|228814699|gb|EEM60959.1| hypothetical protein bthur0007_11960 [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228826971|gb|EEM72732.1| hypothetical protein bthur0009_11890 [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|229266860|gb|ACQ48497.1| conserved hypothetical protein [Bacillus anthracis str. A0248]
 gi|300375141|gb|ADK04045.1| conserved hypothetical divergent polysaccharide deacetylase
           [Bacillus cereus biovar anthracis str. CI]
          Length = 256

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|228914003|ref|ZP_04077625.1| hypothetical protein bthur0012_12400 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228845608|gb|EEM90637.1| hypothetical protein bthur0012_12400 [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
          Length = 256

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  ++       G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIHEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVLKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|259906778|ref|YP_002647134.1| hypothetical protein YigQ [Erwinia pyrifoliae Ep1/96]
 gi|224962400|emb|CAX53855.1| conserved uncharacterized protein YigQ [Erwinia pyrifoliae Ep1/96]
 gi|283476564|emb|CAY72392.1| Uncharacterized protein yibQ precursor [Erwinia pyrifoliae DSM
           12163]
          Length = 304

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 44/231 (19%), Positives = 91/231 (39%), Gaps = 4/231 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
             S A   +++IV+   G      Q+ +  +PA I++A   N         +A + G E 
Sbjct: 16  IASPAWAGKLSIVIDDFGYRPALEQQ-VLQMPAAISVAVLPNAPHAREMATKAHQSGHEV 74

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +PM    +   E    TL+     +++   +R +        G+ N+ G+ + S+  
Sbjct: 75  LIHLPMAPLSKQPLE--KDTLRPDMPTEEIGRIIREAAAAVPYAVGLNNHMGSAMTSSLP 132

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + + +        F D  +   +     A   N+  +   ++LDD  +   IR +   
Sbjct: 133 AMQKVMQILNHYHFYFLDSMTIGNSQATRAAEGTNVKVVKRWVFLDDSQNEADIRVQFTR 192

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
              +A+  G AI +      ++ V+ Q L      D+ +   S L   + P
Sbjct: 193 AVRLAQRDGSAIAIGHPHPSTVRVLQQMLPGLPA-DIILERPSQLLNATQP 242


>gi|229587895|ref|YP_002870014.1| hypothetical protein PFLU0334 [Pseudomonas fluorescens SBW25]
 gi|229359761|emb|CAY46611.1| putative exported protein [Pseudomonas fluorescens SBW25]
          Length = 262

 Score =  229 bits (585), Expect = 4e-58,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 91/220 (41%), Gaps = 7/220 (3%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
                    A + +++  LG +     R +  LP  +T A   +      + +EA K G+
Sbjct: 19  ATPAGEPQKAYLTLIIDDLGQNLPR-DRRVLALPGPVTTAIMPDTPHAAEFAREAHKAGK 77

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
             IL +PM            +       +++L  RL  + +      G+ N+ G+ + + 
Sbjct: 78  IVILHMPMDPAT------GPFAWHPELPIEELGKRLDAAFQAVPYTAGINNHMGSRMTAQ 131

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
             +   +  E  +R   F D  +S + +    A K+ L ++  D++LDD+     I  +L
Sbjct: 132 PAAMAWLMAELQRRNKFFVDSRTSAQTVAAAEAQKIGLAHVSRDVFLDDERTEAAITTQL 191

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVS 381
           +   ++A   G A+ +   + +++ V+ + L +   + V 
Sbjct: 192 QTAIKLAHKQGSAVMIGHPYPQTLAVLERELPKLKAQGVD 231


>gi|222095065|ref|YP_002529125.1| hypothetical protein BCQ_1405 [Bacillus cereus Q1]
 gi|221239123|gb|ACM11833.1| conserved hypothetical protein [Bacillus cereus Q1]
          Length = 256

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +PA      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPAFLFPIETKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|289624111|ref|ZP_06457065.1| yibQ gene product [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|330868929|gb|EGH03638.1| YibO protein [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 260

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 46/236 (19%), Positives = 98/236 (41%), Gaps = 7/236 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A           A +++++  LG +     R    LP  +TLA   +      + +EA
Sbjct: 17  AHAAPAEDNGKPPKAYLSLIIDDLGQNPARDSRT-LALPGPVTLAIMPDTPHATEFAREA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            +  +  +L +PM            Y       + +L +RL  +L +     G+ N+ G+
Sbjct: 76  HRAAKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGS 129

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + 
Sbjct: 130 RMTAEPVAMAWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEA 189

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I  +L+   +IAR  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 190 INRQLQSAIKIARKHGSAVVIGHPYPVTLDVLERELPKLKDQGVEWIDLRSMISER 245


>gi|229195628|ref|ZP_04322394.1| hypothetical protein bcere0001_11950 [Bacillus cereus m1293]
 gi|228587877|gb|EEK45929.1| hypothetical protein bcere0001_11950 [Bacillus cereus m1293]
          Length = 256

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 49/243 (20%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +PA      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPAFLFPIEAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|209754798|gb|ACI75711.1| hypothetical protein ECs4492 [Escherichia coli]
          Length = 277

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|313501034|gb|ADR62400.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 255

 Score =  229 bits (585), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 47/229 (20%), Positives = 98/229 (42%), Gaps = 7/229 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A+ A ++I++  LG S     R    LP  +T+A   +      + ++A K G+  I
Sbjct: 18  AAPANKAYMSIIIDDLGQSAERDNRT-LALPGPVTMAIMPDTPHATDFARQAHKAGKTVI 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       + +L  RL  +L +     G+ N+ G+ + + ++ 
Sbjct: 77  LHMPMDPAT------GPYAWHPEVPLTELARRLDTALAKVPYAAGINNHMGSRMTAQRQP 130

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S   +    A    L ++  D++LDD    + I  +L   
Sbjct: 131 MAWLMGELQQRHLFFVDSRTSAATVAAAEAQAQGLAHVSRDVFLDDVRTTEAITRQLHQG 190

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             +A   G  + +   + +++EV+ + L     + ++++ L+ +    S
Sbjct: 191 IALASKQGSVVLIGHPYPQTLEVLERELPGLKRQGITLIGLNQMIAERS 239


>gi|291288857|ref|YP_003505673.1| hypothetical protein Dacet_2967 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290886017|gb|ADD69717.1| protein of unknown function DUF610 YibQ [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 431

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 46/258 (17%), Positives = 87/258 (33%), Gaps = 10/258 (3%)

Query: 141 KKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITL 200
            + +    K        P            A++A+V+   G S +   + +  L    T 
Sbjct: 174 PRPVTTVQKRKPAAPSKPEPVIPPAKKTFKAKLAVVIDDCGYSMSL-AKQLAALQYPATF 232

Query: 201 AFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYS 260
           A              A+K G+   L  PMQ       +     L +      +    + +
Sbjct: 233 AVIPFTPYGKETALLARKAGKPVFLHFPMQPRSYPKFDPGKGALFLNMPETVIAAVTKAN 292

Query: 261 LRRGT-GYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNL 319
                    G  N+ G+    ++E  E   KE +K    F D  +S   +   +  +  L
Sbjct: 293 FDYFPIKLDGANNHTGSAFTESREKMEQALKEISKYTPGFLDSHTSRATVAYDVCKETTL 352

Query: 320 PYMVADLYLDDQV--------DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
                D++LD++          R+ + + L    + A   G AI +     ++I V+   
Sbjct: 353 KCGRNDIFLDNEEPGLVTKSAKRNHVHDVLMQAAKKALANGSAIAIGHLRKDTISVLENS 412

Query: 372 LQQEHVRDVSVVPLSCLA 389
            +Q     V +VP++ L 
Sbjct: 413 FRQIEEMGVEIVPVTSLM 430


>gi|228926462|ref|ZP_04089534.1| hypothetical protein bthur0010_11810 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228833286|gb|EEM78851.1| hypothetical protein bthur0010_11810 [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
          Length = 256

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVLKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|167634468|ref|ZP_02392789.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
 gi|254740389|ref|ZP_05198080.1| hypothetical protein BantKB_05133 [Bacillus anthracis str. Kruger
           B]
 gi|167530356|gb|EDR93082.1| conserved hypothetical protein [Bacillus anthracis str. A0442]
          Length = 256

 Score =  229 bits (584), Expect = 5e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSAKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|190150156|ref|YP_001968681.1| hypothetical protein APP7_0887 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303251312|ref|ZP_07337490.1| hypothetical protein APP6_0513 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307252454|ref|ZP_07534350.1| hypothetical protein appser6_9710 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307263494|ref|ZP_07545109.1| hypothetical protein appser13_9100 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189915287|gb|ACE61539.1| hypothetical protein APP7_0887 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302649854|gb|EFL80032.1| hypothetical protein APP6_0513 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306860046|gb|EFM92063.1| hypothetical protein appser6_9710 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306871137|gb|EFN02866.1| hypothetical protein appser13_9100 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 282

 Score =  229 bits (584), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 102/224 (45%), Gaps = 6/224 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +     AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 26  AQAGKLAIVIDDIGY-RAKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 84

Query: 228 PMQAFD-ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           PMQ  +     E     L V  + + +   ++ +  +     G+ N+ G+   +++++ E
Sbjct: 85  PMQPKNRHQPIESG--ALMVGASKENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P ++   +A +L +  +  +L+LDD     +++ +      
Sbjct: 143 HLMTELSKQQLFFLDSKTGP-SVAAKVARELGVNALERNLFLDDNDALHEVQNQFHLALH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AR  G AI +      SIEV+ + L      D+ +V +  L +
Sbjct: 202 YARKHGSAILIGHPRKNSIEVLEKGLANLPE-DIQLVSMGSLWR 244


>gi|82779107|ref|YP_405456.1| hypothetical protein SDY_4047 [Shigella dysenteriae Sd197]
 gi|81243255|gb|ABB63965.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
          Length = 277

 Score =  229 bits (584), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|229029103|ref|ZP_04185201.1| hypothetical protein bcere0028_12050 [Bacillus cereus AH1271]
 gi|228732201|gb|EEL83085.1| hypothetical protein bcere0028_12050 [Bacillus cereus AH1271]
          Length = 244

 Score =  229 bits (583), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 99/243 (40%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 3   LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 61

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 62  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 121

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 122 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 181

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   +          + LS LA    
Sbjct: 182 ISKQAQLLIKKIQEKPIMVAIGHVGPPGEITSRVIETSIPNIREHA-DFIFLSDLALSPP 240

Query: 394 PSS 396
           P S
Sbjct: 241 PVS 243


>gi|229183625|ref|ZP_04310848.1| hypothetical protein bcere0004_11970 [Bacillus cereus BGSC 6E1]
 gi|228599868|gb|EEK57465.1| hypothetical protein bcere0004_11970 [Bacillus cereus BGSC 6E1]
          Length = 244

 Score =  229 bits (583), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 3   LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 61

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 62  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 121

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 122 KVTADERIVRLILAACKKHGLFYLDSKTNPKSVVPKIGKELGVPIIENQLFFDDVYTAAH 181

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 182 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 240

Query: 394 PSS 396
           P S
Sbjct: 241 PVS 243


>gi|229120971|ref|ZP_04250213.1| hypothetical protein bcere0016_12800 [Bacillus cereus 95/8201]
 gi|228662631|gb|EEL18229.1| hypothetical protein bcere0016_12800 [Bacillus cereus 95/8201]
          Length = 256

 Score =  229 bits (583), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 48/243 (19%), Positives = 100/243 (41%), Gaps = 5/243 (2%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      + A   ++AIV+   G +  GT + +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPVQAKAHTNKVAIVIDDFGNNMKGTDK-MLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P+++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPKSIVPKIGKELGVPIIENQLFFDDVYTAAH 193

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFD---ESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           I ++ + L +  +     + +         +  VI   + +        + LS LA    
Sbjct: 194 ISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRVIETSIPKIREHA-DFIFLSDLALSPP 252

Query: 394 PSS 396
           P S
Sbjct: 253 PVS 255


>gi|323179414|gb|EFZ64981.1| divergent polysaccharide deacetylase family protein [Escherichia
           coli 1180]
          Length = 277

 Score =  228 bits (582), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|258645566|ref|ZP_05733035.1| polysaccharide deacetylase [Dialister invisus DSM 15470]
 gi|260402924|gb|EEW96471.1| polysaccharide deacetylase [Dialister invisus DSM 15470]
          Length = 375

 Score =  228 bits (582), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 53/251 (21%), Positives = 95/251 (37%), Gaps = 9/251 (3%)

Query: 146 AKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSGLGISQTGTQRAINLLPANIT 199
                 R         +     A G       R+A+V+   G+    +QR    +   +T
Sbjct: 127 KNPSDTRLKASAAKQREPAEKKAGGNSSSVTGRLAVVIDDAGLDL-ESQRIYEEIGVPLT 185

Query: 200 LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRY 259
           LA   N         E  + G   IL  PM+    S  E    T+  + + + +   L+ 
Sbjct: 186 LAVMPNKMYTSEAAAEWSRYGMPVILHQPMEPVSGSGME--EKTILTSMSDEAIRYMLKE 243

Query: 260 SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNL 319
           SL +     G+ N++G+   ++     V+  E + RGL FFD  ++        A    +
Sbjct: 244 SLEQIPQAVGINNHQGSRATTDARVMRVVMNELSHRGLFFFDSRTNTTTAADSAAASYGV 303

Query: 320 PYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRD 379
           PY   DL++D+  D  +IR  ++     A+  G  I +      +  V    + Q   + 
Sbjct: 304 PYARNDLFVDNSADEGEIRAMIQEGANRAKARGSYIIIGHCRPHTAAVFRDIVPQLQAQG 363

Query: 380 VSVVPLSCLAK 390
           +  V +S L +
Sbjct: 364 IEFVYVSSLLR 374


>gi|307245693|ref|ZP_07527779.1| hypothetical protein appser1_8960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254662|ref|ZP_07536490.1| hypothetical protein appser9_9020 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307259107|ref|ZP_07540837.1| hypothetical protein appser11_9050 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306853395|gb|EFM85614.1| hypothetical protein appser1_8960 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862335|gb|EFM94301.1| hypothetical protein appser9_9020 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866774|gb|EFM98632.1| hypothetical protein appser11_9050 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
          Length = 282

 Score =  228 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 46/224 (20%), Positives = 102/224 (45%), Gaps = 6/224 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +     AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 26  AQAGKLAIVIDDIGY-RAKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 84

Query: 228 PMQAFD-ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           PMQ  +     E     L V  + + +   ++ +  +     G+ N+ G+   +++++ E
Sbjct: 85  PMQPKNRHQPIESG--ALMVGASKENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 142

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P ++   +A +L +  +  +L+LDD     +++ +      
Sbjct: 143 HLMTELSKQQLFFLDSKTGP-SVAAKVARELGVNALERNLFLDDNDALHEVQNQFHLALH 201

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AR  G AI +      SIEV+ + L      D+ +V +  L +
Sbjct: 202 YARKHGSAILIGHPRKNSIEVLEKGLANLPE-DIQLVSMGSLWR 244


>gi|15804158|ref|NP_290197.1| hypothetical protein Z5041 [Escherichia coli O157:H7 EDL933]
 gi|30065110|ref|NP_839281.1| hypothetical protein S4115 [Shigella flexneri 2a str. 2457T]
 gi|56480388|ref|NP_709393.2| hypothetical protein SF3653 [Shigella flexneri 2a str. 301]
 gi|12518367|gb|AAG58761.1|AE005589_1 hypothetical protein Z5041 [Escherichia coli O157:H7 str. EDL933]
 gi|13363967|dbj|BAB37915.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|30043371|gb|AAP19092.1| hypothetical protein S4115 [Shigella flexneri 2a str. 2457T]
 gi|56383939|gb|AAN45100.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|209754800|gb|ACI75712.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|209754802|gb|ACI75713.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|209754804|gb|ACI75714.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|209754806|gb|ACI75715.1| hypothetical protein ECs4492 [Escherichia coli]
 gi|313647513|gb|EFS11963.1| divergent polysaccharide deacetylase family protein [Shigella
           flexneri 2a str. 2457T]
          Length = 277

 Score =  228 bits (582), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|82545982|ref|YP_409929.1| hypothetical protein SBO_3620 [Shigella boydii Sb227]
 gi|81247393|gb|ABB68101.1| conserved hypothetical protein [Shigella boydii Sb227]
          Length = 277

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPLTVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|332994651|gb|AEF04706.1| hypothetical protein ambt_15995 [Alteromonas sp. SN2]
          Length = 280

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 39/216 (18%), Positives = 93/216 (43%), Gaps = 4/216 (1%)

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             R+ I++  LG     +  A   LP+ +T +            ++A+++G+  +L +PM
Sbjct: 31  KPRVIIILDDLGYR--KSDMAAFALPSEVTFSILPRTPLAQTISRKAEQQGRAVMLHMPM 88

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           Q+            L        + + LR +L+      GV N+ G+     + + + I 
Sbjct: 89  QSTSGKA--MGPLGLSTDMYPAAITHTLRAALKSVPNAVGVNNHMGSAFTVEEPAMQTIM 146

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
           +E  ++GL F D  +S     + +A ++ +P     ++LD+      + ++ +  + +A+
Sbjct: 147 EEIKRQGLFFVDSRTSVNTTAQQVADRVGVPNASRQVFLDNDRSEASLSKQFEYTKRLAK 206

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
             G  + +A  + E+I  ++  L       +++  +
Sbjct: 207 RNGTVVVIAHPYPETITFLAHTLPSLATEGIALASV 242


>gi|330967509|gb|EGH67769.1| hypothetical protein PSYAC_23214 [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 260

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 46/228 (20%), Positives = 98/228 (42%), Gaps = 7/228 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
               S A + +++  LG +     R    LP  +TLA   +      + +EA + G+  I
Sbjct: 25  AEKPSKAYLTLIIDDLGQNPVRDSRT-LALPGPVTLAIMPDTPHATDFAREAHRAGKTVI 83

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y       + +L +RL  +L +     G+ N+ G+ + +   +
Sbjct: 84  LHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMGSRMTAEPVA 137

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I  +L+  
Sbjct: 138 MTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAITRQLQTA 197

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            ++A+  G A+ +   +  +++V+ + L +   + V  + L  +    
Sbjct: 198 IKLAQKQGSAVVIGHPYPVTLDVLERELPRLKAQSVEWIDLRSMISER 245


>gi|85060169|ref|YP_455871.1| hypothetical protein SG2191 [Sodalis glossinidius str. 'morsitans']
 gi|84780689|dbj|BAE75466.1| conserved hypothetical protein [Sodalis glossinidius str.
           'morsitans']
          Length = 317

 Score =  228 bits (581), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 41/228 (17%), Positives = 93/228 (40%), Gaps = 4/228 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
           C  A   ++AIV+   G  +  T+  +  +P N+++A   +         +A ++ +E +
Sbjct: 18  CPVAQAGKLAIVIDDFGY-RPATENQVLAMPVNVSIAVLPDAPYAREMALKAHRQRREIL 76

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM    +   E    TL    +  Q+ + ++ + ++     G+ N+ G+ + S+   
Sbjct: 77  IHLPMAPLSKQPLE--RNTLTPAMSRDQVSDIIQQATQKVPYAVGLNNHMGSAMTSSLSG 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            + + +  +     F D  +   +     +    +  +   ++LDD  +   IR +    
Sbjct: 135 MQHVMQALSHYSYYFLDSVTIGNSQAVPASAGTGVRVLKRQVFLDDTANEADIRHQFNRA 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             +AR  G AI +      ++ V+ Q L      D+ +V  S L    
Sbjct: 195 VALARRNGFAIAIGHPHPATVRVLQQMLPSLPG-DIVLVRPSMLLNER 241


>gi|912478|gb|AAB18591.1| unnamed protein product [Escherichia coli str. K-12 substr. MG1655]
          Length = 277

 Score =  228 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 36/202 (17%), Positives = 79/202 (39%), Gaps = 3/202 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
            ++   +R ++       G+ N+ G+ + SN    + + +   +  L F D  +      
Sbjct: 59  DEIERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q
Sbjct: 119 MRAAQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPATVRVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLS 392
            +      D+++V  S L    
Sbjct: 179 MVYNLPP-DITLVKASSLLNEP 199


>gi|288555887|ref|YP_003427822.1| putative polysaccharide de-acetylase [Bacillus pseudofirmus OF4]
 gi|288547047|gb|ADC50930.1| putative polysaccharide de-acetylase [Bacillus pseudofirmus OF4]
          Length = 271

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 46/223 (20%), Positives = 97/223 (43%), Gaps = 5/223 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AIV+   G        +       IT A            +EA   G E I+ +P++ 
Sbjct: 36  KVAIVIDDFG-GNVKGVESFLKGDIPITAAVMPFLEYSTEQAEEAHHAGLEVIIHLPLEP 94

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +    + +++  R+  ++       G+ N+ G+ ++ ++    VI   
Sbjct: 95  KKGKASWLGPKGITSDLSNEEVRKRVEEAIEDVPHAVGLNNHMGSKIVEDRRIMGVILDV 154

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV-DRDKIREKLKGLEEIART 350
             + GL   D G+S +++   LA +  +PY + D++LDD +  R  + ++++ L+++A  
Sbjct: 155 VKEHGLYVIDSGTSNKSVISELAEERRIPYSIRDVFLDDSLSSRSHVAKQMRLLQKVAAV 214

Query: 351 TGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            G AIG+       +E+   I   L+      V +VP S + +
Sbjct: 215 EGDAIGIGHVGVKGEETAAGILSSLRDLEKNKVQIVPASHIIE 257


>gi|167463615|ref|ZP_02328704.1| hypothetical protein Plarl_13849 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322381594|ref|ZP_08055567.1| hypothetical protein PL1_0781 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321154430|gb|EFX46733.1| hypothetical protein PL1_0781 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 281

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 43/264 (16%), Positives = 103/264 (39%), Gaps = 9/264 (3%)

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINL 193
            +    S   L +  +   +  + PA+ +         R AIV+   G    GT+  +  
Sbjct: 23  GMETAFSTPSLYSAIRRVDDPGQSPALPEPSTQK----RAAIVIDDFGNKMGGTED-MLA 77

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  IT+A      +     + A   G+E I+ +PM+      +      +       ++
Sbjct: 78  LPFPITVAVMPFLQTTKADAEAAHAAGKEVIIHLPMEPKIARKSWLGPGVISTDLKNDEI 137

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
             R+  ++       G+ N+ G+    ++   +++ +   +RGL F D  ++  ++    
Sbjct: 138 RKRVHAAIDEVPHAIGINNHMGSKATGDERVMKLVLEVCKERGLFFLDSHTNYWSIACRK 197

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA---FDESIEVISQ 370
           A ++ +P +   L+LDD   +  I ++++ L++  +     + +         +  V+ +
Sbjct: 198 AKEVGVPCIENHLFLDDIHTKKHISQQVRLLDKHLKEHSTCVTIGHVGRYGSLTAAVLRE 257

Query: 371 WLQQE-HVRDVSVVPLSCLAKLSS 393
            +        + +V +S L     
Sbjct: 258 QIPALTEKSGIRIVRISELVPKPK 281


>gi|167036099|ref|YP_001671330.1| hypothetical protein PputGB1_5110 [Pseudomonas putida GB-1]
 gi|166862587|gb|ABZ00995.1| protein of unknown function DUF610 YibQ [Pseudomonas putida GB-1]
          Length = 259

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 48/245 (19%), Positives = 104/245 (42%), Gaps = 7/245 (2%)

Query: 149 KVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNS 208
           +                + A+ A ++I++  LG S     R    LP  +T+A   +   
Sbjct: 6   RYLLCLLLCLLAGVAQAAPAAKAYLSIIIDDLGQSSERDNRT-LALPGPVTMAIMPDTPH 64

Query: 209 LDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYF 268
              + ++A + G+  IL +PM            Y       + +L +RL+ +L +     
Sbjct: 65  ASDFARQAHRAGKTVILHMPMDPAT------GPYAWHPGAPLPELASRLQAALAKVPYAA 118

Query: 269 GVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYL 328
           G+ N+ G+ + + +E    +  E  +R L F D  +S   +    A ++ L ++  D++L
Sbjct: 119 GINNHMGSRMTAQREPMVWLMGELQQRHLFFVDSRTSAATVAAAEAQRIGLAHVSRDVFL 178

Query: 329 DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           DD    + I  +L+    +AR  G A+ +   + ++++V+   +     + + ++PL  +
Sbjct: 179 DDVRTPEAIAAQLQQGVALARKQGSAVLIGHPYPQTLQVLESAMPGLKHQGIELIPLRQM 238

Query: 389 AKLSS 393
               S
Sbjct: 239 IAERS 243


>gi|152990904|ref|YP_001356626.1| hypothetical protein NIS_1160 [Nitratiruptor sp. SB155-2]
 gi|151422765|dbj|BAF70269.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2]
          Length = 334

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 37/223 (16%), Positives = 95/223 (42%), Gaps = 7/223 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
               ++AI++  +        + I  L   I  +F        +  + A       ++ +
Sbjct: 119 TDKPKLAIIIDDVAYGY--QAKTIKNLGIPINPSFFPPSPRHPKTPQYAAMFSH-YMIHL 175

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM+A    + E    TL++T ++Q +   +    +       + N+ G+   ++ E+ + 
Sbjct: 176 PMEANHYLHEE--PDTLRITSSLQTIERVIAKIRKEFPKAKVINNHTGSRFTADYEAMKR 233

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           ++K   K   +F D  ++ + +   L  +L  PY+  +++LD++ +   I+ +L+    +
Sbjct: 234 LYKVLDKYHFVFLDSRTTAQTVVPKLDKELGRPYLARNVFLDNEQNVAYIKNQLRQAVAL 293

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           A+  G AI +      +++ + +     +   V ++ +  L K
Sbjct: 294 AKKRGVAIAIGHPHPATLKALRKSKDILNQ--VQLIYVDSLLK 334


>gi|218888242|ref|YP_002437563.1| hypothetical protein DvMF_3159 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218759196|gb|ACL10095.1| protein of unknown function DUF610 YibQ [Desulfovibrio vulgaris
           str. 'Miyazaki F']
          Length = 543

 Score =  226 bits (577), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 93/229 (40%), Gaps = 2/229 (0%)

Query: 160 MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
                     GAR+AIV+  +G S +   R +  L   +T +            + A K 
Sbjct: 315 APPPVAVAPGGARLAIVIDDIGESMSA-ARDLAALDYPVTFSVWPRSTHAREAAELAHKA 373

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
            +E ++ +PM+       +     +   Q  Q++   +R ++RR     G+ N+ G+   
Sbjct: 374 RREVMIHLPMEPVRYPQVKPGPGAILSGQQPQEMAALVRDAVRRVPYAVGLNNHMGSRAT 433

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
            N  +   + +     G+   D  + P +     A +  LP    +++LD   D+  I  
Sbjct: 434 QNAAAMRTVCEALDGTGMFVLDSMTHPASKLYFEAKRAGLPAYKRNVFLDVIADKRNIMF 493

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +L     IA+  GQAI +     E++  + +W +    R V++V +  L
Sbjct: 494 QLDKAARIAQAEGQAIAIGHPLPETVAALKEWART-RDRTVTIVTVRQL 541


>gi|167945841|ref|ZP_02532915.1| hypothetical protein Epers_04577 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 240

 Score =  226 bits (577), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 47/209 (22%), Positives = 92/209 (44%), Gaps = 3/209 (1%)

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           G      +RA   L   +T +F  +     +   +A +  +E +L +PM++ +       
Sbjct: 6   GNLMQRGERA-LALRGKVTYSFLPHTPYARQQADQAYRLEREVMLHLPMESLE--ALPLG 62

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
              L    T Q+    L  ++       G+ N+ G+M+ ++  + +         GL F 
Sbjct: 63  EGALLTGMTSQEQAEVLAAAVSSVPHLAGINNHMGSMMTADGVAMQQFMALIRDTGLFFL 122

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           D  ++ + L    A +  +     D++LD+    + IR + K L  +AR+ G AIG+A  
Sbjct: 123 DSRTTDKTLAEQSAQENLVATGRRDVFLDNLRQPEAIRAQFKRLLALARSQGHAIGIAHP 182

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             E++EV+   L +   + + +VP+S L 
Sbjct: 183 HPETLEVLEALLPELEQQGIRLVPVSQLI 211


>gi|46580740|ref|YP_011548.1| hypothetical protein DVU2335 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450160|gb|AAS96808.1| conserved domain protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234454|gb|ADP87308.1| protein of unknown function DUF610 YibQ [Desulfovibrio vulgaris
           RCH1]
          Length = 516

 Score =  226 bits (577), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 46/235 (19%), Positives = 92/235 (39%), Gaps = 2/235 (0%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           +    +   GA +AIV+  +G S  G  R +  L   +T A     +      + A + G
Sbjct: 282 EPRPGTPVEGALLAIVIDDIGESM-GAVRDLLKLDYPVTFAVWPRSSHAREAAEAAHRAG 340

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           +E ++  PM+       +     + V     ++   LR +L R     G+ N+ G+    
Sbjct: 341 REVMIHQPMEPLKYPSVKPGPGAIYVRMGSDEIEATLRDNLARVPHAVGLNNHMGSRFTQ 400

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +      +      +GL   D  +   ++    A K  LP    +++LD   D+  I  +
Sbjct: 401 DTRGVRAVCDALEGKGLFVLDSVTHSGSVFYREARKAGLPAGKRNVFLDVIHDKRNIMFQ 460

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           L     +A   G A+ +     E++  + +W Q+   + V +V +  L    + +
Sbjct: 461 LDKAARVAHEQGVAVAIGHPLAETVAALKEW-QRTRDKSVRIVTMRQLLDAETTA 514



 Score = 39.7 bits (91), Expect = 0.76,   Method: Composition-based stats.
 Identities = 16/147 (10%), Positives = 34/147 (23%), Gaps = 9/147 (6%)

Query: 11  KKTPKRKSFYSQIISRLGLFLLFCTFIVG---LSIYILISHAFVGTISEMIPYSVIREIA 67
           +K  K  +   + ++RL + ++    +V       ++    A              +  A
Sbjct: 32  RKGSKTPAATEKTLTRLVIVIMGVLCLVFTVMAGYWLWQGGADATRPVPPSKTERQKTPA 91

Query: 68  PIPLTIPLNIEDKQSPSKRDNNTVCNQ------LKNDSSQHDGQIQNDISGKTVVNKPTR 121
                 P   +   +  K  +                S         D +  +V    T 
Sbjct: 92  ATSPARPTPAQPSATAGKVQSGEASRTTGKGVHADAQSDASTPGGDADKAAPSVPRNATS 151

Query: 122 STSIDSLPTIEERLILGLSKKELLAKN 148
                            L  +E L   
Sbjct: 152 DAVDGEGAVRAPVNAGALPYEESLDAP 178


>gi|110807708|ref|YP_691228.1| hypothetical protein SFV_3915 [Shigella flexneri 5 str. 8401]
 gi|110617256|gb|ABF05923.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 274

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 78/199 (39%), Gaps = 3/199 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P+ I++A   +         +A   G E ++ +PM    +   E    TL+   +  ++
Sbjct: 1   MPSAISVAVLPDSPHAREMATKAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEI 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + SN    + + +   +  L F D  +         
Sbjct: 59  ERIIRSAVNNVPYAVGINNHMGSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRA 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A    +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q + 
Sbjct: 119 AQGTGVKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVY 178

Query: 374 QEHVRDVSVVPLSCLAKLS 392
                D+++V  S L    
Sbjct: 179 NLPP-DITLVKASSLLNEP 196


>gi|283787753|ref|YP_003367618.1| polysaccharide deacetylase [Citrobacter rodentium ICC168]
 gi|282951207|emb|CBG90900.1| putative polysaccharide deacetylase [Citrobacter rodentium ICC168]
          Length = 270

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 38/199 (19%), Positives = 81/199 (40%), Gaps = 3/199 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A   N         +A   G E ++ +PM    +   E    TL+   +  ++
Sbjct: 1   MPDAISVAVLPNAPHAREMAAKAHSSGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSDEI 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++ +     G+ N+ G+ + S+    + + +   +  L F D  +   +     
Sbjct: 59  ERIIREAVSKVPYAVGLNNHMGSAMTSSLFGMQKVMQALERYELYFLDSMTIGNSQAMRA 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A    +  +   ++LDD  +   IR +     E+AR+ G AI +      ++ V+ Q + 
Sbjct: 119 ASGTGVKVIKRKVFLDDTQNEADIRRQFNRAIELARSNGSAIAIGHPHPSTVRVLQQMVY 178

Query: 374 QEHVRDVSVVPLSCLAKLS 392
                D+++V  S L    
Sbjct: 179 NLPA-DITLVRPSSLLNEP 196


>gi|149180684|ref|ZP_01859187.1| hypothetical protein BSG1_12141 [Bacillus sp. SG-1]
 gi|148851474|gb|EDL65621.1| hypothetical protein BSG1_12141 [Bacillus sp. SG-1]
          Length = 262

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 38/241 (15%), Positives = 100/241 (41%), Gaps = 13/241 (5%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
            +  +   S+     ++IV+   G +  GT+  +  LP ++T+A     ++       A 
Sbjct: 19  VSAKEPEPSSLKKRSLSIVIDDFGNNMEGTKE-MLELPISLTVAVMPLMDTTKEDADLAH 77

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           + G E I+ +PM+      +      +    + +++  R+  ++       G+ ++ G+ 
Sbjct: 78  RLGHEVIVHMPMEPLKGKRSWLGPGAITTDLSNEEIRKRVEAAIDSVPFAVGMNHHMGSR 137

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
             +++    V+     +RGL + D  ++P+++   LA ++ +P +  +++ DD      I
Sbjct: 138 ASADERVMRVVLTVCKERGLYYLDSRTTPKSVIPELAEEIGVPLLENEMFFDDIYTTRHI 197

Query: 338 REKLKGLEEIARTTGQAIGVAVA---FDESIEVISQWLQ----QEHVRDVSVVPLSCLAK 390
            ++   + +      + I +        + + V+ +++     +        VPLS L  
Sbjct: 198 VKQANRVVKRLEKDDEVIAIGHVGITGTKMVNVLREYIPVYLNEAKA-----VPLSELIP 252

Query: 391 L 391
            
Sbjct: 253 E 253


>gi|325275726|ref|ZP_08141608.1| hypothetical protein G1E_20175 [Pseudomonas sp. TJI-51]
 gi|324099130|gb|EGB97094.1| hypothetical protein G1E_20175 [Pseudomonas sp. TJI-51]
          Length = 259

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 48/229 (20%), Positives = 99/229 (43%), Gaps = 7/229 (3%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
            + A    ++I++  LG S     R    LP  +T+A   +      + ++A K G+  I
Sbjct: 22  AAPAGKTYMSIIIDDLGQSPNRDSRT-LALPGPVTMAIMPDTPHATDFARQAHKAGKTVI 80

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           L +PM            Y        ++L  RL  +L +     G+ N+ G+ + + +E 
Sbjct: 81  LHMPMDPAT------GPYAWHPGIAGEELARRLDSALLKVPYAAGINNHMGSRMTAQREP 134

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +  E  +R L F D  +S   +    A    L ++  D++LDD    + I  +L+  
Sbjct: 135 MAWLMGELQRRHLFFVDSRTSAATVAAAEAQAQGLAHVSRDVFLDDVRTTEAIAGQLQQG 194

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
             +A   G A+ +   + +++EV+++ L +   + ++++ L  +    S
Sbjct: 195 VALAHKQGSAVLIGHPYPQTLEVLARELPRLKSQGITLLGLPQMIAERS 243


>gi|302338309|ref|YP_003803515.1| protein of unknown function DUF610 YibQ [Spirochaeta smaragdinae
           DSM 11293]
 gi|301635494|gb|ADK80921.1| protein of unknown function DUF610 YibQ [Spirochaeta smaragdinae
           DSM 11293]
          Length = 314

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 58/318 (18%), Positives = 121/318 (38%), Gaps = 11/318 (3%)

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIE 132
                  K  P++         +   ++      +     + +      S S    P   
Sbjct: 2   TEKKRPPKTKPTQLYLLLGVIIVLLLAALLLFPGKTGSRKQELSEGRDDSPSQQEAPPDS 61

Query: 133 ERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN 192
           E   + +       K   G +      +            +AI++  +G S     R + 
Sbjct: 62  ETAPVAVQNPAEDLK---GGKPLPGQKVPAKPSRGE----LAIIIDDVGYSLKE-LRPLL 113

Query: 193 LLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQ 252
             P  IT A           +KE  + G+EAIL  PM+A     N+     +        
Sbjct: 114 AFPGPITFAILPGVTYSKEALKEILQAGKEAILHQPMEAIGG--NDPGPGAIYTWMDTAA 171

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
           +  +L  +L+   G  G+ N+ G+ + S+    EV+ ++  ++ L+F D  ++   ++R 
Sbjct: 172 VREQLDKNLKELRGVKGINNHMGSKVTSDPRVMEVVLEDLKEKNLMFIDSRTTAETVSRG 231

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF-DESIEVISQW 371
           +A +L++PY    ++LD+  +R++I +  +   + A   G+AI +   +  E  E++ + 
Sbjct: 232 IAQRLHIPYQERSVFLDNTQEREEILQAFQEGLQKAEKNGRAIMIGHVWCHELAEILLEV 291

Query: 372 LQQEHVRDVSVVPLSCLA 389
             Q        + +S L 
Sbjct: 292 YPQALEEGFEFLSVSDLI 309


>gi|315121752|ref|YP_004062241.1| hypothetical protein CKC_00010 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495154|gb|ADR51753.1| hypothetical protein CKC_00010 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 354

 Score =  226 bits (575), Expect = 7e-57,   Method: Composition-based stats.
 Identities = 207/356 (58%), Positives = 247/356 (69%), Gaps = 9/356 (2%)

Query: 37  IVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLK 96
           I GLSIYIL+S+A +GT+SE+ PYS +RE   +PL          SP          Q+ 
Sbjct: 3   IFGLSIYILMSNALIGTVSEIGPYSFVREAVLVPLKNSSVANPASSPVNTAP--SPTQVV 60

Query: 97  NDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE 156
           N +   D  + N+    T+++                     + K +    +      + 
Sbjct: 61  NSTDHKDALVANESKRSTLLDSLPTIEGRLIPV------SELMEKTKPHLISVESENKSV 114

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A     C N SGARIAIVVS LGISQTGTQRAINLLP N+TLAFASNGNSL+RWM+ A
Sbjct: 115 SSAYSTRSCPNVSGARIAIVVSALGISQTGTQRAINLLPQNVTLAFASNGNSLNRWMQAA 174

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
           K+KGQE +LQIPMQ+F+E  N+ D YTLK+T++ QQLL+RLRYSLRRG GYFGVMNYRGA
Sbjct: 175 KQKGQEVMLQIPMQSFNELNND-DVYTLKITKSSQQLLSRLRYSLRRGKGYFGVMNYRGA 233

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
           M LSNK+S E IFKEFA  GLLFFDDGSS RNLTRV+AP++NLPY VADLYLDD VDRD 
Sbjct: 234 MFLSNKDSVETIFKEFAALGLLFFDDGSSSRNLTRVVAPQINLPYAVADLYLDDVVDRDS 293

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           IREKLK L +IAR TGQAIGVA AFDES+E IS+WLQ+EH  DVS+VPLSCL KL+
Sbjct: 294 IREKLKKLSDIARVTGQAIGVASAFDESVEEISKWLQEEHASDVSIVPLSCLVKLA 349


>gi|205373558|ref|ZP_03226361.1| hypothetical protein Bcoam_09870 [Bacillus coahuilensis m4-4]
          Length = 258

 Score =  225 bits (574), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 44/219 (20%), Positives = 101/219 (46%), Gaps = 5/219 (2%)

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           AIV+  LG +  GT+  I  LP  +T+A   +  +     ++A K G E I+ +P++   
Sbjct: 30  AIVIDDLGNNMKGTEE-ILQLPTILTVAVMPHLETSKEDAEKAHKLGHEVIIHLPLEPVR 88

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
              +     ++    + +++  R+R +++      G+ ++ G+   +++    +I +   
Sbjct: 89  GKKSWLGPGSITTDLSDEEIRKRVRLAIKSVPHAVGMNHHLGSKASADERVMRIILEVCK 148

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
           +  L + D  +S +++   LA +L + Y+  +++LD     + +  K K LE+      +
Sbjct: 149 ENNLYYLDSKTSTQSVIPKLANELGVSYLENEIFLDHVGTIEHMVGKAKLLEKRLARENE 208

Query: 354 AIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            I +       D+  +V+ +++ +        VPLS L 
Sbjct: 209 LIAIGHVGITGDKMADVLREFIPEFEEIG-DAVPLSKLL 246


>gi|94264377|ref|ZP_01288168.1| Protein of unknown function DUF610, YibQ [delta proteobacterium
           MLMS-1]
 gi|93455206|gb|EAT05422.1| Protein of unknown function DUF610, YibQ [delta proteobacterium
           MLMS-1]
          Length = 359

 Score =  225 bits (574), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 56/270 (20%), Positives = 113/270 (41%), Gaps = 3/270 (1%)

Query: 119 PTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVS 178
              + +  S P   E       +    A + +           +   +     R+A++V 
Sbjct: 89  APPTEADASAPATHEPAAAPEPEPRATAVDPLEPAPLLPITPPQPPLAEDPRPRLALIVD 148

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
            +G  +  T+  +      +T +F    + L   ++ A+ + +E +L +P++A DE +NE
Sbjct: 149 DMGY-RPATELQLLARDWELTFSFIPFADHLYEVLETARLQEREILLHLPLEAQDERWNE 207

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
                L        +      +L +     GV N+ G+   ++  + E +  + A   L 
Sbjct: 208 A-PGMLLTAMDDAAIATGFADALAQVPMAVGVNNHMGSRFTADARAMEALMAQVAHYDLF 266

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F D  ++  ++    A +  +P++  DL+LD+  D  KI   LK L EIA   G A+G+ 
Sbjct: 267 FLDSLTTANSVADQAAARHQVPFLKRDLFLDNDQDPGKIIANLKRLLEIAEERGYAVGIC 326

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             +  ++  +  +  +   + V +VPLS L
Sbjct: 327 HPYPATVTALQDFYPRLAEK-VRLVPLSVL 355


>gi|315633408|ref|ZP_07888699.1| exported polysaccharide deacetylase [Aggregatibacter segnis ATCC
           33393]
 gi|315477908|gb|EFU68649.1| exported polysaccharide deacetylase [Aggregatibacter segnis ATCC
           33393]
          Length = 275

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 40/225 (17%), Positives = 97/225 (43%), Gaps = 4/225 (1%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
             A  A++AIV+  LG         I  +P  +++A         +  ++A ++G++ ++
Sbjct: 19  PFAYSAKLAIVIDDLGY-HAKEDAQILAMPKAVSVAIIPAAPYAKQRNQQAFQQGRDILI 77

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +PM+   +   ED    L +  +  ++ +R++ +    +   G+ N+ G+   ++    
Sbjct: 78  HMPMETQSKMKIEDG--GLHLGMSQGEVNHRVQTAHNIVSNAIGMNNHMGSAATADGPLM 135

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             +     +R L F D  +  R++   +A +  +  +   ++LDD      ++ + +   
Sbjct: 136 TKLMTALRERHLSFLDSRTIGRSVAGKMAKEQGVRTLDRHIFLDDSDAFADVQRQFQAAV 195

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           + A+  G AI +      +I V+   +      DV +V +  L +
Sbjct: 196 QYAQKHGIAIAIGHPRKNTIAVLQAGIANLPA-DVQLVSMGSLWR 239


>gi|254282675|ref|ZP_04957643.1| Divergent polysaccharide deacetylase superfamily [gamma
           proteobacterium NOR51-B]
 gi|219678878|gb|EED35227.1| Divergent polysaccharide deacetylase superfamily [gamma
           proteobacterium NOR51-B]
          Length = 252

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 49/224 (21%), Positives = 94/224 (41%), Gaps = 4/224 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            R+AI++  LG S      A   LPA +TL+   +            ++G+E ++ +PM+
Sbjct: 26  PRLAIIIDDLGYSLNRGLDA-ANLPAPLTLSIIPHTPHAHSIATVGVEQGKEIMVHMPME 84

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           +     ++     L            +  +L    G  GV N+ G+ L +N+   E    
Sbjct: 85  STKVPPSD--PVVLTTALADDDFEATIDAALLSVPGATGVNNHMGSKLTTNRPLMERFMA 142

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
                 + F D  ++  ++   +A  + +P     ++LD+  D  +I  +L     IA  
Sbjct: 143 RVLDNSMFFIDSRTTAESVAADVATAMAVPNTERSVFLDNTRDPVQIENQLLEAVSIALH 202

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
            G A+ +   + E+++V++Q L +     V +VP S L     P
Sbjct: 203 AGDAVAIGHPYPETLKVLAQALPRLPSA-VQLVPASALTGCRLP 245


>gi|297570178|ref|YP_003691522.1| protein of unknown function DUF610 YibQ [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296926093|gb|ADH86903.1| protein of unknown function DUF610 YibQ [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 359

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 49/283 (17%), Positives = 121/283 (42%), Gaps = 11/283 (3%)

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD--------KNFCSNAS 169
           +       DS P   E  +     +    +     +                +   ++  
Sbjct: 77  RAEPPGVTDSEPDPREERLAAPPDQGFPERGTTAADQAAATTTPTPQPITETRPAPADDP 136

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             R+A+++  +G S    +  +  L   +T +F        + +   + +G+  +L +P+
Sbjct: 137 RPRLALIIDDMGYS-PEIEEKMLGLDLELTFSFIPFAPQRQQILNRTRAQGRAILLHLPL 195

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
           +A D+ +N+     L    + ++++     +L       GV N+ G+   +++ + +V+ 
Sbjct: 196 EALDDKWNKA-PGLLATGMSEEEIVTGFTAALNEIPMATGVSNHMGSRFTADRRAMQVLL 254

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
            +  +  L F D  ++P ++   +A +L +P++  D+++D   + ++IR ++  L  IA 
Sbjct: 255 AQLPRYDLYFLDSLTTPDSVGAEIAAELGIPFLRRDIFIDHHREPEQIRTQIDRLLNIAE 314

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             G A+G+   + E++ V+ +   + + R V +V L  L K  
Sbjct: 315 KRGWAVGLGHPYPETLRVLQEKEGELNRR-VRLVKLDQLVKQH 356


>gi|220936444|ref|YP_002515343.1| protein of unknown function DUF610 YibQ [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|219997754|gb|ACL74356.1| protein of unknown function DUF610 YibQ [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 279

 Score =  225 bits (573), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 51/222 (22%), Positives = 97/222 (43%), Gaps = 5/222 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
                IAI++  LG +Q G  +    LP  +T+A   +         EA  +G+E +L +
Sbjct: 32  PPRPFIAIIIDDLG-NQPGPGQRTLALPGPVTVAVLPHTPFARPLANEAHAQGKEVMLHL 90

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQA +          + V    + L      +L       GV N+ G++L  +    + 
Sbjct: 91  PMQATE--ALPLGPGGITVDMEREALRETFLAALASVPHVRGVNNHMGSLLTRHIGHMDW 148

Query: 288 IFKEF-AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD-RDKIREKLKGLE 345
              E  A+ GL F D  ++  ++ + +A    LP    D++LD   D  + +  ++  L 
Sbjct: 149 FMAELAAQSGLYFVDSRTTALSVAQRVALHHGLPATRRDVFLDTLPDNEEFVEAQMDQLI 208

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC 387
            +A+  G A+ +   +  +++V+ + L   H   + +VP+S 
Sbjct: 209 SLAQRRGHALAIGHPYGATLDVLERRLATLHEAGIELVPVSE 250


>gi|322514546|ref|ZP_08067579.1| divergent polysaccharide deacetylase [Actinobacillus ureae ATCC
           25976]
 gi|322119485|gb|EFX91572.1| divergent polysaccharide deacetylase [Actinobacillus ureae ATCC
           25976]
          Length = 282

 Score =  224 bits (572), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 43/226 (19%), Positives = 101/226 (44%), Gaps = 4/226 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G        AI  LP  +++A            K+A ++ ++ ++ +
Sbjct: 26  AHAGKLAIVIDDIGYRMKK-DNAIYALPKEVSVAIIPVAPYATARAKKAYEQKRDVLIHL 84

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ  ++    + S  L +  +  ++   ++ +  +     G+ N+ G+   +++ +   
Sbjct: 85  PMQPKNKQQPIE-SGALMIGASEVKVAQLIQAARNQVPYAIGLNNHMGSGATADRTTMSH 143

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           + K  A++ L F D  + P ++   +A +  +  +  +L+LDD      ++ +     E 
Sbjct: 144 LMKVMAQQQLFFLDSKTGP-SVAAKVAREYGVKALERNLFLDDSDALSDVQRQFNAAIEY 202

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           AR  G AI +      S+ V+ Q +     +D+ +V +  L +  +
Sbjct: 203 ARKHGSAILIGHPRKNSVAVLEQGIANLP-QDIQLVSMGSLWRNET 247


>gi|254420794|ref|ZP_05034518.1| Divergent polysaccharide deacetylase family [Brevundimonas sp.
           BAL3]
 gi|196186971|gb|EDX81947.1| Divergent polysaccharide deacetylase family [Brevundimonas sp.
           BAL3]
          Length = 396

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 78/385 (20%), Positives = 139/385 (36%), Gaps = 20/385 (5%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPI 69
           R K   +    +     +   L     +   ++++ +                +      
Sbjct: 20  RGKPSLKPVVAALKKPPVIAGLSGLFLLSATALFLTVLGDPRAG--TPSARIALHREEAA 77

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
           P   P   E     +      +        +     +     G TV    + S  + +  
Sbjct: 78  PAPAPTGFEAFSMGAMGLYQDLTGTGDPSGAAGGEAVITLPDGATVAGGASYSAPVQAAS 137

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSGLGIS 183
            + +  I GLS+         G      P       + A         R+A++V GLG++
Sbjct: 138 PLAKAPIAGLSQPG-----ASGPLPMIAPDGRVPAQAYARPFRSNGKPRVALIVGGLGLN 192

Query: 184 QTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT 243
              T+ AI  LP  +TL+F    ++L  W+ +A+ +G E +L++PM+      N+   YT
Sbjct: 193 AVTTRAAIERLPPEVTLSFVPYADNLQSWIDQARAQGHEVMLEMPMEPTGYPDNDPGPYT 252

Query: 244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDG 303
           L  + T   +  ++ + L R  GYFGV NY G    ++            +RG+ F DDG
Sbjct: 253 LLASGTPDDVQAKMDWLLGRAVGYFGVTNYLGDRFATSDTGMSAFLSTLRQRGIAFLDDG 312

Query: 304 SSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDE 363
           S  R                AD  +D       I   L  LE  A+  G A+G   ++  
Sbjct: 313 SFQR-------RPGAWARASADKVIDQTQSPAAIIAALNSLEAQAKLRGSALGTGFSYPV 365

Query: 364 SIEVISQWLQQEHVRDVSVVPLSCL 388
           ++E  ++W      R + + P S +
Sbjct: 366 TVEAAARWTAGLEQRGLQLAPASAM 390


>gi|83944752|ref|ZP_00957118.1| hypothetical protein OA2633_08994 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851534|gb|EAP89389.1| hypothetical protein OA2633_08994 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 405

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 94/383 (24%), Positives = 152/383 (39%), Gaps = 25/383 (6%)

Query: 19  FYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIE 78
            +      L    +    I+G++    ++     TIS     +   E     +     IE
Sbjct: 8   RFPLKAPLLAGLGVAAALIIGVAALTWLAGGPAPTISASADIAGQPE-----VLASAPIE 62

Query: 79  DKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILG 138
                   D       L       D    +D  G T             LP         
Sbjct: 63  GDHGAPFSDGQADEVSLPGVRDTADALSAHDAGGHTTAQPAAPQAPPAPLP--------- 113

Query: 139 LSKKELLAKNKVGREDTEVPAMDKNFCSNAS-------GARIAIVVSGLGISQTGTQRAI 191
                L      G       + ++   + A           ++++V GLG+SQ+ T+RAI
Sbjct: 114 ----GLYENGPGGPLPVISASGERPDQAYAHDFPGAENVPTVSVIVGGLGLSQSLTERAI 169

Query: 192 NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQ 251
            +LPA +TL+FA   ++L  W+  A+  G E +L++PM+ FD   N+   +TL V  + Q
Sbjct: 170 EVLPAEVTLSFAPYADNLQDWINRARADGHEVLLELPMEPFDYPNNDPGPHTLLVDASSQ 229

Query: 252 QLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
           +   RL + L R  GY GV NY GA L + +     IF E   RGL  F DG+  R +  
Sbjct: 230 ENTRRLVWLLSRAAGYTGVANYLGARLGAAEGPLSEIFSELEARGLSIFHDGAGRRAVLE 289

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQW 371
               + +    +AD  +D       I  +L  LE +A   G A+G   A+  +++ I+ W
Sbjct: 290 QAGRQAHARMTIADRVVDSDPTPRAIDGRLLELEALALQNGSALGSGFAYPATVDTIAAW 349

Query: 372 LQQEHVRDVSVVPLSCLAKLSSP 394
            +    R   + P S + ++ SP
Sbjct: 350 AEGLDGRGYQLAPASFVMQIRSP 372


>gi|303252828|ref|ZP_07338987.1| hypothetical protein APP2_1780 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302648258|gb|EFL78455.1| hypothetical protein APP2_1780 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
          Length = 264

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 47/224 (20%), Positives = 103/224 (45%), Gaps = 6/224 (2%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A   ++AIV+  +G  +T    AI  LP  +++A            ++A ++ ++ ++ +
Sbjct: 8   AQAGKLAIVIDDIGY-RTKEDNAIYALPKEVSVAIIPVAPYATARAQKAYEQKRDVLIHL 66

Query: 228 PMQAFD-ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           PMQ  +     E     L V  + + +   ++ +  +     G+ N+ G+   +++++ E
Sbjct: 67  PMQPKNRHQPIESG--ALMVGASKENVARLIQAARNQVPYAIGLNNHMGSGATADRQTME 124

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +  E +K+ L F D  + P ++   +A +L +  +  +L+LDD     +++ +      
Sbjct: 125 HLMTELSKQQLFFLDSKTGP-SVAAKVARELGVNALERNLFLDDNDALHEVQNQFHLALH 183

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AR  G AI +      SIEV+ + L      D+ +V +  L +
Sbjct: 184 YARKHGSAILIGHPRKNSIEVLEKGLANLPE-DIQLVSMGSLWR 226


>gi|154148192|ref|YP_001405976.1| polysaccharide deacetylase family protein [Campylobacter hominis
           ATCC BAA-381]
 gi|153804201|gb|ABS51208.1| divergent polysaccharide deacetylase family [Campylobacter hominis
           ATCC BAA-381]
          Length = 354

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 54/379 (14%), Positives = 131/379 (34%), Gaps = 32/379 (8%)

Query: 11  KKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIP 70
           KK  K +      + +  + +LFC   +    +IL    F G I              + 
Sbjct: 2   KKISKGRHKKRPELLKFTIIILFCIVCIAFGYWIL--ELFFGRIPT---EISKTAPKAVE 56

Query: 71  LTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSI-DSLP 129
             I    ++ +  +  +   +     N+    + ++        +V     S    D   
Sbjct: 57  QNISSPKKNDEILTIEE---IVKYKPNNIESKNVEVAKSAENSKIVGGTEISDQNLDVNT 113

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
           T E   + G++ +                         +   ++AI++  +  S     +
Sbjct: 114 TNEISGLEGVNSQ---------------TNEKIFVKPRSKKPKLAIIIDDM--SNENDAK 156

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
            +  +   +T +F           + AK      ++ +P++A +         T+ +  +
Sbjct: 157 NLKAVGLKLTPSFFPRSKFTPHTPQIAKNFKH-FMIHLPLEALNYKDE---LDTILIGDS 212

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
             ++  ++R           + N+ G+   SN+++ E ++   +     F D  +   + 
Sbjct: 213 ALRIEAKIRSIRSDFPNARFINNHTGSKFTSNQKAMERLYNVLSIYNFDFVDSLTVGNSK 272

Query: 310 TRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVIS 369
            + +A      Y+  D++LD+  +  +IR+ LK   ++A   G AI +     E+ + + 
Sbjct: 273 VQKVAQNRGKRYIYRDVFLDNIQNVAEIRKMLKKAVKVAHEKGFAIAIGHPKKETFKALG 332

Query: 370 QWLQQEHVRDVSVVPLSCL 388
                    DV +V +  +
Sbjct: 333 TSGDIL--GDVEIVYVDEI 349


>gi|116053282|ref|YP_793605.1| hypothetical protein PA14_67820 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115588503|gb|ABJ14518.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa UCBPP-PA14]
          Length = 257

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 99/232 (42%), Gaps = 7/232 (3%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
               ++         + +V+  LG +     R +  LP  +TLA            +EA 
Sbjct: 18  AQARQDPVPYQRPPLLTVVIDDLGQNLAR-DRRVLDLPPGVTLAIIPETPHAAELAREAH 76

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           ++G+  IL +PM            Y  +   T ++   RL  +L +     G+ N+ G+ 
Sbjct: 77  QRGRTVILHMPMDPAG------GPYAWRPELTQEERARRLDAALAKVPFVQGLNNHEGSR 130

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + + + +   + +E  +RGL   D  +S   +    A ++ L  +  D++LD++   + +
Sbjct: 131 MTAVRPAMAWLAEELQRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAV 190

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +L+    +AR  G A+ +      +++V+++ L +   + + +VP   L 
Sbjct: 191 SAQLQAGIALARKQGSALLIGHPHKATLDVLARELPKLRAQGIELVPPQMLI 242


>gi|257460562|ref|ZP_05625663.1| divergent polysaccharide deacetylase family protein [Campylobacter
           gracilis RM3268]
 gi|257441893|gb|EEV17035.1| divergent polysaccharide deacetylase family protein [Campylobacter
           gracilis RM3268]
          Length = 401

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 61/407 (14%), Positives = 144/407 (35%), Gaps = 38/407 (9%)

Query: 9   LRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAP 68
           +    P+       I      F++   F+ G   Y ++   F G  + +   S  R+ A 
Sbjct: 1   MANANPRGHRKKRPINYIAIAFVVILCFLSGAVTYAVLDLVFSGNKAALQQSS--RKQAS 58

Query: 69  IPLTIPLNIEDKQSPSKRD-----------------NNTVCNQLKNDSSQHDGQIQNDIS 111
              + P   + + S ++++                         + +S+  +   QN  +
Sbjct: 59  KSTSDPRGKKPRLSAAEKEALIQKELDKIAEQNVTAPKMSIEPARQNSAGQNLVRQNSSN 118

Query: 112 GKTVVNKPTRSTSIDSLP--TIEERLILGLSKKELLAKN--KVGREDTEVPAMD-----K 162
           G +  +  + +++  +      +   +   +       +     +      A D     +
Sbjct: 119 GDSQNSANSMASANSAAVNSAGDGSDVNFTAANSASENSINSTAQSPASGSADDLSKSPR 178

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
                 S A++AI++  +G       + I  LP  +T +         R    +  +G E
Sbjct: 179 KALPAGSRAKLAIIIDDVGTD--EQAQKIAALPVRVTPSIFP--PEYQRKDTRSLARGFE 234

Query: 223 -AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
              + +PM+A     N     TL+ +   ++L   +            + N+ G+   ++
Sbjct: 235 HYAIHLPMEASSAKNNSA---TLRASDNYEKLRGVIAKLRADFPNAKFINNHTGSKFTAD 291

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           + + + + +   + G LF D  +SP    +       + Y+  D++LD+Q     +R+KL
Sbjct: 292 ERAMQNLLRAMNEHGFLFIDSRTSPATKAKAAMNGFGMRYVHRDVFLDNQNSVAAVRKKL 351

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +    +A+  G AI +      ++  ++          V +V L  +
Sbjct: 352 REAVALAKKQGYAIAIGHPKSSTLRALANSSDILGE--VDLVYLDEI 396


>gi|120601972|ref|YP_966372.1| hypothetical protein Dvul_0924 [Desulfovibrio vulgaris DP4]
 gi|120562201|gb|ABM27945.1| protein of unknown function DUF610, YibQ [Desulfovibrio vulgaris
           DP4]
          Length = 461

 Score =  223 bits (569), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 45/235 (19%), Positives = 93/235 (39%), Gaps = 2/235 (0%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           +    +   GA +AIV+  +G S  G  R +  L   +T A     +      + A + G
Sbjct: 227 EPRPGTPVEGALLAIVIDDIGESM-GAVRDLLKLDYPVTFAVWPRSSHAREAAEAAHRAG 285

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
           +E ++  PM+       +     + V     ++   LR +L R     G+ N+ G+    
Sbjct: 286 REVMIHQPMEPLKYPSVKPGPGAIYVRMGRDEIEATLRDNLARVPHAVGLNNHMGSRFTQ 345

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +      + +    +GL   D  +   ++    A +  LP    +++LD   D+  I  +
Sbjct: 346 DVRGVRAVCEALEGKGLFVLDSVTHSGSVFYREARRAGLPAGKRNVFLDVIHDKRNIMFQ 405

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           L     +A   G A+ +     E++  + +W Q+   + V +V +  L    + +
Sbjct: 406 LDKAARVAHEQGVAVAIGHPLAETVAALKEW-QRTRDKSVRIVTMRQLLDAETTA 459


>gi|15600328|ref|NP_253822.1| hypothetical protein PA5135 [Pseudomonas aeruginosa PAO1]
 gi|218894234|ref|YP_002443103.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa LESB58]
 gi|254243986|ref|ZP_04937308.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296391985|ref|ZP_06881460.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa PAb1]
 gi|313110177|ref|ZP_07796076.1| hypothetical protein PA39016_002260002 [Pseudomonas aeruginosa
           39016]
 gi|9951434|gb|AAG08520.1|AE004926_10 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126197364|gb|EAZ61427.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218774462|emb|CAW30279.1| putative divergent polysaccharide deacetylas [Pseudomonas
           aeruginosa LESB58]
 gi|310882578|gb|EFQ41172.1| hypothetical protein PA39016_002260002 [Pseudomonas aeruginosa
           39016]
          Length = 257

 Score =  223 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 99/232 (42%), Gaps = 7/232 (3%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
               ++         + +V+  LG +     R +  LP  +TLA            +EA 
Sbjct: 18  AQARQDPVPYQRPPLLTVVIDDLGQNLAR-DRRVLDLPPGVTLAIIPETPHAAELAREAH 76

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           ++G+  IL +PM            Y  +   T ++   RL  +L +     G+ N+ G+ 
Sbjct: 77  QRGRTVILHMPMDPAG------GPYAWRPELTQEERARRLDAALAKVPFVQGLNNHEGSR 130

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + + + +   + +E  +RGL   D  +S   +    A ++ L  +  D++LD++   + +
Sbjct: 131 MTAVRPAMAWLAEELQRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAV 190

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +L+    +AR  G A+ +      +++V+++ L +   + + +VP   L 
Sbjct: 191 SAQLQAGVALARKQGSALLIGHPHKATLDVLARELPKLRAQGIELVPPQMLI 242


>gi|332307949|ref|YP_004435800.1| hypothetical protein Glaag_3602 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332175278|gb|AEE24532.1| protein of unknown function DUF610 YibQ [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 273

 Score =  222 bits (566), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 42/212 (19%), Positives = 90/212 (42%), Gaps = 3/212 (1%)

Query: 178 SGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYN 237
             +G +      A   LP N+ ++   + +   ++   A ++ +E +L +PM++      
Sbjct: 45  DDVGNNHHR-DAAALTLPVNVAISILPHKHFSQKYALLAHEQRREYLLHMPMESMAGLKQ 103

Query: 238 EDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGL 297
           E     L  +   + ++  L  +        G+ N+ G+ L   +           + GL
Sbjct: 104 EA--NVLLASMNDKTIVQTLHAAFASVPNALGMNNHMGSRLTQLETPMRTTMDYLHRHGL 161

Query: 298 LFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGV 357
           +F D  +S +     +A + N+P +   ++LD+ +  DKI  +   L   AR  G++I +
Sbjct: 162 IFVDSRTSAQTQAEAIAKQQNVPALRRHVFLDNVLAEDKIALQFNLLVRKARKYGRSIAI 221

Query: 358 AVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
                ++I  + + L      +V +VPLS + 
Sbjct: 222 GHPHKQTIAYLQKRLPTLAQENVQLVPLSAML 253


>gi|254447505|ref|ZP_05060971.1| polysaccharide deacetylase family protein [gamma proteobacterium
           HTCC5015]
 gi|198262848|gb|EDY87127.1| polysaccharide deacetylase family protein [gamma proteobacterium
           HTCC5015]
          Length = 270

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 45/218 (20%), Positives = 93/218 (42%), Gaps = 4/218 (1%)

Query: 174 AIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           AI++  +G + T + R I  +P  +T A      + +R  +      +E +L +PMQ   
Sbjct: 29  AIIIDDIGYN-TVSARRIAAMPWPLTCAVLPEAVASERAAQILADADKELMLHLPMQGRL 87

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
               E   + L +          +   L R     G+ N++G++L + ++    +  E +
Sbjct: 88  GEARE--PHVLNINMDRHHFRQEVLRQLDRFPRVVGINNHQGSVLTTRQQPMNWLMDELS 145

Query: 294 K-RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
                   D  ++  +L +  A    LP    D++LD Q +   I  ++     +A+ +G
Sbjct: 146 TIENFYVVDSRTASDSLLQASAQHYQLPNSTRDVFLDHQRNEAYIARQVLEFVRVAKASG 205

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            AI +   + E++ V+ + L       V ++P+S L +
Sbjct: 206 SAIAIGHPYPETLNVLEKALPYFESEGVRLLPVSQLIR 243


>gi|332289073|ref|YP_004419925.1| Divergent polysaccharide deacetylase [Gallibacterium anatis UMN179]
 gi|330431969|gb|AEC17028.1| Divergent polysaccharide deacetylase [Gallibacterium anatis UMN179]
          Length = 273

 Score =  222 bits (566), Expect = 7e-56,   Method: Composition-based stats.
 Identities = 49/222 (22%), Positives = 107/222 (48%), Gaps = 4/222 (1%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           + A++AIV+  +G  +     AI  LP  + +A   +     +  K+A ++G++A++ +P
Sbjct: 20  NAAQLAIVIDDIGY-RAHEDNAIFALPLAVNVAIIPSAPYAQQRAKQAHQQGRDALIHMP 78

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           MQ       + ++  L +  T  Q+ +R+  +        G+ N+ G+   S+     ++
Sbjct: 79  MQPKS--NIKLEANGLVLGLTPAQVSHRIDLAQNIVPNAIGMNNHMGSAATSDSGLMHIL 136

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
            ++ A+RGL F D  +   ++   +A +  +  +  +++LDD  +   I+++ +   + A
Sbjct: 137 MQQLAQRGLSFLDSKTIGSSVAGKIAKQYGVSALERNIFLDDNNEYANIQQQFQQAIQYA 196

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           R    AI +      +I V+ Q L Q    D+ +V +S L +
Sbjct: 197 RKHQTAIVIGHPRKNTIAVLQQQLSQLPA-DIELVKISRLWQ 237


>gi|240949054|ref|ZP_04753405.1| hypothetical protein AM305_09111 [Actinobacillus minor NM305]
 gi|240296527|gb|EER47152.1| hypothetical protein AM305_09111 [Actinobacillus minor NM305]
          Length = 264

 Score =  222 bits (565), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 45/223 (20%), Positives = 98/223 (43%), Gaps = 4/223 (1%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A  A++AIV+  +G S    QR +  LP  I++A   +        + A  + ++ ++ +
Sbjct: 7   AQAAKLAIVIDDIGYSVREDQR-VYQLPKEISVAIIPSAPYAKVRAENAFAQKRDILIHL 65

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PMQ  +     +    L V     +  + L  + +      G+ N+ G+   ++K +   
Sbjct: 66  PMQPQNAQQAIEKP-ALLVGDDFAKAQSLLENARQHVPYAIGLNNHMGSGATADKATMRH 124

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
             +  A + L F D  + P ++   +A +  +  +   ++LDD  + + +  + +  +  
Sbjct: 125 FMQALAAQKLFFLDSKTGP-SVATKVAAEFGINALERHVFLDDSNEYNDVMHQFQQAKAY 183

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           AR  G AI +      SI+V+ + L+     D+ +V +  L +
Sbjct: 184 ARKHGVAILIGHPRKNSIDVLEKELKTLPA-DIQLVSMGSLWR 225


>gi|107104231|ref|ZP_01368149.1| hypothetical protein PaerPA_01005304 [Pseudomonas aeruginosa PACS2]
 gi|254238163|ref|ZP_04931486.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126170094|gb|EAZ55605.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 257

 Score =  222 bits (565), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 99/232 (42%), Gaps = 7/232 (3%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
               ++         + +V+  LG +     R +  LP  +TLA            +EA 
Sbjct: 18  AQARQDPAPYQRPPLLTVVIDDLGQNLAR-DRRVLDLPPGVTLAIIPETPHAAELAREAH 76

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           ++G+  IL +PM            Y  +   T ++   RL  +L +     G+ N+ G+ 
Sbjct: 77  QRGRTVILHMPMDPAG------GPYAWRPELTQEERARRLDAALAKVPFVQGLNNHEGSR 130

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + + + +   + +E  +RGL   D  +S   +    A ++ L  +  D++LD++   + +
Sbjct: 131 MTAVRPAMAWLAEELQRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAV 190

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +L+    +AR  G A+ +      +++V+++ L +   + + +VP   L 
Sbjct: 191 SAQLQAGVALARKQGSALLIGHPHKATLDVLARELPKLRAQGIELVPPQMLI 242


>gi|228964394|ref|ZP_04125508.1| hypothetical protein bthur0004_12430 [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228795251|gb|EEM42743.1| hypothetical protein bthur0004_12430 [Bacillus thuringiensis
           serovar sotto str. T04001]
          Length = 221

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 41/191 (21%), Positives = 84/191 (43%), Gaps = 1/191 (0%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
           +P+      +NA   ++AIV+   G +  GT   +  LP  +T+A      S       A
Sbjct: 15  LPSFLFPIQANAHTNKVAIVIDDFGNNMKGT-NQMLSLPIPLTVAVMPFLPSTKEDAIAA 73

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            KKG E I+ +PM+             +    + +++ NRL  +++      G+ N+ G+
Sbjct: 74  HKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSDEEINNRLEQAIQEVPHAIGMNNHMGS 133

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
            + +++    +I     K GL + D  ++P ++   +  +L +P +   L+ DD      
Sbjct: 134 KVTADERIVRLILAACKKHGLFYLDSKTNPNSVVPKIGKELGVPIIENQLFFDDVYTAGH 193

Query: 337 IREKLKGLEEI 347
           I ++ + L + 
Sbjct: 194 ISKQAQLLIKK 204


>gi|15614055|ref|NP_242358.1| hypothetical protein BH1492 [Bacillus halodurans C-125]
 gi|10174109|dbj|BAB05211.1| BH1492 [Bacillus halodurans C-125]
          Length = 273

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 96/225 (42%), Gaps = 5/225 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R AI++   G    G    +      +T+A         +  + A+  G E I+ +P++ 
Sbjct: 33  RAAIIIDDFGGDVKGVDDFLTG-EIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEP 91

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +    +V ++ +R+R +        G+ N+ G+ ++ N++    I + 
Sbjct: 92  KKGKISWLGPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEV 151

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV-DRDKIREKLKGLEEIART 350
             ++     D G+SP +L   LA +L +PY    ++LD+    R ++ + ++ L + A+ 
Sbjct: 152 VKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEVIKNMRKLAKKAKQ 211

Query: 351 TGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             + IG+       DE+   I   L +     + +VP+S L    
Sbjct: 212 GSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLPSP 256


>gi|313672937|ref|YP_004051048.1| hypothetical protein Calni_0974 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939693|gb|ADR18885.1| protein of unknown function DUF610 YibQ [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 408

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 42/265 (15%), Positives = 92/265 (34%), Gaps = 5/265 (1%)

Query: 126 DSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQT 185
           D L          +  KE++ + K   +      ++          R+AI++   G +  
Sbjct: 147 DILEIYNASKENDVENKEMVKEPKADFKKDV--KINSKNSKIEPKHRLAIILDDSGQNLE 204

Query: 186 GTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLK 245
              R +  +   + L+              A+K  +E  L  PM+             + 
Sbjct: 205 L-ARKVLSMKYPVVLSILPYTQYDRETADLARKYKREFFLHQPMEPKSYPDTNPGKGAIL 263

Query: 246 VTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSS 305
           +      +   ++ ++ R  G  GV N+ G+    N +  +           +F D  ++
Sbjct: 264 LNMPKSVIEVTIKENINRLEGVDGVNNHMGSAFTENADKMKEALDTIKDYTKIFVDSHTT 323

Query: 306 PRNLTRVLAPKL-NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
           P  +   +  K   L   ++  ++D+  D+D I  KL         +   I +    + +
Sbjct: 324 PDTVAYEVCKKTEGLKCGISKRFIDNSADKDYITNKLYEAAGF-LKSQDVIVIGHLRNNT 382

Query: 365 IEVISQWLQQEHVRDVSVVPLSCLA 389
           ++V+   L Q     V +V +S + 
Sbjct: 383 VDVLEDVLPQLEKMGVRIVTISEVV 407


>gi|332531758|ref|ZP_08407643.1| hypothetical protein PH505_aa00630 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332038734|gb|EGI75176.1| hypothetical protein PH505_aa00630 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 208

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 41/196 (20%), Positives = 88/196 (44%), Gaps = 2/196 (1%)

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           ++ +   +      +   A +  +E +L +PMQA +    E     L +    +QL   L
Sbjct: 1   MSYSILPHTPYSQIFATLASQSNKELLLHVPMQALNGK--ELGPGALTLNMNKEQLQQTL 58

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
             +L       GV N+ G+ L    ++ +   +   KR L F D  ++  +  +  A  L
Sbjct: 59  GTALASLPQVKGVNNHMGSALTQKSQAMKWTMEVLKKRHLYFLDSRTTDLSQAQNAANFL 118

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
            +  +   ++LD+    ++++ +L+ L+++A +   AI +A  + E+IE +   L +   
Sbjct: 119 GVANISRQVFLDNITTPEQLQLRLEELKQLAISHSFAIAIAHPYPETIEFLRHALPELTK 178

Query: 378 RDVSVVPLSCLAKLSS 393
           +   +VP+S L +   
Sbjct: 179 QGFELVPVSQLVERKY 194


>gi|85858725|ref|YP_460927.1| polysaccharide deacetylase [Syntrophus aciditrophicus SB]
 gi|85721816|gb|ABC76759.1| polysaccharide deacetylase [Syntrophus aciditrophicus SB]
          Length = 334

 Score =  220 bits (560), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 45/287 (15%), Positives = 99/287 (34%), Gaps = 11/287 (3%)

Query: 94  QLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRE 153
             +        +   +  G+    +P           + E             K      
Sbjct: 47  PQEETRPPEITRSIPEHRGEKHRIEPGEIPLPVPERPVTEAPGTEKPVPPPTEK------ 100

Query: 154 DTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
                   K      SG RIAI++  +G   +  +  +  + A I+ A   +        
Sbjct: 101 ---ATPTTKAPKERVSGLRIAILIDDIGADLSPVKN-LLKIEAPISFAVLPHMPRGAAAA 156

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
               K G++ +L +PM+       +     L  T    +L   L  +L       GV N+
Sbjct: 157 DMIHKAGRDVLLHLPMEPRSYPKEKPGPGALLTTMDDSELRKVLTGNLDAVPHISGVNNH 216

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G++   ++E   ++  E  KRGL F D  ++P +    ++  + +P+    +++D+  D
Sbjct: 217 MGSLFTEDEEKLAIVMAELEKRGLFFIDSRTTPYSKAAKVSQDIGIPFASRRIFIDNGQD 276

Query: 334 RDKIREK-LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRD 379
             K  +  L  L +        + +   +  ++  +++ + +   R 
Sbjct: 277 YTKTCQILLDVLNKTKDGNSTLLLIGHPYPNTVSALAKIVPELKSRG 323


>gi|304322188|ref|YP_003855831.1| yibQ gene product [Parvularcula bermudensis HTCC2503]
 gi|303301090|gb|ADM10689.1| yibQ gene product [Parvularcula bermudensis HTCC2503]
          Length = 323

 Score =  219 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 62/296 (20%), Positives = 122/296 (41%), Gaps = 7/296 (2%)

Query: 98  DSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV 157
            +    G +    +     +       +       +       K +  +   +G      
Sbjct: 21  AAGSALGTMVVLSTSPARPSPEPLRNLVVEARAAGQAASPHAPKDDAGSI-DLGEVHLRS 79

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P+         +  RIA+V+  +G S     R +N LP  +T+AF          +    
Sbjct: 80  PSPPWRRVDFHARPRIALVIDDMGYSWAAYDR-LNDLPVPLTMAFLPFSADAQEMIDALW 138

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
            +  +AI+ +PM+   E++       L        +   L  +L +  GY GV N+ G+ 
Sbjct: 139 PR-HDAIVHLPMEPIAETHL-AGPGMLSTDMDADAIKWGLLAALSQLRGYSGVNNHTGSR 196

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD---DQVDR 334
             +++    V+  E  +RGL F D  ++PR +  ++A       +  +++LD   D +  
Sbjct: 197 FTADRARMAVVLGELNRRGLFFLDSITTPRPVAHLIAEAEGFSVLERNVFLDSDYDTLTS 256

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++R +L  LE IA++ GQAIG+   +  +++V+ +W +    R  S+V +  LA 
Sbjct: 257 QQVRTQLAKLERIAQSEGQAIGIGHPYAITLDVVERWAEDVEARGFSLVLVKDLAP 312


>gi|255321385|ref|ZP_05362545.1| ferric-uptake regulator [Campylobacter showae RM3277]
 gi|255301538|gb|EET80795.1| ferric-uptake regulator [Campylobacter showae RM3277]
          Length = 545

 Score =  219 bits (557), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 52/324 (16%), Positives = 120/324 (37%), Gaps = 14/324 (4%)

Query: 65  EIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTS 124
              P     PL    K+     + + V +   + + Q   +++ D    T + +      
Sbjct: 235 TPMPQAQNNPLEQALKKEKIHIEFSDVKSVTNDQAGQ--VEVEFDAENATQIAEKNEQEK 292

Query: 125 IDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQ 184
            +   + ++        K+   K+     + +               R+ I++  +    
Sbjct: 293 SEKEKSKKDEKAKFADTKKTDKKSATETNEVKAA------VKAGYKPRLVIIIDDVAY-- 344

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
                AI  +   +T +F    ++       A++     ++ +PMQA       +   TL
Sbjct: 345 KHQADAIKAVNLKLTPSFFPATSAHPETPVLARRFSF-YMIHLPMQALGGFKGAE-IGTL 402

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
            V    +++  +L+   R       + N+ G+   S+  + + + +      L+F D  +
Sbjct: 403 TVDDDYEKIAKKLQSIKRDFPNLKYINNHTGSRFTSDAAAMDRMMRAVRDENLIFVDSKT 462

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
           +        A K ++PY+  D++LD    +  +R++LK   ++A+    AI +      +
Sbjct: 463 TSPTKVYGAAKKYSMPYIARDVFLDHDGSKAAVRKQLKYAVKLAKNRSYAIAIGHPHKNT 522

Query: 365 IEVISQWLQQEHVRDVSVVPLSCL 388
           +EV+ +  +      V VV L  L
Sbjct: 523 LEVLQESAKLLQE--VEVVYLKDL 544


>gi|119390469|pdb|2NLY|A Chain A, Crystal Structure Of Protein Bh1492 From Bacillus
           Halodurans, Pfam Duf610
          Length = 245

 Score =  219 bits (557), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 45/225 (20%), Positives = 96/225 (42%), Gaps = 5/225 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R AI++   G    G    +      +T+A         +  + A+  G E I+ +P++ 
Sbjct: 5   RAAIIIDDFGGDVKGVDDFLTG-EIPVTVAVMPFLEHSTKQAEIAQAAGLEVIVHMPLEP 63

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      +    +V ++ +R+R +        G+ N+ G+ ++ N++    I + 
Sbjct: 64  KKGKISWLGPSGITSNLSVGEVKSRVRKAFDDIPYAVGLNNHMGSKIVENEKIMRAILEV 123

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV-DRDKIREKLKGLEEIART 350
             ++     D G+SP +L   LA +L +PY    ++LD+    R ++ + ++ L + A+ 
Sbjct: 124 VKEKNAFIIDSGTSPHSLIPQLAEELEVPYATRSIFLDNTHSSRKEVIKNMRKLAKKAKQ 183

Query: 351 TGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             + IG+       DE+   I   L +     + +VP+S L    
Sbjct: 184 GSEPIGIGHVGVRGDETYAGIRSMLDEFQAESIQLVPVSQLLPSP 228


>gi|224417738|ref|ZP_03655744.1| putative periplasmic protein [Helicobacter canadensis MIT 98-5491]
 gi|253827082|ref|ZP_04869967.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313141280|ref|ZP_07803473.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|253510488|gb|EES89147.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
 gi|313130311|gb|EFR47928.1| conserved hypothetical protein [Helicobacter canadensis MIT
           98-5491]
          Length = 367

 Score =  218 bits (556), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 54/347 (15%), Positives = 122/347 (35%), Gaps = 23/347 (6%)

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
               E  P     P  +E K +     +       K+     D +   D        +  
Sbjct: 24  IPNEEPKPTQNKTPKAVETKPNAQDTKDTKDTKDTKDTKDTKDTKDTKDTKDTKDTKEIN 83

Query: 121 RSTSIDSLPTIEERLILGLSK--KELLAKNKVGREDTEVPAMDK-------NFCSNASGA 171
                 +L  ++E L     +  +  +  +    + T +   ++             +  
Sbjct: 84  NVLIQKNLDFLKENLSTPKQQDSQPKIKSSPTIPQTTPIQPKEQETNTAKTTPICQKTKP 143

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++AI++    +S     R +  +P  IT +F     +     K A       ++ +P++A
Sbjct: 144 QLAIIIDD--VSNYEQYRRLQEIPYKITPSFFPKTIASKNTPKIAATAPF-YMVHLPLEA 200

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            +    E     L    + Q + +R++   +       + N+ G+    N ++ + +   
Sbjct: 201 LNFYQKE--HLWLFSDDSKQTIQDRIQAIKKDFPNLTYINNHTGSKFTQNLQAMQNLLTI 258

Query: 292 FAKRGLLFFDDGSSPRNLTR---------VLAPKLNLPYMVADLYLDDQVDRDKIREKLK 342
             +  + F D  ++P+  T           L P  N P++  +++LD+++D  KI + L 
Sbjct: 259 LNENNITFVDSRTTPKTKTALYYKNNPTKSLNPCQNTPFLERNVFLDNELDISKITQNLI 318

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              E A+  G AI +     E+I  +    +      +  V ++ L 
Sbjct: 319 KAIETAKIKGYAIAIGHPHKETILALKNASEYLQKSGIEAVYINELI 365


>gi|149193944|ref|ZP_01871042.1| hypothetical protein CMTB2_02628 [Caminibacter mediatlanticus TB-2]
 gi|149135897|gb|EDM24375.1| hypothetical protein CMTB2_02628 [Caminibacter mediatlanticus TB-2]
          Length = 332

 Score =  218 bits (556), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 100/235 (42%), Gaps = 7/235 (2%)

Query: 156 EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
                +     +    ++ I++    +S       I  +P  IT +F    N     +  
Sbjct: 104 PTIKTEPKKIKHNHKPKLVIIIDD--VSFKYQTNLIKQIPYKITPSFFPPTNRHPNTIYL 161

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           AK      ++ +P++A +      +  T+ ++ T Q++ NR+ Y  +       + N+ G
Sbjct: 162 AKSFSH-YMVHLPLEAKNYHK--PEPNTITISSTYQEIYNRIVYLKKIFPKAKFMNNHTG 218

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           +   S+KES + +FK F K  L F D  +S      ++    N+P+   +++LD+  D++
Sbjct: 219 STFTSDKESMKKLFKVFKKENLGFVDSVTSANTKGELVDKIYNIPFYKRNIFLDNIQDKN 278

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            IR++L     +A+  G AI +      ++  +          +V VV +  L K
Sbjct: 279 YIRKQLLKAVMLAKKHGYAIAIGHPHKITLITLKNSKDILK--NVDVVYIDELNK 331


>gi|152985938|ref|YP_001351189.1| hypothetical protein PSPA7_5870 [Pseudomonas aeruginosa PA7]
 gi|150961096|gb|ABR83121.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 258

 Score =  218 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 45/232 (19%), Positives = 99/232 (42%), Gaps = 7/232 (3%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
               +          + +V+  LG +     R +  LP+ +TLA            +EA 
Sbjct: 19  AQARQESAPYQRPPLLTVVIDDLGQNLAR-DRRVLDLPSGVTLAIIPETPHAAELAREAH 77

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           ++G+  IL +PM            Y  +   T ++   RL  +L +     G+ N+ G+ 
Sbjct: 78  QRGRTVILHMPMDPAG------GPYAWRPELTQEERARRLDAALAKVPFVQGLNNHEGSR 131

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + + + +   + +E  +RGL   D  +S   +    A ++ L  +  D++LD++   + +
Sbjct: 132 MTAVRPAMAWLAEELQRRGLYLVDSRTSAATVAASEAQRIGLASVSRDVFLDNEATPEAV 191

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +L+    +AR  G A+ +      +++V+++ L +   + + +VP   L 
Sbjct: 192 SAQLQAGVALARRQGSALLIGHPHKATLDVLARELPKLRAQGIELVPPQMLI 243


>gi|302381253|ref|YP_003817076.1| hypothetical protein Bresu_0138 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302191881|gb|ADK99452.1| protein of unknown function DUF610 YibQ [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 399

 Score =  218 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 72/372 (19%), Positives = 130/372 (34%), Gaps = 18/372 (4%)

Query: 25  SRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPS 84
             + +       +  +++++ +                       P    L         
Sbjct: 36  PPVAVGAAGLLLLGTVALFLTVLGDPRAGTPSARVALKREAPVAPPAPSGLEAFSMGGFG 95

Query: 85  KRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKEL 144
                +         +     +     G +V      +        +    I GLS+   
Sbjct: 96  AWQGLSGAPVDPATGAAGGDALITLPDGASVAGGSAIAAPPQPAQPLVAAPIAGLSQPG- 154

Query: 145 LAKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSGLGISQTGTQRAINLLPANI 198
                 G              + A          +A++V GLG++   T+ AI  LPA++
Sbjct: 155 ----PQGFLPVIASDGRVPAQAYARPFRPNGKPTVALIVGGLGLNAVTTRAAIERLPADV 210

Query: 199 TLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLR 258
           TL+F      L  W+  A+ +G E +++IPM+       +   YTL    T   +  ++ 
Sbjct: 211 TLSFVPYAEGLQGWINLARAQGHEVMIEIPMEPTGYPNTDPGPYTLLNNATPDDVQAKMA 270

Query: 259 YSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLN 318
           + L R TGYFGV NY G   +++            +RG+ F DDGS+ R           
Sbjct: 271 WLLGRATGYFGVTNYLGDRFVTSDTGMSAFLGILRQRGIAFLDDGSARR-------RPGA 323

Query: 319 LPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVR 378
                AD  +D+      I   L  LE  A++ G A+G   A+  ++E  ++W      R
Sbjct: 324 WARASADSIIDETQTPAAIIGALNMLEATAKSRGAALGTGFAYPVTVEAAARWTAGLDAR 383

Query: 379 DVSVVPLSCLAK 390
            + + P S + +
Sbjct: 384 GLQLAPASAMTQ 395


>gi|114569952|ref|YP_756632.1| hypothetical protein Mmar10_1402 [Maricaulis maris MCS10]
 gi|114340414|gb|ABI65694.1| protein of unknown function DUF610, YibQ [Maricaulis maris MCS10]
          Length = 350

 Score =  218 bits (556), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 48/259 (18%), Positives = 103/259 (39%), Gaps = 4/259 (1%)

Query: 131 IEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRA 190
            +   +   S +  +           +   D    + A   +I +V+  +G+     +R 
Sbjct: 73  NDGADVQAASLEAPIDIAASNMSPVVIAPADPQLSAIAR-PQIVLVIDDVGLDVAAAERV 131

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  LP  +T+A      +       A+  G + +L +PM+       +     L++  + 
Sbjct: 132 V-ALPIPLTVAILPYAEASAELAALARLNGHDVLLHMPMEPVGL--ADPGPNALRIGLSD 188

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
             L  R+R+ + R  G  G+ N+ G+   ++  +  V     +    LF D  ++  +  
Sbjct: 189 VDLQTRVRWGMARVPGAIGLNNHMGSRFTADPRALRVALSAVSHTNPLFLDSLTTGESRG 248

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
           R +A  L L  +  D++LD     + I  +L    E+AR  G A+ +      +++ ++ 
Sbjct: 249 RAVAAGLGLRALERDIFLDHDRSAEAIEARLADAAELARQDGFAVVIGHPHTLTLDTLTA 308

Query: 371 WLQQEHVRDVSVVPLSCLA 389
           WL+    + +  V    LA
Sbjct: 309 WLESPAAQGIDFVTAGTLA 327


>gi|296445175|ref|ZP_06887135.1| protein of unknown function DUF610 YibQ [Methylosinus trichosporium
           OB3b]
 gi|296257349|gb|EFH04416.1| protein of unknown function DUF610 YibQ [Methylosinus trichosporium
           OB3b]
          Length = 402

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 101/395 (25%), Positives = 166/395 (42%), Gaps = 13/395 (3%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M+ +LN PL     + +          G  L     +  +++   +    +G   +    
Sbjct: 1   MTDELNQPLGVGGEEPR---RAPGRGRGALLAVAGTLGAVAVAAALVAPRIGGDGQPFAV 57

Query: 61  SVIREIAPI----PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVV 116
           + I  I P        +              N     +++  S     +     +   +V
Sbjct: 58  ARIETIEPPKIVEAPPVEPVAPAPPPTEAERNAAAIAEMERFSGVKVTRGGGGDAPGALV 117

Query: 117 NKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRED--TEVPAMDKNFCSNASGARIA 174
            K   S   +  P  ++RL+   S   L      G +         D +    A   RIA
Sbjct: 118 IKIEES-GPELAPAPDKRLVEKTSDGLLPRIGADGAKPMDVYARPADLSARLPAGAPRIA 176

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +VV G+G++   + RAI+ LPA +TLA A  G +++     A+ +G E +L  PM+ +D 
Sbjct: 177 LVVGGVGLNARLSDRAIDELPAAVTLALAPYGAAVEATAARARARGHEILLHAPMEPYDF 236

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
                  +TL+           L + + R TGY GV+N+ GA   +   +   +  + A 
Sbjct: 237 PVENPGPHTLRAGSDALGD---LHWLMSRFTGYVGVVNFLGARFTAEAGALRPVLADIAA 293

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           RGLL+ DDG+SPR+L   LA  L L    AD  +D +    +I  +L  LE +AR  GQA
Sbjct: 294 RGLLYIDDGASPRSLAPSLASGLGLASARADAAIDARAKPQEIDAQLTQLEALARRNGQA 353

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           I VA A    I  +S + +    R +++VP+S LA
Sbjct: 354 IAVAEALPGVIARLSHFARDLERRGIALVPVSALA 388


>gi|307133063|ref|YP_003885079.1| putative periplasmic protein [Dickeya dadantii 3937]
 gi|306530592|gb|ADN00523.1| Putative periplasmic protein [Dickeya dadantii 3937]
          Length = 268

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 41/204 (20%), Positives = 85/204 (41%), Gaps = 3/204 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  +P  I++A   N         +A  +G+E ++ +PM    +   E    TL+   + 
Sbjct: 1   MLAMPTAISVAVLPNAPYARDMATKAHAQGREVLIHLPMAPMSKQPLE--RDTLRPDMSS 58

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
           +++   LR ++ +     G+ N+ G+ + ++    + + +      L F D  +   +  
Sbjct: 59  EEIARILRDAVNKVPYAVGLNNHMGSAMTASLPGMQKVMQAMTAYRLYFLDSMTIGSSQA 118

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    +  +   ++LDD  +   IR +     EIA+ +G AI +      +I+V+ Q
Sbjct: 119 SRAAAGTGIKVLKRKVFLDDTQNVADIRRQFSRAVEIAQRSGYAIAIGHPHPTTIQVLQQ 178

Query: 371 WLQQEHVRDVSVVPLSCLAKLSSP 394
            L      D+ +V  S L     P
Sbjct: 179 MLPTLPA-DIVLVRPSQLLNEPEP 201


>gi|223039675|ref|ZP_03609961.1| divergent polysaccharide deacetylase family [Campylobacter rectus
           RM3267]
 gi|222879058|gb|EEF14153.1| divergent polysaccharide deacetylase family [Campylobacter rectus
           RM3267]
          Length = 549

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 43/227 (18%), Positives = 94/227 (41%), Gaps = 6/227 (2%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
           K      S  R+ I++  +         AI  +   +T +F  + ++       A++   
Sbjct: 328 KAAVKAGSKPRLVIIIDDVAYR--HQADAIRSVNLKLTPSFFPSTSAHPETPILARRFSF 385

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
             ++ +PMQA       +   TL +    +++  +L+   R       + N+ G+   S+
Sbjct: 386 -YMIHLPMQALGGFKGAE-IGTLTINDDYEKIAKKLQSIKRDFPDLKYINNHTGSRFTSD 443

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
             + + + +      L+F D  ++        A K ++PY+  D++LD    +  +R++L
Sbjct: 444 AAAMDRLMRAVRDENLIFVDSKTTSPTKVYGAAKKYSMPYIARDVFLDHDGSKAAVRKQL 503

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           K   E+A+    AI +      ++EV+ +  +      V +V L  L
Sbjct: 504 KYAVELAKKRSYAIAIGHPHKNTLEVLRESAKLLQE--VEIVYLKDL 548


>gi|121997999|ref|YP_001002786.1| hypothetical protein Hhal_1209 [Halorhodospira halophila SL1]
 gi|121589404|gb|ABM61984.1| protein of unknown function DUF610, YibQ [Halorhodospira halophila
           SL1]
          Length = 272

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 52/252 (20%), Positives = 113/252 (44%), Gaps = 7/252 (2%)

Query: 139 LSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANI 198
           L     LA++  G E    P  + +  +       A+++  +G       R+I  L   +
Sbjct: 15  LWSAPALAQDPGGAEWMPFPTPEVDPPAGRPA---ALIIDDIGDDWAAGVRSI-DLAEGV 70

Query: 199 TLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLR 258
           T++   +        + A ++G E +L +PM+A +    +     L +    +Q+   + 
Sbjct: 71  TISVLPHTPHGRSLAERAHERGHEVMLHLPMEAKNG--ADPGPGALFLDMDEEQVRKTIA 128

Query: 259 YSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR-GLLFFDDGSSPRNLTRVLAPKL 317
            +L+      GV N+ G+++  +      + +E A R  L F D  +S R++ + +A + 
Sbjct: 129 RALKSVPHAAGVNNHMGSLITRHPGHMTWLMEELAAREDLYFIDSRTSARSVAQQMAEEH 188

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
            +   V  ++LD + D + I E+ +    +A+    AI +   + E+++++ + L +   
Sbjct: 189 GVDNAVRHVFLDPRRDTEVIAEQFERFVTLAQQGDGAIAIGHPYPETLDLLEEELPRLRE 248

Query: 378 RDVSVVPLSCLA 389
           R V++VP S L 
Sbjct: 249 RGVALVPASELV 260


>gi|327395759|dbj|BAK13181.1| periplasmic protein YibQ [Pantoea ananatis AJ13355]
          Length = 258

 Score =  216 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 36/199 (18%), Positives = 83/199 (41%), Gaps = 3/199 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A   +     +   +A + G+E ++ +PM    +   E    TL    +  ++
Sbjct: 1   MPQAISVAVLPDAPYARQMAIKAHQGGREVLIHLPMAPLSKQPLE--KNTLTPEMSRAEI 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
              +R ++       G+ N+ G+ + S+    + + +   +  L F D  +   + +   
Sbjct: 59  DRIIRSAVNNVPYAVGLNNHMGSKMTSSLPGMQKVMQALNQYNLYFLDSMTIGNSQSLQA 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A   ++  +   ++LDD  D + IR++      +A+  G AI +      ++ V+ Q L 
Sbjct: 119 AQGTHVRVLKRRVFLDDSQDINAIRQQFNRAVTLAQRDGYAIAIGHPHPNTVRVLQQMLP 178

Query: 374 QEHVRDVSVVPLSCLAKLS 392
                D+++V    L    
Sbjct: 179 SLPA-DITLVTPGQLLNEP 196


>gi|320354673|ref|YP_004196012.1| hypothetical protein Despr_2585 [Desulfobulbus propionicus DSM
           2032]
 gi|320123175|gb|ADW18721.1| protein of unknown function DUF610 YibQ [Desulfobulbus propionicus
           DSM 2032]
          Length = 294

 Score =  216 bits (550), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 48/296 (16%), Positives = 103/296 (34%), Gaps = 11/296 (3%)

Query: 103 DGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK 162
              +   ++G    + P R  +           +L                 T+ P    
Sbjct: 2   TAALATSLAGCRSPDAPERLPAGSVPTAAPPTRVLVSPTSLSEQFPSSASLSTKTPPPRS 61

Query: 163 NFCSNASG--------ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
                A G          IAI++  +G       R    L  N+T +F           +
Sbjct: 62  AHERTADGNASTTAGRPEIAIIIDDMGNDLKMG-RKFLELDDNLTFSFLPGAPHTQELAE 120

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A + G+  ++ +PM+  D       +  L +  T + +  +    L       G  N+ 
Sbjct: 121 QAFQAGRTVLVHLPMEPKDT-RWSPGTEALHIADTEEGIRTKTETMLAAVPHAVGTNNHM 179

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+    +      +     +R L F D  ++  +     A +L +P     ++LD++   
Sbjct: 180 GSRFTEHGLGMHRVLTVLKERALFFVDSYTTAGSQGLATARRLAVPATRRHVFLDNEKTP 239

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            KI ++L  L  +AR  G A+G+          +++   + ++  +++V +  L +
Sbjct: 240 SKICDQLDQLALLARQQGHAVGIGHPNQAMFTALARCGPE-NMHHINLVSVQRLTR 294


>gi|329847637|ref|ZP_08262665.1| divergent polysaccharide deacetylase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328842700|gb|EGF92269.1| divergent polysaccharide deacetylase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 405

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 81/376 (21%), Positives = 144/376 (38%), Gaps = 15/376 (3%)

Query: 22  QIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQ 81
                +        FI+ +  ++ ++         +         A  P       E  +
Sbjct: 35  FKKPYVAPLTAGSAFILVVIAFLNLAGDPDAASQSVRIKMPKTTAAKAPPPRSGAGEAAE 94

Query: 82  SPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP--TRSTSIDSLPTIEERLILGL 139
             +   ++            +         G  V+  P    +T+ ++ P      +   
Sbjct: 95  GETFTLDSLGLFGDTPVEGFNLDPAAEAEPGHAVITLPGDETATAAEAGPRAARIPLAQS 154

Query: 140 SKKELLAKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSGLGISQTGTQRAINL 193
               L+     G      PA      + A          +A++V GLG++ T T++AI+ 
Sbjct: 155 PIAGLVQTTNSGPLPMISPAGLTPASAYARPFRSDGRPYVALIVGGLGLNPTATRQAIDQ 214

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  +TL+F      L  W+  A+  G E I+++PMQ  +    +    TL       +L
Sbjct: 215 LPPEVTLSFVPYTQGLQGWIDLARASGHEVIVEVPMQPTNYPDTDPGPQTLMANAKSDEL 274

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            N+L +SL R TG+F V NY+G+  L +K  A+        RG+ F DDG +        
Sbjct: 275 QNKLAWSLSRATGFFAVSNYQGSAFLKDKAGAQTFMSVLKSRGVAFIDDGQAR------- 327

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
             +       AD  +D Q++   I+ +L GLE  A+  G A+G    +  ++ V  +W Q
Sbjct: 328 GLQGAWSRASADRVIDSQINAQAIQAQLIGLETTAKNRGSALGTGFGYPVTLAVALRWTQ 387

Query: 374 QEHVRDVSVVPLSCLA 389
               + + + P S L 
Sbjct: 388 SLEAKGIQLAPASALL 403


>gi|251793608|ref|YP_003008337.1| divergent polysaccharide deacetylase superfamily protein
           [Aggregatibacter aphrophilus NJ8700]
 gi|247535004|gb|ACS98250.1| divergent polysaccharide deacetylase superfamily [Aggregatibacter
           aphrophilus NJ8700]
          Length = 301

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 39/226 (17%), Positives = 95/226 (42%), Gaps = 4/226 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
             +   A++AIV+  LG         I  LP  +++A            ++A ++G++ +
Sbjct: 44  SPSVYSAKLAIVIDDLGY-HPKEDAQILALPQAVSVAIIPAAPHAKARNQQAHQQGRDIL 102

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +PM+   ++  E     L +  T  ++  R++ +    +   G+ N+ G+   ++   
Sbjct: 103 IHMPMETLSKTKIEGG--GLHLGMTQDEVKQRVQTAKHIVSNAIGMNNHMGSAATADVPL 160

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +     +  L F D  +  R++   +A +  +  +   ++LDD      ++++ +  
Sbjct: 161 MTKLMTALREHHLFFLDSRTIGRSVAGKMAKEQGVRALDRHIFLDDSDAFADVQQQFQAA 220

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            + A+  G AI +      +I V+   +      DV +V +  L +
Sbjct: 221 VQYAQKHGTAIAIGHPRKNTIAVLQAGIANLPS-DVQLVSMGSLWR 265


>gi|51892007|ref|YP_074698.1| hypothetical protein STH869 [Symbiobacterium thermophilum IAM
           14863]
 gi|51855696|dbj|BAD39854.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 252

 Score =  216 bits (549), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 44/226 (19%), Positives = 87/226 (38%), Gaps = 4/226 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                 +AIV+  L     G +  +  LP  +T A   +        +     G E IL 
Sbjct: 22  PGQPPLLAIVIDDLTTGAPGLEE-MLRLPYPLTFAILPDRPDAGALARRIAALGHEVILH 80

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM A +          +   Q+ +++   +   L       G+ N+ G +   ++    
Sbjct: 81  LPMDAGEVDPQWYVGRPISSRQSDEEIQQLVSEWLAAVPEARGMNNHMGTVATQDERVVR 140

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + +   + G    D  ++   +    A ++ +P M   L+LD +   + +  +L  L E
Sbjct: 141 AVLEVARRHGKYILDSMTTENTVVPRTAVEMGVPCMQRSLFLDHENGEEVVAAQLYKLAE 200

Query: 347 IARTTGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            A T G AIG+       + +   +++ L +   R + +V LS L 
Sbjct: 201 WAETHGAAIGIGHVGVGREGTAAALAEVLPELEARGIRLVTLSQLL 246


>gi|42528003|ref|NP_973101.1| hypothetical protein TDE2503 [Treponema denticola ATCC 35405]
 gi|41819048|gb|AAS13020.1| conserved domain protein [Treponema denticola ATCC 35405]
          Length = 390

 Score =  216 bits (549), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 54/360 (15%), Positives = 132/360 (36%), Gaps = 8/360 (2%)

Query: 28  GLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRD 87
            +       I+ L+++ L     V    E    + I +             +K     + 
Sbjct: 33  AIAGFLAVCIIMLAVF-LFIIPSVKNKDETTNKTQIAKEQEKIEEEKPKTTEKPPIESKA 91

Query: 88  NNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAK 147
            +    + K   +Q    +  + + KT+ +KP  S         ++     +        
Sbjct: 92  KDKRTEKTKEAETQASKNLPKEAAKKTLHDKPKESEKAGRENKAKKPENPII----TGKP 147

Query: 148 NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
               +E        ++     S  ++  V    G +     +    LP   T+A      
Sbjct: 148 KPQEQEPDVSAYPIQDLPELPSKGKLIFVFDDAGHNL-EQLQYFLDLPFPCTIAVLPKLP 206

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
           +     +  +  G+E IL  PMQA +          +K     +++   +  ++      
Sbjct: 207 NSRETARRIRAAGKELILHQPMQALN-PNINPGDGAVKPGMDREEIKKIVASNVEEIGPI 265

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            G+ N+ G+++ S++++ E + +   ++ + F D  +S +++   +A KLN+      ++
Sbjct: 266 AGMNNHEGSLITSDEKAMEAVLELCREKNIYFLDSRTSSKSVVPQVAKKLNMNIWERAVF 325

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV-ISQWLQQEHVRDVSVVPLS 386
           LD++ D+  +++++    EIA   G+AI +   F   + + + +          +   +S
Sbjct: 326 LDNKKDKAYMKKQIIEGLEIASQRGEAIMIGHVFTVDLAILLKEMYSDLTQEGYTFSTIS 385


>gi|224373177|ref|YP_002607549.1| putative periplasmic protein [Nautilia profundicola AmH]
 gi|223588750|gb|ACM92486.1| putative periplasmic protein [Nautilia profundicola AmH]
          Length = 330

 Score =  215 bits (548), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 47/237 (19%), Positives = 97/237 (40%), Gaps = 7/237 (2%)

Query: 156 EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
                   F   +   ++ I++    +S  G  + I  +P  IT +F    N        
Sbjct: 101 PKTKEKPAFIPLSKKPKLVIIIDD--VSFKGQVKKIKKIPYKITPSFFPPTNRHPNTAVY 158

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           AK+     ++ +PMQA        +  TL +  +   +L+R+    +       + N+ G
Sbjct: 159 AKEFSH-YMVHLPMQAIHFKK--PEPKTLNINDSYLTILSRIDEIKKMFPKAKFINNHTG 215

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           +   SNKE+   +F+      + F D  ++P +  +    +  +P    +++LD++ +  
Sbjct: 216 STFTSNKEAMIKLFRALKTENMGFVDSKTTPNSKAKEAQKEFYIPLYSRNIFLDNEENPT 275

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            IR +LK   +IA+  G AI +      ++E +          ++ VV +  L+K  
Sbjct: 276 YIRNQLKKAVKIAQKRGYAIAIGHPHSITLETLKNSTDILK--NIDVVYIDELSKNK 330


>gi|325474776|gb|EGC77962.1| hypothetical protein HMPREF9353_00809 [Treponema denticola F0402]
          Length = 390

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 52/360 (14%), Positives = 134/360 (37%), Gaps = 8/360 (2%)

Query: 28  GLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRD 87
            +       ++ L+++ L     V    E    + I +           I +K     + 
Sbjct: 33  AIAGFLAVCVIMLAVF-LFIIPSVKNKDETTNKTQIAKEQEKIKEEKPKIAEKPPIESKA 91

Query: 88  NNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAK 147
            +    + K   +Q    +  + + KT+ +KP      +     ++     ++ K    +
Sbjct: 92  KDKRTEKTKETETQAAKNLPKEAAKKTLQDKPKEIEKPNRENKAKKPENPIITDKPKPQE 151

Query: 148 NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
            +       +  + +         ++  V    G +     +    LP   T+A      
Sbjct: 152 QEPDVSAYPIQDLPELPSKG----KLIFVFDDAGHNL-EQLQYFLDLPFPCTIAVLPKLP 206

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
           +     +  +  G+E IL  PMQA +          +K     +++   +  ++      
Sbjct: 207 NSRETARRIRAAGKELILHQPMQALN-PNINPGDGAVKPGMDREEIKKIVASNVEEIGPI 265

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            G+ N+ G+++ S++++ E + +   ++ + F D  +S +++   +A KLN+      ++
Sbjct: 266 AGMNNHEGSLITSDEKAMEAVLELCKEKNIYFLDSRTSSKSVVPQVAKKLNMNIWERAVF 325

Query: 328 LDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV-ISQWLQQEHVRDVSVVPLS 386
           LD++ D+  +++++    EIA   G+AI +   F   + + + +              +S
Sbjct: 326 LDNKKDKAYMKKQIIEGLEIASQRGEAIMIGHVFTVDLAILLKEMYSDLTQEGYIFSTIS 385


>gi|289523286|ref|ZP_06440140.1| polysaccharide deacetylase family protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289502978|gb|EFD24142.1| polysaccharide deacetylase family protein [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 315

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 49/235 (20%), Positives = 103/235 (43%), Gaps = 4/235 (1%)

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKG 220
           + +   +  GA +AIVV  LG S    +  +  L   +T A      S     + A+ KG
Sbjct: 82  EPSKAKSLKGAYLAIVVDDLGFSYARAEE-LAGLKIPLTWAIIPFQRSSKATAELARNKG 140

Query: 221 QEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLS 280
              ++ +PM+AF ++ ++     L  +   + +   +R +L    G  GV N+RG+   S
Sbjct: 141 IPFLVHVPMEAFGDNESQMHLVAL--SMDDETIRRNVREALESLPGAIGVNNHRGSAATS 198

Query: 281 NKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREK 340
           +  +   + +E  +  ++F D  ++  ++  + A K  +  +    ++D   D   +  +
Sbjct: 199 DMRAMRALMEELRQDNMIFLDSRTAASSVAAIEARKAGIFALENGAFIDHLEDIKFMWSQ 258

Query: 341 LKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           L+     A+  G A+ +  A   ++  ++Q L       V +V +  L ++ S S
Sbjct: 259 LERAAGQAQRRGYAVAICHARPVTLTFLNQ-LDSNPDIGVKLVTVDELVRILSQS 312


>gi|242309714|ref|ZP_04808869.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
 gi|239523715|gb|EEQ63581.1| conserved hypothetical protein [Helicobacter pullorum MIT 98-5489]
          Length = 338

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 44/275 (16%), Positives = 98/275 (35%), Gaps = 17/275 (6%)

Query: 124 SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGIS 183
             ++  T +  +                                    ++AI++  +  S
Sbjct: 70  QQENNQTSQSTIPQITPPPISQESKPTKPTQIPSKP---KTQCQKPKPQLAIIIDDI--S 124

Query: 184 QTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT 243
                + I  +P  IT +      +     + AKK     ++ +P++A + S  E     
Sbjct: 125 NFYQYQKIQEIPYKITPSLFPRSIASQNTPEIAKKADF-YMVHLPLEALNFSQKE--HKY 181

Query: 244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDG 303
           L  T + Q +   ++   +       + N+ G+      ++   + +   +  + F D  
Sbjct: 182 LLSTDSKQTIQETIQNLKKDFPNLTYLNNHTGSKFTQTPQAMYFLLEILNENNISFVDSR 241

Query: 304 SSPRNLTR---------VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           ++P   TR          L    N P++  D++LD+++D  KI + L    +IA+T G A
Sbjct: 242 TTPHTKTRNYYQQNPTTPLNQCQNQPFLERDIFLDNELDITKITQNLIQAVKIAKTKGYA 301

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           I +     ++I  +           + +V ++ L 
Sbjct: 302 IAIGHPHQQTILALKNATNYLQNSGIELVYINELV 336


>gi|212632982|ref|YP_002309507.1| hypothetical protein swp_0073 [Shewanella piezotolerans WP3]
 gi|212554466|gb|ACJ26920.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 247

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 37/215 (17%), Positives = 88/215 (40%), Gaps = 4/215 (1%)

Query: 181 GISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDD 240
           G  Q  + +A+  LP ++TL+             +A ++G E ++ +PMQA +       
Sbjct: 28  GYRQ--SDKAVLALPPSVTLSVLPLTPLGKAVATKAHQQGSEILVHLPMQALNGKTI--G 83

Query: 241 SYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFF 300
              L    + Q    +L  ++       G  N+ G++L    +    +     +R + F 
Sbjct: 84  PGALTNAMSEQDFKLQLEQAIDSVPFASGANNHMGSLLTQLDKPMHWVMDTLLQRDIYFI 143

Query: 301 DDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA 360
           D  ++       +A  + +P +   ++LD+      +  + +    + +T    + +A  
Sbjct: 144 DSVTTKFTQAGAVAESVGVPLLKRTIFLDNDKTDAGLELQFQKAIALTKTQTDVVVIAHP 203

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           + E++  ++  L +    ++++VP S L  +   S
Sbjct: 204 YPETLTFLNNNLHRLAQANIALVPPSKLLPIGITS 238


>gi|315185549|gb|EFU19318.1| protein of unknown function DUF610 YibQ [Spirochaeta thermophila
           DSM 6578]
          Length = 311

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 83/209 (39%), Gaps = 4/209 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++   G S          LP  +T++             + ++ G+   L +PM+    
Sbjct: 96  LIIDDAGYSLD-QVAPFLSLPFPLTVSVLPGLPLSKEVALKVQEAGKTLFLHLPMEPEG- 153

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              +     L V+ +  ++   +   L    G  GV N+ G+    +    E I    A 
Sbjct: 154 -DEDPGPGALYVSMSWNEIEKVIAEDLASVPGVQGVNNHMGSRFTKDPLRMEWILSILAA 212

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
            GLLF D  ++  ++ R  A +L +P M  D++LD++     + +      +IAR  G+A
Sbjct: 213 GGLLFVDSRTTAESVVRETALRLGVPVMERDVFLDNEQTEAYVEQAFMHAVQIARRRGRA 272

Query: 355 IGVAVAFDESIE-VISQWLQQEHVRDVSV 382
           + +   +   +  V+ +   +     V +
Sbjct: 273 VAIGHVWTRVLPGVLDRMADRARNEGVIL 301


>gi|16127669|ref|NP_422233.1| hypothetical protein CC_3439 [Caulobacter crescentus CB15]
 gi|221236488|ref|YP_002518925.1| hypothetical protein CCNA_03552 [Caulobacter crescentus NA1000]
 gi|13425155|gb|AAK25401.1| hypothetical protein CC_3439 [Caulobacter crescentus CB15]
 gi|220965661|gb|ACL97017.1| conserved hypothetical protein [Caulobacter crescentus NA1000]
          Length = 394

 Score =  214 bits (544), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 84/381 (22%), Positives = 144/381 (37%), Gaps = 19/381 (4%)

Query: 15  KRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIP 74
           + K   +     +        F+  ++  +LI+          +    + +I        
Sbjct: 25  RAKFMAAISNPYISASGAALLFLASVATLVLITSDPHAG--SPVIRLELTKIGATKNAPE 82

Query: 75  LNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEER 134
              E        +   +  +L   ++     +    S   V      + +I   P + + 
Sbjct: 83  GWREALGGDPAHEAGLLPGELGLSANPFGPIMAKAESEAPVAEGLENAPAIPQGPGLPQA 142

Query: 135 LILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSGLGISQTGTQ 188
            + GLS          G              + A         +++IV+ GLG++   T+
Sbjct: 143 PLAGLSAPG----PGGGLLPIIAADGRTAAEAYARPFTPNGRPKVSIVIGGLGLNAQTTR 198

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
            AI  LP  +TL+FA     L  W+  A+  G E +L+ PM+  D   N+   YTL    
Sbjct: 199 AAIETLPGEVTLSFAPYAEGLQGWIDLARAHGHEVLLETPMEPADYPANDPGPYTLIAAN 258

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
                + +L + + R TGYFG+ NY GA  + N ++          RGL F DDG + R 
Sbjct: 259 RPDDTVRKLEWLMSRATGYFGLSNYLGARFVDNDQAMNTFNATLKARGLAFIDDGLAAR- 317

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
                     +P   AD  +DD++    I  +L+ LE  A   GQ++G   A+  +I  +
Sbjct: 318 ------RAGPIPRASADRVIDDELSASAIDAQLRALETGAAARGQSLGSGFAYPVTINQV 371

Query: 369 SQWLQQEHVRDVSVVPLSCLA 389
             W      R + + P S LA
Sbjct: 372 RAWAAGLQARGIQLAPASALA 392


>gi|78044631|ref|YP_360224.1| putative N-acetylmuramoyl-L-alanine amidase [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996746|gb|ABB15645.1| putative N-acetylmuramoyl-L-alanine amidase [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 448

 Score =  214 bits (544), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 42/226 (18%), Positives = 91/226 (40%), Gaps = 6/226 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++ I++   G +          L    T A     N+  +  K   + G + I+ +PM+ 
Sbjct: 223 KLLIIIDDFGNNSDSLVD-FLKLKLPFTAAVMPFLNNTHQEAKALYQSGNDIIIHLPMEP 281

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
                +      + V  T Q++ + L  +L+      G+ N+ G+    +++  + +   
Sbjct: 282 KSYKRSWLGPRPIMVNLTPQEITSLLIAALKENPWAIGINNHTGSRACEDEKIVKTVLSF 341

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIART 350
             K  L F D  ++P +L  +L  +  +  +  D++L+ +  +   I E+LK L+ IA+ 
Sbjct: 342 CQKNNLAFIDSQTTPNSLFPLLGSEFGVVVLKRDIFLEVNGKEEKNIIEQLKKLQSIAQK 401

Query: 351 TGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
               I +     E    +   + + L +   +   +  LS L K  
Sbjct: 402 KNLGIAIGHVGYEGGKPTANALKKVLPELQRQGFKICTLSDLIKKH 447


>gi|295687690|ref|YP_003591383.1| hypothetical protein Cseg_0245 [Caulobacter segnis ATCC 21756]
 gi|295429593|gb|ADG08765.1| protein of unknown function DUF610 YibQ [Caulobacter segnis ATCC
           21756]
          Length = 393

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 79/381 (20%), Positives = 141/381 (37%), Gaps = 10/381 (2%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPI 69
                + K   +     +G     C F+  L+  +L++          +    + +I   
Sbjct: 20  GSAVLRGKLGAALANPYIGAGGAACLFLASLATLVLVTSDPHAGN--PVVRLELTKIGAT 77

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
                   E   + S  +     ++L+   +                 +           
Sbjct: 78  KNAPEGWREALTAESPHEAPLKPSELQLSRAPFPAAGAEAGEKPAFEGEQPPPPVQQGPG 137

Query: 130 TIEERLIL-GLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQ 188
             +  +               +  +            +     ++++V+ GLG++   T+
Sbjct: 138 LPQAPIAGLTAPGPGGAPLPIIAPDGRTAADAYARPFTPNGRPKVSVVIGGLGLNAQTTR 197

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
            AI  LPA ITL+FA     L  W+  A++ G E +L+ PM+  D   N+   YTL    
Sbjct: 198 AAIETLPAEITLSFAPYAEGLQGWIDLAREHGHEVLLETPMEPADYPANDPGPYTLIAAN 257

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
             +  + +L + + R TGYFG+ NY GA  + N ++          RGL F DDG + R 
Sbjct: 258 RPEDTVRKLEWLMSRATGYFGLANYLGARFVDNDQAMATFNTVLKTRGLAFIDDGLAAR- 316

Query: 309 LTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
                     +P   AD  +DD++    I  +L+ LE  A   GQ++G   A+  +I  +
Sbjct: 317 ------RSGPIPRASADRVIDDELSASAIDAQLRALENGASARGQSLGSGFAYPVTINQV 370

Query: 369 SQWLQQEHVRDVSVVPLSCLA 389
             W      R + + P S LA
Sbjct: 371 RLWAAGLQARGLQLAPASALA 391


>gi|307718431|ref|YP_003873963.1| hypothetical protein STHERM_c07330 [Spirochaeta thermophila DSM
           6192]
 gi|306532156|gb|ADN01690.1| hypothetical protein STHERM_c07330 [Spirochaeta thermophila DSM
           6192]
          Length = 271

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 84/209 (40%), Gaps = 4/209 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++   G S          LP  + ++            +  ++ G+   L +PM+    
Sbjct: 56  LIIDDAGYSL-EQVEPFLSLPFPLAVSVLPGLPLSGEVARRVREAGKTLFLHLPMEPEG- 113

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
              +     L V+ +  ++ + +   L    G  GV N+ G+    +    E I    A 
Sbjct: 114 -NEDPGPGALYVSMSRAEIEHVIAEDLASVPGVQGVNNHMGSRFTKDPLRMEWILSILAA 172

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
            GLLF D  ++P ++ R  A +L +P M  D++LD++     + +      +IAR  G+A
Sbjct: 173 GGLLFVDSRTTPESVVRETAFRLGVPVMERDVFLDNEQTAVYVEQAFMHAVQIARRRGRA 232

Query: 355 IGVAVAFDESIE-VISQWLQQEHVRDVSV 382
           + +   +   +  V+ +   +     V +
Sbjct: 233 VAIGHVWTRVLPGVLGRMADRARDEGVIL 261


>gi|327398190|ref|YP_004339059.1| hypothetical protein Hipma_0017 [Hippea maritima DSM 10411]
 gi|327180819|gb|AEA33000.1| protein of unknown function DUF610 YibQ [Hippea maritima DSM 10411]
          Length = 247

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 39/214 (18%), Positives = 90/214 (42%), Gaps = 1/214 (0%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+AIV+  +G       R    L   +  AF  +        K+  K G   ++ +P Q 
Sbjct: 33  RLAIVIDDMGYDVALANR-FESLKMPLAFAFLPDAPFSGELSKKLSKDGFIVMIHMPSQP 91

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            D   +    + + +  +  +    L ++ ++     G+ N+ G+ +L +K   + I + 
Sbjct: 92  IDYPKDNPGKHAIYLWTSKAETFRLLNWAYKKIPNAMGLNNHMGSAILRDKTHLDYIMEF 151

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             K  L F D  +   +L  + A K  +      ++LD++ +   I+ +++   ++ +  
Sbjct: 152 LKKHDLFFIDSATVKDSLGCIEAEKFGVMCAKRRVFLDNKKNVAYIKGQIRQALKMLKKR 211

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
              + +    +++ E ++Q  +Q     VSVV +
Sbjct: 212 NNVVAIGHCNEKTYEALAQMKKQLKPYLVSVVFV 245


>gi|302343200|ref|YP_003807729.1| hypothetical protein Deba_1768 [Desulfarculus baarsii DSM 2075]
 gi|301639813|gb|ADK85135.1| protein of unknown function DUF610 YibQ [Desulfarculus baarsii DSM
           2075]
          Length = 360

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 58/307 (18%), Positives = 116/307 (37%), Gaps = 9/307 (2%)

Query: 83  PSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKK 142
             +        +++    +  G+I++ +          R         I E  + G    
Sbjct: 62  AGEPWGQVAQMKVELAPGEDAGKIRSAVESALAGLSAPRRWRQRGRAWIMELSLAGRPSH 121

Query: 143 ELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAF 202
            L+   +   +    P   +   +       AIV+  +G    G  + +  L  ++T + 
Sbjct: 122 RLIITAQAAPDGPAPPPDRREALA-------AIVIDDMGY-LLGPAKELLELDLDLTFSI 173

Query: 203 ASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLR 262
                   +  + AK +G++ +L +PM+             L V    Q L  +    L 
Sbjct: 174 LPFSPHGRQVARMAKARGRQVLLHLPMEPKSFPRLSPGPGALLVEADEQALARQTAADLD 233

Query: 263 RGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYM 322
                 GV N+ G+    +  +   +  +  +RGL F D  +SPR+    +A +L L   
Sbjct: 234 FLPEAVGVNNHMGSRFTEDATALRPVMTQIGRRGLFFVDSLTSPRSAAYDVAGQLGLRRA 293

Query: 323 VADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
             D++LD +VD   IR +++GL  +AR     I +      +I+ +  + ++     V +
Sbjct: 294 RRDMFLDHEVDEQAIRRQIEGLIHLARGGHPVIAIGHPHQATIKALRHYQERLRQE-VRL 352

Query: 383 VPLSCLA 389
            P+S L 
Sbjct: 353 RPVSELL 359


>gi|319956136|ref|YP_004167399.1| hypothetical protein Nitsa_0380 [Nitratifractor salsuginis DSM
           16511]
 gi|319418540|gb|ADV45650.1| protein of unknown function DUF610 YibQ [Nitratifractor salsuginis
           DSM 16511]
          Length = 340

 Score =  213 bits (541), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 54/281 (19%), Positives = 105/281 (37%), Gaps = 8/281 (2%)

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGAR 172
            TV   P + + +      E+R+  GL    L+ K +   +        K     +S   
Sbjct: 66  STVTVAPKQPSLVGEEYPKEDRVGFGLED--LIEKTRKRAKGKNESPSTKATPKKSSSPE 123

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           + +++    +SQ     AI  LP  +T +            K AK      ++  P+++ 
Sbjct: 124 LVLIIDD--VSQPRQLAAIRKLPFPVTPSIFPPSQMNKHTPKLAKGLRH-YMIHFPLES- 179

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
                     TL V     ++  R+            + N+ G++  SN  +   ++   
Sbjct: 180 GSKKMNRFEKTLFVRDDPAKVRKRVEEIRHLFPSARFLNNHTGSVFTSNYRAMYRLYGFL 239

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            K G +F D  +S  +  R +A + ++PY+  D++LD+      +R +LK    +A+  G
Sbjct: 240 KKEGFIFLDSRTSGHSKVRKIAAEYHMPYLGRDVFLDNVQIPQAVRTQLKRAVRLAKKRG 299

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            AI +      ++ V+ Q         V  V L    +   
Sbjct: 300 YAIAIGHPHPVTLRVLKQAASLLK--GVKAVYLDDFYREHY 338


>gi|206900827|ref|YP_002250509.1| divergent polysaccharide deacetylase family [Dictyoglomus
           thermophilum H-6-12]
 gi|206739930|gb|ACI18988.1| divergent polysaccharide deacetylase family [Dictyoglomus
           thermophilum H-6-12]
          Length = 389

 Score =  213 bits (541), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 44/230 (19%), Positives = 100/230 (43%), Gaps = 6/230 (2%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +IA VV  +      T   +   P  + ++            ++  K+G E ++ +PM+
Sbjct: 155 PKIAFVVDDVVEDNFWTHE-LLNFPYTLNISIIP-TRKTKDIAEKVSKRGWEVLMHLPME 212

Query: 231 AFDESYNE--DDSYTLKVTQTVQQLLNRLRYSLRRGTGYF--GVMNYRGAMLLSNKESAE 286
           +     +     S  + V     ++ N ++  L R        V N+ G+ +  + E+ E
Sbjct: 213 SISYPRDAKYLVSEAIMVGMDEVEIENIIKTHLERFGNVKISWVNNHMGSKVTQDSETME 272

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + K F K  L F D  +   ++   +A +  +P +   L++D + D ++I+ +      
Sbjct: 273 RVIKVFKKYNLAFLDSRTILNSVGYKMANRSGIPALENMLFIDHENDEERIKARFIQAVN 332

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           IA+  G  + +     ++I+V+++  ++    D+ +V +S L ++ S  S
Sbjct: 333 IAKKRGWGVFILHLRPKTIKVLNELDKEGFFNDLDLVRISDLYEVISEHS 382


>gi|89100427|ref|ZP_01173290.1| hypothetical protein B14911_20563 [Bacillus sp. NRRL B-14911]
 gi|89084856|gb|EAR63994.1| hypothetical protein B14911_20563 [Bacillus sp. NRRL B-14911]
          Length = 259

 Score =  212 bits (540), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 37/196 (18%), Positives = 80/196 (40%), Gaps = 3/196 (1%)

Query: 197 NITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNR 256
            IT A     +   +  + A + G E ++ +PM+      +      +    + +++  R
Sbjct: 52  PITAAVMPFTDQTAQHAEWAHENGFEVMVHLPMEPKRGKKSWLGPKPITTNLSSEEVRKR 111

Query: 257 LRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPK 316
           +  ++       G+ N+ G+  + ++     I K   +R L   D G+SP +   ++A +
Sbjct: 112 VNEAIDSVPYAKGLNNHMGSRAVEDEGIVREIVKIAKERKLYIVDSGTSPESKFPIIAKE 171

Query: 317 LNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVA---FDESIEVISQWLQ 373
           L +P +  D++LDD      +R ++K L  I    G+ I +             I Q   
Sbjct: 172 LGVPLIKRDVFLDDISSVSHVRRQMKKLALITEQQGRGIAIGHVGVTGKVCSAGILQEKG 231

Query: 374 QEHVRDVSVVPLSCLA 389
               + + + P+S + 
Sbjct: 232 YFEEKGIRIAPVSEII 247


>gi|157149233|ref|YP_001456552.1| hypothetical protein CKO_05073 [Citrobacter koseri ATCC BAA-895]
 gi|157086438|gb|ABV16116.1| hypothetical protein CKO_05073 [Citrobacter koseri ATCC BAA-895]
          Length = 258

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 34/185 (18%), Positives = 74/185 (40%), Gaps = 3/185 (1%)

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
              +A   G E ++ +PM    +   E    TL+   +  ++   +R ++ +     G+ 
Sbjct: 1   MATKAHNSGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSDEIERIIRDAVNKVPYAVGLN 58

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+ + S+    + + +   +  L F D  +   +     A    +  +   ++LDD 
Sbjct: 59  NHMGSAMTSSLFGMQKVMQALERYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDT 118

Query: 332 VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            +   IR +     E+AR  G AI +      ++ V+ Q +      D+++V  S L   
Sbjct: 119 QNEADIRRQFNRAIELARRNGSAIAIGHPHPSTVRVLQQMVYNLPA-DITLVRPSSLLNE 177

Query: 392 SSPSS 396
               +
Sbjct: 178 PQTDT 182


>gi|56963524|ref|YP_175255.1| hypothetical protein ABC1759 [Bacillus clausii KSM-K16]
 gi|56909767|dbj|BAD64294.1| conserved hypothetical protein [Bacillus clausii KSM-K16]
          Length = 266

 Score =  212 bits (539), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 40/226 (17%), Positives = 86/226 (38%), Gaps = 5/226 (2%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
            +A+   +AI++   G        A       +T+A   N          A + G E I+
Sbjct: 25  CDAANKDVAIIIDDFG-GNVKGVDAFLQGDIPVTVAIMPNMPYTTEQAIAAHENGLEVII 83

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +P++  +   +      + V  + +++  RLR +  +     G+ N+ G+  + +K   
Sbjct: 84  HLPLEPKNGKASWLGPNGITVDLSNEEINKRLREAYEQIPYAVGLNNHMGSKAMEDKRIV 143

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV-DRDKIREKLKGL 344
            +I +     GL   D  ++P ++   LA K  +P     L+LDD +    +++ K++  
Sbjct: 144 GLIVEFAKTNGLYLVDSKTTPHSVMPELALKAQIPCFENKLFLDDTLSTTQQVQAKMQTF 203

Query: 345 EEIARTTGQAIGVAVA---FDESIEVISQWLQQEHVRDVSVVPLSC 387
                     I +       +++   I   L     +   +V  S 
Sbjct: 204 AAKGNMHQHPIAIGHVGVKGEQTYAGIKAGLPHLKKQGYKLVFPSA 249


>gi|291086413|ref|ZP_06571498.1| YibQ protein [Citrobacter youngae ATCC 29220]
 gi|291068178|gb|EFE06287.1| YibQ protein [Citrobacter youngae ATCC 29220]
          Length = 247

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 35/181 (19%), Positives = 74/181 (40%), Gaps = 3/181 (1%)

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
              +A   G E ++ +PM    +   E    TL+   + +++   +R ++ +     G+ 
Sbjct: 1   MAMKAHNSGHEVLIHLPMAPLSKQPLE--KDTLRPEMSSEEIERIIRDAVSKVPNAVGLN 58

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G+ + S+    + + +   +  L F D  +   +     A    +  +   ++LDD 
Sbjct: 59  NHMGSAMTSSLFGMQKVMQALERYDLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDT 118

Query: 332 VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
            +   IR +     E+AR  G AI +      ++ V+ Q L      D+++V  S L   
Sbjct: 119 QNEADIRRQFNRAVELARRNGSAIAIGHPHPSTVRVLQQMLYSLPA-DITLVRPSSLLNE 177

Query: 392 S 392
            
Sbjct: 178 P 178


>gi|227824417|ref|ZP_03989249.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904916|gb|EEH90834.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 333

 Score =  211 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 56/316 (17%), Positives = 112/316 (35%), Gaps = 3/316 (0%)

Query: 75  LNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEER 134
            ++       +    TV   +K    Q   +    +  K                  +  
Sbjct: 21  PDLTWPDVVEEALPETVRETVKEVLPQTVKEEIEKVRKKERKEIEKEKIEKIEKEEKQGP 80

Query: 135 LILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLL 194
           +     +++        +E  +           A   R+AIV+   G  Q G  R +  L
Sbjct: 81  IRDHPVEEKKTVPPAAKKESAKADENSLGLAPGAYKGRLAIVIDDCGY-QLGPVRTLTSL 139

Query: 195 PANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLL 254
           P  +T A      +    +   +  G  A+L +PM+      +E     + V QT  Q+ 
Sbjct: 140 PLKMTFAVIPFKPNSAAALSIIRNSGHTAMLHLPMEPVSGGSSET--RFVGVGQTKAQIA 197

Query: 255 NRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLA 314
           + ++ ++    G  GV N++G+   ++  +         + GL F D  ++   +    A
Sbjct: 198 SFVQEAIDSLPGISGVNNHQGSKATAHGPTIRAALSVIGENGLFFIDSRTNSATVAEREA 257

Query: 315 PKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQ 374
             L +P     L+LD+  D   I EK+    ++A   G  I +  A   + E   +  + 
Sbjct: 258 GNLGIPTGHNSLFLDNSSDIGAIEEKIAQAVKLADRYGSVIVICHARPNTAEAWKRSYKA 317

Query: 375 EHVRDVSVVPLSCLAK 390
                +++VP + L +
Sbjct: 318 VIQSGITLVPAASLLQ 333


>gi|257457722|ref|ZP_05622885.1| divergent polysaccharide deacetylase family protein [Treponema
           vincentii ATCC 35580]
 gi|257444890|gb|EEV19970.1| divergent polysaccharide deacetylase family protein [Treponema
           vincentii ATCC 35580]
          Length = 470

 Score =  210 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 47/335 (14%), Positives = 118/335 (35%), Gaps = 8/335 (2%)

Query: 52  GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND-- 109
             I+   P +     +    T P   +   +     +++  ++    + +     +    
Sbjct: 127 PQIAAQTPKAESTHTSAAQKTTPAVQKTAPAAQPSQSSSASSRTAPAAPKDSAHKETPAV 186

Query: 110 -ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
             + +         T      + E+  +  +  K+  A+     +    P   +     A
Sbjct: 187 RPAPQKNTVPEKSVTPDKKNTSPEKNTVPAVPDKKNTAQAVQPVQSAAKPEKPRRLAPYA 246

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
               +  V    G +          LP   T+A            +  +K G++ IL  P
Sbjct: 247 GN--LTFVFDDAGHNLD-QLEYFLRLPFPCTIAVLPGLRYSSESARRIRKAGKQVILHQP 303

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           MQ+ D  +       +    + +Q+ N +R +L       G+ N+ G+++ +++ +   +
Sbjct: 304 MQSVDL-HINPGPGAVTPGLSAEQIKNIVRKNLEEIWPVAGMNNHEGSLMTADEAAMRAV 362

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
               A++ + F D  ++ +++   +A + N+      +++D+   R  +  ++K    IA
Sbjct: 363 LDVVAEKHIFFLDSRTTAKSVVSKVAKEKNMVVWERAIFIDNDKSRAAMETQIKKGLSIA 422

Query: 349 RTTGQAIGVAVAFDESIEVIS-QWLQQEHVRDVSV 382
           R  G AI +   F   +  +  +          S+
Sbjct: 423 RQKGSAIMIGHVFTVELAQLLTEMYPALIEEGFSL 457


>gi|119505488|ref|ZP_01627560.1| hypothetical protein MGP2080_04180 [marine gamma proteobacterium
           HTCC2080]
 gi|119458597|gb|EAW39700.1| hypothetical protein MGP2080_04180 [marine gamma proteobacterium
           HTCC2080]
          Length = 255

 Score =  210 bits (535), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 47/220 (21%), Positives = 99/220 (45%), Gaps = 4/220 (1%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +A+++  LG +   T +    +PA +T++                K+G+E +L +PM A 
Sbjct: 27  LAVIIDDLGYNLD-TAQVAAAIPAPLTMSIIPGTPYALEVADLGAKRGKEVMLHMPMAAV 85

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
               ++     L     V  +  R++ +L+   G  G+ N+ G+ L +N+E+ + +  E 
Sbjct: 86  RTRVSD--PLVLDGQLPVADIGQRVQQALQSVPGAAGMNNHMGSALTTNREAMDALMSEL 143

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
           A + + F D  ++   + R  A    +P     ++LD++ +   +  ++K     A   G
Sbjct: 144 AAQDMFFIDSRTTAETVARDAAKARGVPSASRTVFLDNKPELAAVEIQIKEAVRRALVEG 203

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            AI +      ++  +S+ L +    DV+VV  S +A+  
Sbjct: 204 YAIAIGHPHPATLTALSRALPRLPA-DVTVVSASQIARCH 242


>gi|291279748|ref|YP_003496583.1| hypothetical protein DEFDS_1366 [Deferribacter desulfuricans SSM1]
 gi|290754450|dbj|BAI80827.1| hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 357

 Score =  209 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 35/217 (16%), Positives = 90/217 (41%), Gaps = 1/217 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AI++   G +     + +  +P  IT +   +        + A+K  +   L +PMQ  
Sbjct: 141 LAIIIDDCGNNLKL-AKKLANIPYPITFSIIPHLKYSKETAEIARKFNKPVFLHLPMQPK 199

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
                +     + +      +   ++ ++       G  N+ G+ L  ++E    +  E 
Sbjct: 200 SYPSTDPGMGAIYLNTPKSLIKIIIKKNVESIGKIDGANNHMGSALTESREKMFEVLNEL 259

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
                +F D  +S + +   +  KLN+   + + ++D+  D++ I+E L     + +   
Sbjct: 260 KNYTDIFVDSHTSSKTVAYNVCKKLNMRCGLNNKFIDNIDDKNSIKEILYKSLSLFQKQD 319

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           + I +    + +IEV+S+ L +   +++ +  +  + 
Sbjct: 320 KVIIIGHLKENTIEVLSEELPKISKKNIKITNILEVV 356


>gi|157736497|ref|YP_001489180.1| hypothetical protein Abu_0236 [Arcobacter butzleri RM4018]
 gi|157698351|gb|ABV66511.1| conserved hypothetical protein [Arcobacter butzleri RM4018]
          Length = 359

 Score =  209 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 106/238 (44%), Gaps = 4/238 (1%)

Query: 146 AKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASN 205
               +  E       D    +     +IAI++    +     +  I+ +   IT+AF   
Sbjct: 120 ENIPLVEEKAAPIKKDTYVYNKKDKPKIAIIIDD--VVSDSQKSKISNIGYPITMAFLPP 177

Query: 206 GNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGT 265
            N+     K A+      ++  P+QA      E+   TLK+T + + + NR++       
Sbjct: 178 TNTHKDSAKIAQNVPF-YMIHFPLQASSAFKGEE-INTLKITDSYETIENRVKQLRNWYP 235

Query: 266 GYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
                 N+ G++   N E+ + +FK   K   +F D  +S +++ +  A K NLPY+  +
Sbjct: 236 NAKYTNNHTGSVFTENDEAMDKLFKALVKYNFIFVDSKTSAKSVGQKYANKYNLPYISRN 295

Query: 326 LYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
           ++LD++   + I+ +L    E+A+  G A+ +   +D +++V+ +     +  D  +V
Sbjct: 296 IFLDNEKSYEYIKAQLIKTVELAKKHGYAVAIGHPYDITLKVLKESKHLLNDVDPILV 353


>gi|315635656|ref|ZP_07890919.1| divergent polysaccharide deacetylase superfamily protein
           [Arcobacter butzleri JV22]
 gi|315479953|gb|EFU70623.1| divergent polysaccharide deacetylase superfamily protein
           [Arcobacter butzleri JV22]
          Length = 359

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 51/238 (21%), Positives = 106/238 (44%), Gaps = 4/238 (1%)

Query: 146 AKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASN 205
               +  E       D    +     +IAI++    +     +  I+ +   IT+AF   
Sbjct: 120 ENIPLVEEKAAPIKKDTYVYNKKDKPKIAIIIDD--VVSDSQKSKISNIGYPITMAFLPP 177

Query: 206 GNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGT 265
            N+     K A+      ++  P+QA      E+   TLK+T + + + NR++       
Sbjct: 178 TNTHKDSAKIAQNVPF-YMIHFPLQASSAFKGEE-INTLKITDSYETIENRVKQLRSWYP 235

Query: 266 GYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
                 N+ G++   N E+ + +FK   K   +F D  +S +++ +  A K NLPY+  +
Sbjct: 236 NAKYTNNHTGSVFTENDEAMDKLFKALVKYNFIFVDSKTSAKSVGQKYANKYNLPYISRN 295

Query: 326 LYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
           ++LD++   + I+ +L    E+A+  G A+ +   +D +++V+ +     +  D  +V
Sbjct: 296 IFLDNEKSYEYIKSQLIKTVELAKKHGYAVAIGHPYDITLKVLKESKHLLNDVDPILV 353


>gi|283954085|ref|ZP_06371610.1| hypothetical protein C414_000080075 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794364|gb|EFC33108.1| hypothetical protein C414_000080075 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 361

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 42/223 (18%), Positives = 103/223 (46%), Gaps = 7/223 (3%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
            N+   ++AI++  +  +     R +  L   +  +F     +     K A K     ++
Sbjct: 143 KNSKKPKLAIIIDDM--ANANQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMV 199

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +P+ A +   N+ +  TL    + +++L +++   +       + N+ G++  SN+E+ 
Sbjct: 200 HLPLAAINY--NKPELDTLNPNDSKERILKKIKQIKKDFKNLRYINNHTGSLFTSNEEAM 257

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
             +++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++LK   
Sbjct: 258 RKLYEALKNQNIFFVDSKTIGNSKANKIAKELSIPYIQRDVFLDNEDDVNYVKKQLKSAV 317

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           E+A+  G AI +      + + + Q         V +V LS +
Sbjct: 318 ELAQKKGFAIAIGHPRKNTFKALEQSKDLLKS--VELVYLSEI 358


>gi|296274361|ref|YP_003656992.1| hypothetical protein Arnit_2837 [Arcobacter nitrofigilis DSM 7299]
 gi|296098535|gb|ADG94485.1| protein of unknown function DUF610 YibQ [Arcobacter nitrofigilis
           DSM 7299]
          Length = 388

 Score =  208 bits (530), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 51/282 (18%), Positives = 118/282 (41%), Gaps = 7/282 (2%)

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
            +       +    +    ++  T+E++          L +  + +E       +K    
Sbjct: 111 ADLKEKNEEIQSVEKKVFPENKQTLEKQNAQQKPLLPALEEGMIHKE--VEKNKEKIVTK 168

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
           +++  +++IV+  + +        I  +   I ++            + AK     A++ 
Sbjct: 169 SSNKPKLSIVIDDVTL--QSQINRIKDIGYTINISLMPPTKGHKNSARIAKNLPF-ALVH 225

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
            P+QA   S   ++  TLKV  + +++  R+    +         N+ G++  S+K S E
Sbjct: 226 FPLQAGITSIKFEEQNTLKVGDSYEKIEKRVAQIRKWYPKIKYTNNHTGSVFTSDKTSME 285

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            + K   K    F D  ++  ++ R +  +  +PY+  +++LD+  D + I+ +LK    
Sbjct: 286 YLIKALKKYNFQFIDSRTTSHSVVREVTKEFGMPYIARNIFLDNNKDFNYIQNQLKKAIR 345

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           IA+ TG AI +   +  ++EV+ +        D+ +V ++ L
Sbjct: 346 IAKKTGSAIAIGHPYPITMEVLKKSKYLLK--DLDLVYINKL 385


>gi|310779173|ref|YP_003967506.1| protein of unknown function DUF610 YibQ [Ilyobacter polytropus DSM
           2926]
 gi|309748496|gb|ADO83158.1| protein of unknown function DUF610 YibQ [Ilyobacter polytropus DSM
           2926]
          Length = 348

 Score =  207 bits (527), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 35/253 (13%), Positives = 93/253 (36%), Gaps = 8/253 (3%)

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPAN 197
              KK ++            P             +++I++  +G++ T T      +   
Sbjct: 104 HGEKKLVIELYYHAPIPIIPP-------EKVYSGKLSILIDDVGMN-TQTADIFGKIKKP 155

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           ++ A            ++ K+ G + IL +PM   ++S N      L    T +++  R 
Sbjct: 156 VSFATIPFLPRSSEATEKLKEYGFQVILHMPMAGSNDSLNSRTEGILMPDMTREEIYKRF 215

Query: 258 RYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKL 317
             ++       G  N+ G+    N    + + +    + + + D  ++ +      A +L
Sbjct: 216 DKAIGDVGDMNGFNNHMGSRFTENAFLMKTLLRYAKNKEMFYIDSKTTSKTKGYSTAKEL 275

Query: 318 NLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHV 377
            +P      +LD+    + I++++K   ++A+  G+ + +          +   +     
Sbjct: 276 GIPTYYCSRFLDNSKKIEDIKKEIKAAVKMAKDNGKILVIGHYHKNMAVALKSMVDYIEN 335

Query: 378 RDVSVVPLSCLAK 390
            +V +V +  + +
Sbjct: 336 ENVELVYIKEVLE 348


>gi|305433166|ref|ZP_07402322.1| conserved hypothetical protein [Campylobacter coli JV20]
 gi|304443867|gb|EFM36524.1| conserved hypothetical protein [Campylobacter coli JV20]
          Length = 343

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 98/223 (43%), Gaps = 7/223 (3%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S    AR+AI++  +  +     RA+  L   +  +F     +     K A K     ++
Sbjct: 125 SKTKQARLAIIIDDM--ANISQVRALQALKLKLIPSFFPPDKNHIDTPKLALKFDF-YMV 181

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +P+ A + +    +  TL  + + +++  +++   +       + N+ G++  S++++ 
Sbjct: 182 HLPLAAMNYTK--PELDTLNPSDSEKRIFKKIQQVKKDFKDLKFINNHTGSLFTSDEKAM 239

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + ++K F K  L+F D  +   +    +A  L   Y+  D++LD++ D   I+ +L    
Sbjct: 240 KKLYKAFEKEELIFVDSKTIASSKAPKVAKALGQIYIQRDVFLDNRDDVAYIKNQLIEAV 299

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +A+  G AI +      + + + Q         V +V LS +
Sbjct: 300 RLAKQKGFAIAIGHPRKNTFKALEQSKDLLKS--VELVYLSEI 340


>gi|57167659|ref|ZP_00366799.1| probable periplasmic protein Cj0633 [Campylobacter coli RM2228]
 gi|57020781|gb|EAL57445.1| probable periplasmic protein Cj0633 [Campylobacter coli RM2228]
          Length = 350

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 43/223 (19%), Positives = 98/223 (43%), Gaps = 7/223 (3%)

Query: 166 SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAIL 225
           S    AR+AI++  +  +     RA+  L   +  +F     +     K A K     ++
Sbjct: 132 SKTKQARLAIIIDDM--ANISQVRALQALKLKLIPSFFPPDKNHIDTPKLALKFDF-YMV 188

Query: 226 QIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESA 285
            +P+ A + +    +  TL  + + +++  +++   +       + N+ G++  S++++ 
Sbjct: 189 HLPLAAMNYTK--PELDTLNPSDSEKRIFKKIQQVKKDFKDLKFINNHTGSLFTSDEKAM 246

Query: 286 EVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
           + ++K F K  L+F D  +   +    +A  L   Y+  D++LD++ D   I+ +L    
Sbjct: 247 KKLYKAFEKEELIFVDSKTIASSKAPKVAKALGQIYIQRDVFLDNRDDVAYIKNQLIEAV 306

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +A+  G AI +      + + + Q         V +V LS +
Sbjct: 307 RLAKQKGFAIAIGHPRKNTFKALEQSKDLLKS--VELVYLSEI 347


>gi|1573763|gb|AAC22414.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
          Length = 231

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 37/197 (18%), Positives = 84/197 (42%), Gaps = 3/197 (1%)

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           +P  I++A            +EAK +G++ ++ +PMQ       ED    L +  +  Q+
Sbjct: 1   MPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQPVSAVKIEDG--GLHLGMSAAQV 58

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            +R+  +        G+ N+ G+   ++ +    +     ++ L F D  +  +++   +
Sbjct: 59  NDRVNTAKNIVRDAIGMNNHMGSAATADPQLMTYLMTALQEKHLFFLDSRTIGKSVAGKI 118

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
           A +  +  +   ++LDD  +   ++ + K     AR  G AI +      +I V+   L+
Sbjct: 119 AKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKHGSAIAIGHPRPNTIAVLQAGLR 178

Query: 374 QEHVRDVSVVPLSCLAK 390
                D+ +V +  L +
Sbjct: 179 NLPE-DIQLVGMGNLWR 194


>gi|146284395|ref|YP_001174548.1| hypothetical protein PST_4083 [Pseudomonas stutzeri A1501]
 gi|145572600|gb|ABP81706.1| putative exported protein [Pseudomonas stutzeri A1501]
          Length = 263

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 88/222 (39%), Gaps = 7/222 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A+   + +++  LG +     R +  LP  + LA            ++A + G+  +L +
Sbjct: 31  AARPSLTLIIDDLGQNPAR-DRRVLQLPGPVALAILPGTRHAAELAEQAHRAGKTVMLHM 89

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM            +         +L  RL  +L       G+ N+ G+ +    ++   
Sbjct: 90  PMAPAG------GRFAWHPQLPHDELARRLDAALAAVPHVRGLNNHMGSAMTEQPQAMTW 143

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  E  +R L F D  +SPR +    A +  L  +  D++LDD      + E+ +    +
Sbjct: 144 LMGELQRRHLFFLDSRTSPRTVAAASAQRTALASLSRDIFLDDDPSPAAVAERFQAAIAL 203

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           AR  G  + +    + ++ ++ + L +   + +  V +  + 
Sbjct: 204 ARKQGSVVIIGHPHESTLALLERELPRLTAQGIEWVDVGQMI 245


>gi|86149913|ref|ZP_01068142.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|85839731|gb|EAQ56991.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           CF93-6]
          Length = 360

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEVLKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLDNEDDVNYVKKQLESAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|86151591|ref|ZP_01069805.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315124148|ref|YP_004066152.1| hypothetical protein ICDCCJ07001_579 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|85841220|gb|EAQ58468.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|315017870|gb|ADT65963.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 360

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPEIDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSIPYIQRDVFLDNEDDVNYVKKQLESAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|327482780|gb|AEA86090.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 263

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 40/222 (18%), Positives = 89/222 (40%), Gaps = 7/222 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
           A+   + +++  LG +     R +  LP  + LA   +        ++A + G+  +L +
Sbjct: 31  AARPSLTLIIDDLGQNPAR-DRRVLQLPGPVALAILPDTRHAAELAEQAHRAGKTVMLHM 89

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           PM            +         +L  RL  +L       G+ N+ G+ +    ++   
Sbjct: 90  PMAPAG------GRFAWHPQLPHDELARRLDAALAAVPHVRGLNNHMGSAMTEQPQAMTW 143

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +  E  +R L F D  +SPR +    A +  L  +  D++LDD      + E+ +    +
Sbjct: 144 LMGELQRRHLFFLDSRTSPRTVAAASAQRTALASLSRDIFLDDDPSPAAVAERFQAAIAL 203

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           AR  G  + +    + ++ ++ + L +   + +  V +  + 
Sbjct: 204 ARKQGSVVIIGHPHESTLALLERELPRLPAQGIEWVDVGQMI 245


>gi|315930930|gb|EFV09909.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 360

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLDNEDDVNYVKKQLESAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|88597070|ref|ZP_01100306.1| conserved domain protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88190759|gb|EAQ94732.1| conserved domain protein [Campylobacter jejuni subsp. jejuni 84-25]
 gi|284925893|gb|ADC28245.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           IA3902]
          Length = 360

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPEIDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLDNEDDVNYVKKQLESAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|121613073|ref|YP_001000334.1| hypothetical protein CJJ81176_0661 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|167005280|ref|ZP_02271038.1| hypothetical protein Cjejjejuni_03335 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|87250269|gb|EAQ73227.1| conserved domain protein [Campylobacter jejuni subsp. jejuni
           81-176]
          Length = 360

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPEIDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLDNEDDVNYVKKQLESAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|86153389|ref|ZP_01071593.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85843115|gb|EAQ60326.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 360

 Score =  206 bits (524), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPEIDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLDNEDDVNYVKKQLESAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|283956047|ref|ZP_06373534.1| LOW QUALITY PROTEIN: hypothetical protein C1336_000100100
           [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792367|gb|EFC31149.1| LOW QUALITY PROTEIN: hypothetical protein C1336_000100100
           [Campylobacter jejuni subsp. jejuni 1336]
          Length = 360

 Score =  206 bits (524), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 100/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     + +   K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHNETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSMPYIQRDVFLDNEDDVNYVKKQLQSAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|315638452|ref|ZP_07893629.1| periplasmic protein [Campylobacter upsaliensis JV21]
 gi|315481443|gb|EFU72070.1| periplasmic protein [Campylobacter upsaliensis JV21]
          Length = 334

 Score =  206 bits (523), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 36/221 (16%), Positives = 89/221 (40%), Gaps = 8/221 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
               ++AI++  +  +     + +  L   +  +F  +        K AK+     ++ +
Sbjct: 120 GQKPKLAIIIDDM--ANKEQVKELKALHLKLNPSFFPSHTLHPNTPKLAKEFEF-YMVHL 176

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           P++A            L    + +++   +            + N+ G++  S++E+   
Sbjct: 177 PLKALSFQNK---MSVLSPEDSEEEIEKTIAKIKGEFKKLKFINNHTGSLFTSDEEAMRK 233

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           ++K   K  L F D  +   +    +A ++   Y+  D++LD++ D D ++ +L     +
Sbjct: 234 LYKALDKHHLSFVDSKTIHNSKAPKIAKEMQKIYIKRDVFLDNEDDVDYVKNQLLSAVNL 293

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A+  G AI +      + + + +  +      V +V LS L
Sbjct: 294 AQKRGYAIAIGHPKKNTFKALKESKELLKS--VDLVYLSEL 332


>gi|218562283|ref|YP_002344062.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|112359989|emb|CAL34778.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
          Length = 360

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 100/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+ + +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMKKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +L++PY+  D++LD++ D + ++++L+   ++A
Sbjct: 260 YEALKNQNIFFVDSKTIGNSKANKIAKELSIPYIQRDVFLDNEDDVNYVKKQLENAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLK--GVDLVYLSEI 357


>gi|313143477|ref|ZP_07805670.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
 gi|313128508|gb|EFR46125.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818]
          Length = 354

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 45/244 (18%), Positives = 104/244 (42%), Gaps = 8/244 (3%)

Query: 148 NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
           ++  +    +   +      AS  ++ +++  L  S+    +A+  LP NIT +      
Sbjct: 98  SQNPQNPQNLNTQNSQNLPLASKPKVLLIMDDL--SKLSQIKALESLPLNITPSIFPKTR 155

Query: 208 S---LDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRG 264
                    K   + G+  ++ +P++A +    E +   LKV    Q L  ++    +  
Sbjct: 156 HNGITPNLAKRVIQNGKIFMIHLPLEAQNFMQKELEP--LKVGIDKQSLKEQILQIKQDF 213

Query: 265 TGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVA 324
                + N+ G+    +K   + + + F +  L F D  + P   + +LA +     M  
Sbjct: 214 PQLVYLNNHTGSKFTQSKTDMKNLLEVFDELDLKFIDSVTIPNPASEILAKEQKRLIMQR 273

Query: 325 DLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVP 384
           D++LD+Q +    +++L+ L + A+  G AI +      + + ++Q  ++ +  ++ +V 
Sbjct: 274 DIFLDNQTNIAYTKKQLQSLIQKAKKKGYAIAICHPHPSTFKALAQMQKELNA-NLELVS 332

Query: 385 LSCL 388
            S L
Sbjct: 333 PSEL 336


>gi|224437004|ref|ZP_03657985.1| hypothetical protein HcinC1_03480 [Helicobacter cinaedi CCUG 18818]
          Length = 360

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 45/244 (18%), Positives = 104/244 (42%), Gaps = 8/244 (3%)

Query: 148 NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
           ++  +    +   +      AS  ++ +++  L  S+    +A+  LP NIT +      
Sbjct: 104 SQNPQNPQNLNTQNSQNLPLASKPKVLLIMDDL--SKLSQIKALESLPLNITPSIFPKTR 161

Query: 208 S---LDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRG 264
                    K   + G+  ++ +P++A +    E +   LKV    Q L  ++    +  
Sbjct: 162 HNGITPNLAKRVIQNGKIFMIHLPLEAQNFMQKELEP--LKVGIDKQSLKEQILQIKQDF 219

Query: 265 TGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVA 324
                + N+ G+    +K   + + + F +  L F D  + P   + +LA +     M  
Sbjct: 220 PQLVYLNNHTGSKFTQSKTDMKNLLEVFDELDLKFIDSVTIPNPASEILAKEQKRLIMQR 279

Query: 325 DLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVP 384
           D++LD+Q +    +++L+ L + A+  G AI +      + + ++Q  ++ +  ++ +V 
Sbjct: 280 DIFLDNQTNIAYTKKQLQSLIQKAKKKGYAIAICHPHPSTFKALAQMQKELNA-NLELVS 338

Query: 385 LSCL 388
            S L
Sbjct: 339 PSEL 342


>gi|330900944|gb|EGH32363.1| hypothetical protein PSYJA_26750 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 199

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 36/190 (18%), Positives = 81/190 (42%), Gaps = 6/190 (3%)

Query: 203 ASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLR 262
             +      + ++A + G+  +L +PM            Y       + +L +RL  +L 
Sbjct: 1   MPDTPHATEFARQAHRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALL 54

Query: 263 RGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYM 322
           +     G+ N+ G+ + +   +   +  E  +R L F D  +S + +    A ++ L  +
Sbjct: 55  KVPYAAGINNHMGSRMTAEPVAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASV 114

Query: 323 VADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSV 382
             D++LDD+   + I  +L+   +IAR  G A+ +   +  +++V+ + L     + V  
Sbjct: 115 SRDVFLDDERTAEAITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEW 174

Query: 383 VPLSCLAKLS 392
           + L  +    
Sbjct: 175 IDLRSMISER 184


>gi|217967182|ref|YP_002352688.1| protein of unknown function DUF610 YibQ [Dictyoglomus turgidum DSM
           6724]
 gi|217336281|gb|ACK42074.1| protein of unknown function DUF610 YibQ [Dictyoglomus turgidum DSM
           6724]
          Length = 391

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 42/230 (18%), Positives = 99/230 (43%), Gaps = 6/230 (2%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +IA VV  +          +   P  + ++        ++  ++  ++G E ++ +PM+
Sbjct: 157 PKIAFVVDDVVEDNYWVHE-LLSFPYTLNISIIP-TRKAEKVAEKIFERGWEIMMHLPME 214

Query: 231 AFDESYNE--DDSYTLKVTQTVQQLLNRLRYSLRRGTG--YFGVMNYRGAMLLSNKESAE 286
           +     +     +  + V     ++ N +R  L+R        V N+ G+ +  + E+ E
Sbjct: 215 SITYPKDAKYLVAEAIMVGMNEDEIDNIVRTHLKRFGNIKVSWVNNHMGSKVTKDPETME 274

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEE 346
            +   F K  L F D  +   ++   +A    +P +   L++D + D +KIR +      
Sbjct: 275 KVINVFKKYNLAFLDSKTILGSVAYKMANSSGIPSLENMLFIDHENDENKIRLRFLKAIN 334

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           +A++ G  + +     ++I+V+ +  ++    DV +V +S L +  +  S
Sbjct: 335 MAKSKGWGVFILHLRPKTIKVLKELEKEGFFADVDLVKISDLYEAINEHS 384


>gi|237752167|ref|ZP_04582647.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376409|gb|EEO26500.1| conserved hypothetical protein [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 359

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 45/275 (16%), Positives = 99/275 (36%), Gaps = 14/275 (5%)

Query: 123 TSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGI 182
           +          R       K+ + +++        P +D NFC   +  ++AI++    +
Sbjct: 89  SPQGLNQNSTPRKTTPHEAKQTIQESQRQELLAPSPKLDSNFCV-RNKPQLAIIIDD--V 145

Query: 183 SQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSY 242
           S     +AI  +P  +T +            K AK      ++ +P++A +    E    
Sbjct: 146 SNFAQYQAIKEIPFKLTPSLFPKSKVNPDTPKIAKIAPF-YMIHLPLEALNFHQKE--HK 202

Query: 243 TLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDD 302
            L    +  ++ + +            + N+ G+    N ES  ++ +      + F D 
Sbjct: 203 WLFAGDSKDKMESYIAAIKHDFPNLSHINNHTGSKFTQNLESMSLLLETLNNHHINFIDS 262

Query: 303 GSSPRNLTRVL-APKLNLPY-------MVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
            +     T    A    + +       +  D++LD+ +D  KI E+L    +IA+  G A
Sbjct: 263 RTIATTKTNSAYAKSPYIAFNPCQQKPLERDVFLDNVLDIPKITEQLIQAVQIAKQKGYA 322

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           I +      ++  +           V +V ++ + 
Sbjct: 323 IAIGHPHKATLLTLKNATDYLQKSGVELVYINEII 357


>gi|307721625|ref|YP_003892765.1| hypothetical protein Saut_1709 [Sulfurimonas autotrophica DSM
           16294]
 gi|306979718|gb|ADN09753.1| protein of unknown function DUF610 YibQ [Sulfurimonas autotrophica
           DSM 16294]
          Length = 328

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 42/233 (18%), Positives = 97/233 (41%), Gaps = 11/233 (4%)

Query: 153 EDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRW 212
                 A  K      S  ++AI++  +    T   RA+  L  N+T++F     +    
Sbjct: 99  LANPPKAKAKKVEIYTSKPKLAIIIDDM--QTTSQVRAVKSLHLNVTMSFLPPRAARPNS 156

Query: 213 MKEAKKKGQE--AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
            K       E   ++ +PM+A   S  E   +TL++  + Q++  +++   +       +
Sbjct: 157 AKL---ASHEKFYMVHLPMEAMHFSAEE--PHTLRIYDSQQKISAKIKDIKKLFPKVGYI 211

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            N+ G+   +N+ +   +        + F D  ++ + +   +     L Y+  D++LD 
Sbjct: 212 NNHTGSKFTANEVAMNRLIFALNTNHIHFIDSRTTAKTMAPKVLKNFGLKYVSRDVFLDH 271

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
            +D+  I +++K    +A++ G AI +      +++ + +        DV +V
Sbjct: 272 HMDKPYILKQIKKAIAVAKSHGSAIAIGHPHKNTLQALYESKDLFK--DVELV 322


>gi|212705014|ref|ZP_03313142.1| hypothetical protein DESPIG_03082 [Desulfovibrio piger ATCC 29098]
 gi|212671566|gb|EEB32049.1| hypothetical protein DESPIG_03082 [Desulfovibrio piger ATCC 29098]
          Length = 422

 Score =  204 bits (518), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 82/218 (37%), Gaps = 7/218 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             + +V+  +G  +      +  LP  + LA   +        + A+  G + +L +PM+
Sbjct: 190 PALVLVIDDMGQ-KLEPAEQLASLPFPVALALWPHAAVRRSVQQVARDMGLDVLLHMPME 248

Query: 231 A---FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           A    + +        L+       + + L  +L +     G  N+ G+     +++  +
Sbjct: 249 AMPRKNGTAPNPGPGALETDMDAYAMEHALDKALAQVPTALGFNNHMGSGFTGQRDACRM 308

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +      RGL   D  +   +       +  +      ++LDD    DK+   L     +
Sbjct: 309 LAGLAYGRGLFVLDSVTRGNSQLENSMVRQGIVTASRHVFLDDPQGTDKVLAALDKAARL 368

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
           AR  G AI +      ++  + +W  +     V+VVPL
Sbjct: 369 ARKQGIAIAIGHPHASTLRALERWENR---EGVAVVPL 403


>gi|157414912|ref|YP_001482168.1| hypothetical protein C8J_0592 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|157385876|gb|ABV52191.1| hypothetical protein C8J_0592 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|307747550|gb|ADN90820.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           M1]
          Length = 360

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 99/220 (45%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +LN+PY+  D++LD++ D + ++++++   ++A
Sbjct: 260 YEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLDNEDDVNYVKKQIQNAVKLA 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLKS--VDLVYLSEI 357


>gi|294102438|ref|YP_003554296.1| protein of unknown function DUF610 YibQ [Aminobacterium colombiense
           DSM 12261]
 gi|293617418|gb|ADE57572.1| protein of unknown function DUF610 YibQ [Aminobacterium colombiense
           DSM 12261]
          Length = 343

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 42/244 (17%), Positives = 93/244 (38%), Gaps = 10/244 (4%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
            +  A  +N         IAIV+   G S +     I  +   +T A            +
Sbjct: 103 IKAEAEGENRDEGEPLPVIAIVIDDFGFSYSL-AEKIAAIDLPVTWAIIPYQRFTHETAR 161

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
            A  K    ++ +PM+A  +      +  + V  +   L   +R       G  G+ N+R
Sbjct: 162 LAASKNIPYLVHMPMEALADKSQ--GASLIGVGMSAPALSKVVRDVFALLPGAVGMNNHR 219

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G+   S+K++ E + +       +F D  +S  ++   +A    +P +   ++LD + D 
Sbjct: 220 GSKATSDKKTMEALMETLRPLEKVFVDSRTSSCSVAYDMALCYGIPAVYNSVFLDHEKDI 279

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDV---SVVPLSCLAKL 391
           + +R++ +    IA+  G  + +     ++I  + +        ++     V +  L + 
Sbjct: 280 EFMRKQFQRAITIAKRRGWVLAICHNRPDTIPFLQE----LCDSNINVVKFVTVPELLEE 335

Query: 392 SSPS 395
              +
Sbjct: 336 EKGT 339


>gi|313681712|ref|YP_004059450.1| hypothetical protein Sulku_0584 [Sulfuricurvum kujiense DSM 16994]
 gi|313154572|gb|ADR33250.1| protein of unknown function DUF610 YibQ [Sulfuricurvum kujiense DSM
           16994]
          Length = 344

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 39/218 (17%), Positives = 96/218 (44%), Gaps = 7/218 (3%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A++ I++  +  ++    +AI      + ++F             AK++G   ++ +P++
Sbjct: 134 AKLVIIIDDVSYARD--VKAIQSTGLPLVMSFLPPSPRHPDSAALAKQQG-TYMVHLPLE 190

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A      +++  TL++  T +++  RL    +       + N+ G+   S+  + + + +
Sbjct: 191 AVAFH--DEEPNTLRIGSTEEEIEKRLDALKQLYPNVHYINNHTGSKFTSDSAAMDKLIR 248

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
              K GL F D  +   +  R    K  + Y+  D++LDDQ     ++++++   E A+ 
Sbjct: 249 IMKKEGLQFVDSRTIGTSKGREATEKHGMRYLTRDVFLDDQDGVGNVKKQIRDAVEKAKR 308

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            G AI +     ++I+ + +         V +V +  +
Sbjct: 309 YGTAIAIGHPRKDTIQALKESKDILGE--VRLVGIGQI 344


>gi|218961345|ref|YP_001741120.1| hypothetical protein CLOAM1042 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730002|emb|CAO80914.1| hypothetical protein CLOAM1042 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 357

 Score =  203 bits (517), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 38/224 (16%), Positives = 88/224 (39%), Gaps = 2/224 (0%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           I IVV   G            L   +  +         + MK AK++G+  ++ IPM+  
Sbjct: 131 ITIVVDDFGTIGGDLLTGFLALDKEVCFSIFPEEEYSVQTMKLAKEQGRLTLIHIPMEPI 190

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
                      + V    +Q+   +   + +     G  N+ G++  +++E    +    
Sbjct: 191 GYPEVNPGKNPILVQYDERQIEKIMTRFIEQLPYCVGANNHMGSLATTDEEVMNSVMAIL 250

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV-DRDKIREKLKGLEEIARTT 351
            K    F D  ++  ++   +A K +L     DL+LD     +  +  KL  + E++   
Sbjct: 251 KKHNKFFLDSRTTNVSVAYSVAQKNHLKSYRNDLFLDSPNISQSTMDAKLNQIIELSNRN 310

Query: 352 GQAIGVAVAFD-ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
              I +    + + ++ + +++ +      +++PL+ + K + P
Sbjct: 311 QNVIAITHCHNYDKLDYLKRFINRLKAAGFTLIPLTDIDKYNVP 354


>gi|57242341|ref|ZP_00370280.1| probable periplasmic protein Cj0633 [Campylobacter upsaliensis
           RM3195]
 gi|57017021|gb|EAL53803.1| probable periplasmic protein Cj0633 [Campylobacter upsaliensis
           RM3195]
          Length = 356

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 35/221 (15%), Positives = 88/221 (39%), Gaps = 8/221 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
               ++ I++  +  +     + +  L   +  +F  +        K AK+     ++ +
Sbjct: 142 GQKPKLVIIIDDM--ANKEQVKELKALHLKLNPSFFPSHTLHPNTPKLAKEFEF-YMVHL 198

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           P++A            L    + +++   +            + N+ G++  S++E+   
Sbjct: 199 PLKALSFQNK---MSVLSPEDSEEEIEKTIAKIKGEFKNLKFINNHTGSLFTSDEEAMRK 255

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           ++K   K  L F D  +   +    +A ++   Y+  D++LD++ D D ++ +L     +
Sbjct: 256 LYKALDKHHLTFVDSKTIHHSKAPKIAKEMRKIYIKRDVFLDNEDDVDYVKNQLLNAVNL 315

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           A+  G AI +      + + + +  +      V +V LS L
Sbjct: 316 AQKRGYAIAIGHPKKNTFKALKESKELLKS--VDLVYLSEL 354


>gi|218962072|ref|YP_001741847.1| hypothetical protein CLOAM1809 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730729|emb|CAO81641.1| conserved hypothetical protein [Candidatus Cloacamonas
           acidaminovorans]
          Length = 262

 Score =  203 bits (516), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 41/253 (16%), Positives = 93/253 (36%), Gaps = 4/253 (1%)

Query: 140 SKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANIT 199
            K E  + +       E      +  ++A    + I++   G +        + LP  I 
Sbjct: 6   EKTESKSVSTPDMTAIESYKYTWSNNTDAMPP-VVIIIDDFGQNAGQLLDDFSALPKEIA 64

Query: 200 LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRY 259
            +   +        + A+K   E ++ IPMQA D          ++       + + L+ 
Sbjct: 65  FSILPDLPYTQTVARLAEKTNHETLIHIPMQALDHQA-NPGKRYIRTGMDKYAISDLLQD 123

Query: 260 SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNL 319
              +        N+ G+ + S+  +  +I +E    GL F D  ++ ++        L L
Sbjct: 124 FYAQIPNAIAANNHMGSEVTSDLATMNIILEELDNLGLYFLDSATTNKSAAFTAGKNLGL 183

Query: 320 PYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD-ESIEVISQWLQQEHV 377
                D++LD        I  K++GL +        + +    + + +  + ++L+Q   
Sbjct: 184 KIAKRDIFLDVPDNSDATIINKIEGLAKYKGRNEPVVIITHCHNRDKLNALQKFLKQIDN 243

Query: 378 RDVSVVPLSCLAK 390
             + ++ +S L +
Sbjct: 244 MGIELISVSQLFR 256


>gi|148926620|ref|ZP_01810301.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|145845139|gb|EDK22234.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8486]
          Length = 366

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 98/220 (44%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 151 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 207

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 208 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 265

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +LN+PY+  D++LD++ D + ++++L+   ++ 
Sbjct: 266 YEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLDNEDDVNYVKKQLESAVKLT 325

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 326 QKKGFVIAIGHPRKNTFKALEQSKDLLKS--VDLVYLSEI 363


>gi|57236946|ref|YP_178747.1| hypothetical protein CJE0736 [Campylobacter jejuni RM1221]
 gi|205355483|ref|ZP_03222254.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|57165750|gb|AAW34529.1| conserved domain protein [Campylobacter jejuni RM1221]
 gi|205346717|gb|EDZ33349.1| putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315058047|gb|ADT72376.1| Putative periplasmic protein [Campylobacter jejuni subsp. jejuni
           S3]
 gi|315926751|gb|EFV06125.1| divergent polysaccharide deacetylase family protein [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 360

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 37/220 (16%), Positives = 98/220 (44%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +LN+PY+  D++LD++ D + ++++L+   ++ 
Sbjct: 260 YEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLDNEDDVNYVKKQLESAVKLT 319

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G  I +      + + + Q         V +V LS +
Sbjct: 320 QKKGFVIAIGHPRKNTFKALEQSKDLLKS--VDLVYLSEI 357


>gi|332298458|ref|YP_004440380.1| protein of unknown function DUF610 YibQ [Treponema brennaborense
           DSM 12168]
 gi|332181561|gb|AEE17249.1| protein of unknown function DUF610 YibQ [Treponema brennaborense
           DSM 12168]
          Length = 355

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 51/313 (16%), Positives = 108/313 (34%), Gaps = 14/313 (4%)

Query: 72  TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS-GKTVVNKPTRSTSIDSLPT 130
           T P   ED + P     +                +Q  IS   +V  +P + TS     +
Sbjct: 43  TAPPAAEDFRQPPAVSPSVPAPVTPQTPVSPSVSVQPPISVQPSVEQQPAKQTSPTEPVS 102

Query: 131 IEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRA 190
           + E  +  + K+ +             P  D    + A  A +  +    G +     + 
Sbjct: 103 VPEPSLPIVPKEPV---------PPVHPEFDLIPTA-APRAVLVFIFDDGGQNLD-QLQP 151

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
              LP  +++A            K  +  G+E +L  PMQA +          +      
Sbjct: 152 FLNLPFPVSIAVMPELVHSVESAKRVRAAGKELLLHQPMQAKNL-AVNPGPGAIHPDMDR 210

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
             +   L  +L++     G+ N+ G+++  +    + +    A  G+ F D  ++     
Sbjct: 211 DAVRKLLHSNLQKIGPVAGMNNHEGSLITESVTQMDAVLDVCAAEGIFFLDSRTTADTQV 270

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF-DESIEVIS 369
             +A    +     D++LD+  DR  I ++L     IA   G A+ +   +  +   +++
Sbjct: 271 PAVAAARGMKIWERDIFLDNTPDRRDILDQLYRGAAIANKKGYAVMIGHVWSPQLASILN 330

Query: 370 QWLQQEHVRDVSV 382
           +       +  + 
Sbjct: 331 ELYPLLKKKGYTF 343


>gi|229022892|ref|ZP_04179412.1| hypothetical protein bcere0029_12380 [Bacillus cereus AH1272]
 gi|228738427|gb|EEL88903.1| hypothetical protein bcere0029_12380 [Bacillus cereus AH1272]
          Length = 209

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 39/209 (18%), Positives = 82/209 (39%), Gaps = 4/209 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  LP  +T+A      S  +    A KKG E I+ +PM+             +    + 
Sbjct: 1   MLSLPIPLTIAVMPFLPSTKQDAIAAHKKGHEVIIHMPMEPIRGKKEWLGPKAITTDLSD 60

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
           +++ NRL  +++      G+ N+ G+ + +++    +I     K GL + D  ++P ++ 
Sbjct: 61  EEINNRLEQAIQEIPHAIGMNNHMGSKVTADERIVRLILSACKKHGLFYLDSKTNPNSVV 120

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD---ESIEV 367
             +  +L +P +   L+ DD      I  + + L +  +     + +         +  V
Sbjct: 121 PKIGKELGVPVIENQLFFDDVYTASHISRQAQLLIKKIQEKPIMVAIGHVGPPGEITSRV 180

Query: 368 ISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           I   + +        + LS L     P S
Sbjct: 181 IETSIPKVREHA-DFIFLSDLVLSPPPVS 208


>gi|88798902|ref|ZP_01114484.1| hypothetical protein MED297_12627 [Reinekea sp. MED297]
 gi|88778382|gb|EAR09575.1| hypothetical protein MED297_12627 [Reinekea sp. MED297]
          Length = 259

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 88/226 (38%), Gaps = 6/226 (2%)

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           R+ +V+  LG        AI  LP+  T+A            + A   G+E I+  PM  
Sbjct: 29  RLVLVMDDLGNQYRLGLDAI-ALPSVTTVAIMPGRPYTRELAEYAHSLGKEVIIHAPMA- 86

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            + +        L   +  + LL  LR ++       G+ N+ G+ L  + E+   I +E
Sbjct: 87  -NLTDFPLGPMGLTREKGPESLLKNLRDAIDSVPYAVGLSNHMGSRLTQDGEAMGWIMQE 145

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             ++ L FFD  +   ++   +A    +P+    ++LD       I  + +         
Sbjct: 146 LKRQNLYFFDSKTIASSIAWQVAQNHFIPWSSRQVFLDHYQTEAFIASQWRLALAQVDQG 205

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSV-VPLSCLAKLSSPSS 396
                +A  + E++       ++E  +D +  VPLS +      +S
Sbjct: 206 QTVTVIAHPYPETLAFFQN--RREMTQDTAFSVPLSHVLNYPVMTS 249


>gi|228984507|ref|ZP_04144684.1| hypothetical protein bthur0001_12120 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228775210|gb|EEM23599.1| hypothetical protein bthur0001_12120 [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
          Length = 215

 Score =  201 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 40/215 (18%), Positives = 84/215 (39%), Gaps = 4/215 (1%)

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
                 +  LP  +T+A      S       A KKG E I+ +PM+             +
Sbjct: 1   MKGTDKMLSLPIPLTVAVMPFLPSTKEDAIAAHKKGHEVIIHMPMEPIKGKKEWLGPKAI 60

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
               + +++ NRL  +++      G+ N+ G+ + +++    +I     K GL + D  +
Sbjct: 61  TTDLSDEEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIVRLILAACKKHGLFYLDSKT 120

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD-- 362
           +P+++   +  +L +P +   L+ DD      I ++ + L +  +     + +       
Sbjct: 121 NPKSVVPKIGKELGVPIIENQLFFDDVYTAAHISKQAQLLIKKLQEKPIMVAIGHVGPPG 180

Query: 363 -ESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
             +  VI   + +        + LS LA    P S
Sbjct: 181 EITSRVIETSIPKIREHA-DFIFLSDLALSPPPVS 214


>gi|229065441|ref|ZP_04200691.1| hypothetical protein bcere0026_54560 [Bacillus cereus AH603]
 gi|229132227|ref|ZP_04261084.1| hypothetical protein bcere0014_11660 [Bacillus cereus BDRD-ST196]
 gi|228651275|gb|EEL07253.1| hypothetical protein bcere0014_11660 [Bacillus cereus BDRD-ST196]
 gi|228715835|gb|EEL67605.1| hypothetical protein bcere0026_54560 [Bacillus cereus AH603]
          Length = 215

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 41/214 (19%), Positives = 87/214 (40%), Gaps = 5/214 (2%)

Query: 185 TGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTL 244
                 +  LP  +T+A      S  +    A KKG E I+ +PM+             +
Sbjct: 1   MKGTDKMLSLPIPLTVAVMPFLPSTKQDAIAAHKKGHEVIIHMPMEPIRGKKEWLGPKAI 60

Query: 245 KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGS 304
               + +++ NRL  +++      G+ N+ G+ + +++    +I     K GL + D  +
Sbjct: 61  TTDLSDEEINNRLEQAIQEIPHAIGMNNHMGSKVTADERIVRLILSACKKHGLFYLDSKT 120

Query: 305 SPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV---AF 361
           +P ++   +  +L +P +   L+ DD      I ++ + L +  +     + +       
Sbjct: 121 NPNSVVPKIGKELGVPIIENQLFFDDVYTVSHISKQAQLLIKKIQDKPIMVAIGHVGAPG 180

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
           + +  +I   + +        + LS LA LS PS
Sbjct: 181 EITSRIIETSIPKIREHA-DFIFLSDLA-LSPPS 212


>gi|170746547|ref|YP_001752807.1| protein of unknown function DUF610 YibQ [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653069|gb|ACB22124.1| protein of unknown function DUF610 YibQ [Methylobacterium
           radiotolerans JCM 2831]
          Length = 411

 Score =  199 bits (506), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 91/400 (22%), Positives = 151/400 (37%), Gaps = 16/400 (4%)

Query: 2   SIDLNHPLR-------KKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTI 54
              L  PL        +   +     +                V  +  +L      G  
Sbjct: 6   DDILTRPLGVPEAAPAQPEGRIGRLVAAGRRPRVAAAALAASFVVAAGLVLALGDPHGGE 65

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTV----CNQLKNDSSQHDGQIQNDI 110
             +     +RE A  P       +  Q  +             +++  S     +     
Sbjct: 66  PRVQVAITMREPAARPAAQAPAAQQPQVITTEPGTAPLQRSAEEVETASGVTVVRPAGSG 125

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
             + VV +    ++       + R+             K+G        +        SG
Sbjct: 126 PSEAVVIRVPPPSAPRLAQAPDPRIS---ESGRHGLMPKLGEGRIRALDVYARSEEAGSG 182

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            RIAIVV+GLG+ Q  T  A   LPA ++LAF   G  ++R    A+  G E  LQ+PM+
Sbjct: 183 PRIAIVVTGLGVGQAATAGATARLPAAVSLAFLPYGGEVERAAARARDAGHEVFLQLPME 242

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            FD   ++    TL       +  +R  +++ R  GY GV+NY G+ L+++  + E + +
Sbjct: 243 PFDYPDSDPGPQTLLTALKGLENADRQAWAMARFPGYVGVVNYMGSKLMAD-AAFEPVLR 301

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           E   RGL F DDG++ +      A K   P   A++ LD     D I   L   E  AR 
Sbjct: 302 EIGARGLGFLDDGTASK-PAVAPANKGKTPVARAEIVLDATPRADAIDAALAQAEARARA 360

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            G A+  A     S++ I++W ++   R + +VP S   +
Sbjct: 361 NGFALVSATGTPLSVDRIARWAKEIESRGLRLVPASVALR 400


>gi|222823948|ref|YP_002575522.1| polysaccharide deacetylase domain protein [Campylobacter lari
           RM2100]
 gi|222539170|gb|ACM64271.1| conserved hypothetical protein, polysaccharide deacetylase domain
           protein [Campylobacter lari RM2100]
          Length = 355

 Score =  199 bits (505), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 45/220 (20%), Positives = 98/220 (44%), Gaps = 7/220 (3%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
           +  R+AI++  +  S T     +      +  +F           + AK      ++ +P
Sbjct: 142 TKPRLAIIIDDM-ASHTHVD-MLKKTNLKLIPSFFPPDKRHPYTAEFAKDFDF-FMVHLP 198

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A      E    TL     +Q++  R+ +   +      + N+ G++  +NK++ E +
Sbjct: 199 LAAIKYDKAEL--NTLHPGDDMQKIGKRVAFVKEQFPKVKFINNHTGSLFTANKQAMEKL 256

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           F  F +   +F D  +  ++  + LA + N PY+  D++LD++ D   I+ +LK   E A
Sbjct: 257 FSAFKQNDFVFVDSRTIGKSKAKNLASQFNQPYIARDVFLDNEDDIVYIKNQLKQAVEEA 316

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
           +  G AI +    +++ + + Q  +  +   V +V L+ +
Sbjct: 317 KKKGFAIAIGHPREKTFKALVQSKELLNS--VELVYLNEI 354


>gi|47566220|ref|ZP_00237248.1| hypothetical protein exported protein [Bacillus cereus G9241]
 gi|47556773|gb|EAL15104.1| hypothetical protein exported protein [Bacillus cereus G9241]
          Length = 209

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 40/209 (19%), Positives = 84/209 (40%), Gaps = 4/209 (1%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +  LP  +T+A      S       A KKG E I+ +PM+             +    + 
Sbjct: 1   MLSLPIPLTVAVMPFLPSTKEDAIAAHKKGHEVIIHMPMEPIKGKKEWLGPKAITTDLSD 60

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
           +++ NRL  +++      G+ N+ G+ + +++    +I     K GL + D  ++P+++ 
Sbjct: 61  EEINNRLEQAIQEVPHAIGMNNHMGSKVTADERIVRLILAACKKHGLFYLDSKTNPKSVV 120

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD---ESIEV 367
             +  +L +P +   L+ DD      I ++ + L +  +     + +         +  V
Sbjct: 121 PKIGKELGVPIIENQLFFDDVYTAAHISKQAQLLIKKLQEKPIMVAIGHVGPPGEITSRV 180

Query: 368 ISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           I   + +        + LS LA    P S
Sbjct: 181 IETSIPKIREHA-DFIFLSDLALSPPPVS 208


>gi|220904168|ref|YP_002479480.1| hypothetical protein Ddes_0895 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868467|gb|ACL48802.1| protein of unknown function DUF610 YibQ [Desulfovibrio
           desulfuricans subsp. desulfuricans str. ATCC 27774]
          Length = 490

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 46/226 (20%), Positives = 84/226 (37%), Gaps = 7/226 (3%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                 +A+V+  +G S         L P  +T A   +        + A ++  + ++ 
Sbjct: 244 PLPRPALALVIDDMGQSLEAAGALAAL-PYAVTPAIWPHAPHATSTAELAAQRRMDVLVH 302

Query: 227 IPMQAF---DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +PM+A    D +        LKV     ++   L  +L       G+ N+ G+    +  
Sbjct: 303 VPMEALPRKDGTIPNPGQGALKVGMEPHRIQAILEANLASLPTAVGMNNHMGSAFTGDAA 362

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +  ++    A  G    D  ++P +L    A  L L     D++LD       I + L  
Sbjct: 363 ACRIVCARLAGTGFFLLDSLTTPGSLLAQQARALGLVSASRDVFLDTYRQTPAILKALDQ 422

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
               AR  G AI +   + E++  +  W        V++VPL  L 
Sbjct: 423 AAVRARIRGYAIAIGHPYAETLSALRAWQN---SEGVALVPLRRLI 465


>gi|167648681|ref|YP_001686344.1| hypothetical protein Caul_4726 [Caulobacter sp. K31]
 gi|167351111|gb|ABZ73846.1| protein of unknown function DUF610 YibQ [Caulobacter sp. K31]
          Length = 395

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 74/339 (21%), Positives = 128/339 (37%), Gaps = 8/339 (2%)

Query: 52  GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
                 +    + +I           E   +   ++   +   L   +            
Sbjct: 64  PNKGSPMVRVELTKIGATRNAPSGWREALVNEGDKEAPLLPGALDLSNLPFISHPDTAAE 123

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
            + +   P  +++   LP                    +  +            +     
Sbjct: 124 AEAIAAPPPMASATGPLPAAPLAGF-YTPGPGGGVLPVIAPDGRTAAEAYARPFTADGRP 182

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           ++A+V+ GLG++   T+ AI  LP  ITL+FA     L  W+  A+  G E +L+ PM+ 
Sbjct: 183 KVALVIGGLGLNPQTTRAAIETLPPEITLSFAPYAEGLQGWIDLARSHGHEVLLEAPMEP 242

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
            D   N+   YTL      +  + +L + + R TGYFG+ NY G+  +++  +       
Sbjct: 243 VDYPANDPGPYTLITANRPEDTVRKLEWLMSRATGYFGLTNYLGSRFVTSDTAMTTFTLA 302

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
              RGL F DDG +             +P   AD  +DD++    I  +LK LE  A   
Sbjct: 303 LKSRGLAFIDDGQAS-------LRGGPIPRASADRIIDDELAAGSIDGQLKMLETGAAGR 355

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           GQA+G   A+  +I  +  W      R + + P S +AK
Sbjct: 356 GQALGSGFAYPVTITQVRLWAAGLSGRGLQLAPASAMAK 394


>gi|282858015|ref|ZP_06267216.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
 gi|282584169|gb|EFB89536.1| conserved hypothetical protein [Pyramidobacter piscolens W5455]
          Length = 323

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 50/293 (17%), Positives = 111/293 (37%), Gaps = 4/293 (1%)

Query: 100 SQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPA 159
            +   + +   +   VV                E+ +    K  L+A + V R  +    
Sbjct: 27  GESVRRREARKAENAVVLSAEERLWRPGAFPSLEKTLSSTKKTILVAASWVARLQSAALP 86

Query: 160 MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
                 + AS   +A+V+   G +  G    I  L    T A         +  + A K+
Sbjct: 87  KKGKPAA-ASRPGLALVIDDFGYNY-GMAERIARLKLRATWAIIPGTPHSLKIAEYAAKQ 144

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           GQ  +L +PMQA  +     + Y + +    +++   L    +      G+ N+RG+   
Sbjct: 145 GQPFLLHVPMQALGDPNGGRN-YVIGIDVPEKKMAEYLASLQKDFPRAIGINNHRGSKAT 203

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           S+  +     K  +     F D  +S + + + +A +  +P +   +++D   D   ++ 
Sbjct: 204 SDAPTMRRFMKALSATRWGFLDSHTSGKTVAQKVALEYRIPVVQNKVFIDGTTDLSAMKA 263

Query: 340 KLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +      +AR  G A+ +  A + ++  ++ +L +  +  V +V +  +    
Sbjct: 264 QFNAALRLARKYGNAVAICHAREGTLPFLA-YLSKLDLNPVKLVTVDEIWNSQ 315


>gi|114799786|ref|YP_761883.1| hypothetical protein HNE_3208 [Hyphomonas neptunium ATCC 15444]
 gi|114739960|gb|ABI78085.1| conserved hypothetical protein [Hyphomonas neptunium ATCC 15444]
          Length = 429

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 86/404 (21%), Positives = 151/404 (37%), Gaps = 18/404 (4%)

Query: 9   LRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAP 68
           +  +  +     + ++       +F +  + L   I ++                 +   
Sbjct: 1   MGYRQSEPSPLKTGLMHAGMSLGVFGSLAIALGAGIHVTADPSEAGPRQTIALFGTDAGE 60

Query: 69  IPLTIPLNIEDK------QSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP--- 119
                              +             + D       I     G  V       
Sbjct: 61  SDSAFAALPSADYEEDYVAADDAVSGAVDIAYTELDGEGMRIDITGGQGGPAVAPAVGIR 120

Query: 120 -------TRSTSIDSLPTIEERLILGLSKKEL--LAKNKVGREDTEVPAMDKNFCSNASG 170
                     +  +             ++  L    +              + F ++   
Sbjct: 121 INGRLVQPGQSFGEVASGTPAGAGEAGAQLTLNTAEQVSKPASKAPADIYARPFSNSGGQ 180

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             +++V+ GLGI+ T T+ AI+ LPA++TL+FA +   LD W+K A++ G E ++++PM+
Sbjct: 181 PVVSLVIGGLGINSTQTKLAIDALPADVTLSFAPDAKRLDYWIKTAREDGHEVLIEVPME 240

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           AF+         TL      +  L +L   L R +GY+GV+NY+GA   ++  S   IF 
Sbjct: 241 AFEYGRMRMHPDTLIAGGDQKANLAKLNQVLSRASGYYGVINYQGAKFGADAGSIAPIFD 300

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
             A+RGL F DDGS  +     +A    L +  A   +D +     I  +   LE IAR 
Sbjct: 301 VLAERGLAFVDDGSVHKAFFGQVADTKGLRFARAAGPIDTRQSPQDIAAEFMELETIARQ 360

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
            G AIG   AF  +IE  S W+     + + + P+S L   ++P
Sbjct: 361 HGGAIGAGFAFPVTIEAASLWIDTLEEKGLVLAPVSFLVPDAAP 404


>gi|154175021|ref|YP_001408001.1| polysaccharide deacetylase family protein [Campylobacter curvus
           525.92]
 gi|112803301|gb|EAU00645.1| divergent polysaccharide deacetylase family [Campylobacter curvus
           525.92]
          Length = 464

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 51/279 (18%), Positives = 104/279 (37%), Gaps = 9/279 (3%)

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSK-KELLAKNKVGREDTEVPAMDKNFCSNASGA 171
               + P ++     L   +   I    +  E   + K  +     PA        +   
Sbjct: 193 PKASSTPLKTQQGHGLVASKPEKIELKPQKPEPKKQGKQSKRQEFSPAPYVPTKKFSGKP 252

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA-ILQIPMQ 230
           ++ I++    ++       I      +T +              A+  G E  ++ +PMQ
Sbjct: 253 KLVIIIDD--VATYEHASMIRSTGLKLTPSIFPMTKDHPNTPNIAR--GFEFHMIHLPMQ 308

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A    +   +  TL    + + +L R+R           + N+ G+   S+ ++ +  ++
Sbjct: 309 AKHFDH--PEIGTLNTNDSFESILKRIRKIRADFPRAVYMNNHTGSKFTSDYDAMDKAYR 366

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
            F     +F D  +    +   +A K + PY+  D++LDD   R  +R +L    E+A+ 
Sbjct: 367 AFISEKFIFMDSKTIGHTVVAEVARKYSQPYISRDIFLDDDPSRSGVRRQLVNAVELAKK 426

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              AI +      +I++I +       RDV VV L  + 
Sbjct: 427 RSYAIAIGHPKKNTIDIIKESKDTIL-RDVDVVYLKEIL 464


>gi|254457290|ref|ZP_05070718.1| putative periplasmic protein [Campylobacterales bacterium GD 1]
 gi|207086082|gb|EDZ63366.1| putative periplasmic protein [Campylobacterales bacterium GD 1]
          Length = 334

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 45/238 (18%), Positives = 99/238 (41%), Gaps = 7/238 (2%)

Query: 151 GREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
           G       A  ++    +S  ++AI++    +S      AI  L   +T++F        
Sbjct: 103 GTLPEPPEAPKRDVIRTSSKPKLAIIIDD--VSVRSHVNAIKSLGIPLTMSFLPPSKLRP 160

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
              K A K+    ++ +PM+A + S  E    TL+++ +  ++  R++   +       +
Sbjct: 161 NSAKLADKENV-YMVHLPMEAQNFSAEE--PMTLRISDSDFKISQRVKDIKKEFPRVSYI 217

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
            N+ G+   SN+ +   +        + F D  ++       +   L L Y+  D++LD 
Sbjct: 218 NNHTGSKFTSNELAMNRLIYALKSEDINFIDSRTTADTKAPTVMKNLGLNYVARDVFLDH 277

Query: 331 QVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            +D+  I  ++K   ++A+  G AI +      ++  + +  +     DV +V +  L
Sbjct: 278 TMDKVSIIIQIKKAIQVAKLHGTAIAIGHPHANTLLALHESKKLFK--DVELVYIDRL 333


>gi|157163961|ref|YP_001467158.1| ferric-uptake regulator [Campylobacter concisus 13826]
 gi|112801347|gb|EAT98691.1| divergent polysaccharide deacetylase family [Campylobacter concisus
           13826]
          Length = 483

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 54/331 (16%), Positives = 120/331 (36%), Gaps = 13/331 (3%)

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
            S  +        +   IE      K +  T     +N S++ +  I+ ++    ++   
Sbjct: 165 SSEAKSEEKPEQKVEQVIEPF-YAGKNEAKTETKTEQNKSAEANLSIKENLKHSEILKPE 223

Query: 120 TRSTSIDSLPTIEERLI-LGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVS 178
               S        ++ I     +KE + K+              N       A++ +++ 
Sbjct: 224 PTKKSEVEPSNKAKKQIYSEKPQKESVKKDDFAVVP-----FTPNSSVKGRRAKLVLIID 278

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
              ++       +  +   IT +      +       A+      ++ +PMQA     + 
Sbjct: 279 D--VATFEHASMVKSIGLKITPSIFPATKTHPDTPNIARTFEF-YMIHLPMQAKHF--DS 333

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
            +  TL + ++ + +  +++   R         N+ G+   S+ ++ +  ++   ++G +
Sbjct: 334 PEIGTLTINESFESMHEKIKKIRRDFPRAKYTNNHTGSRFTSDYDAMDKAYRALIEQGFI 393

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           F D  +  +      A K N PY+  D++LDD      +R +L     +A+  G AI + 
Sbjct: 394 FVDSKTIAQTAVARAAKKYNQPYISRDIFLDDDPSASAVRRELVAAVNLAKKRGYAIAIG 453

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
                +I VI         +DV VV L  + 
Sbjct: 454 HPKKNTIAVIKASKNNIL-KDVEVVYLKDIL 483


>gi|197103709|ref|YP_002129086.1| hypothetical protein PHZ_c0243 [Phenylobacterium zucineum HLK1]
 gi|196477129|gb|ACG76657.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 379

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 76/342 (22%), Positives = 127/342 (37%), Gaps = 16/342 (4%)

Query: 48  HAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
             F G              A  P      +   Q P     + V    +  +        
Sbjct: 51  GPFEGGAPHARLPLDAAFHAAPPGWREA-LRPAQGPLVVQPDVVRLSERPLAPLAATGWN 109

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
              +            +              L       +           +  +     
Sbjct: 110 APAAPPVRALAGGALPAAPIAGFFAPGPGGPLPIIAQDGRTPAEVYARPFTSNGR----- 164

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQI 227
               +I +VV GLG++   T++AI  L   ITL+F      L  W+  A+  G E +L+ 
Sbjct: 165 ---PKIGLVVGGLGLNARATRQAIETLRPEITLSFVVYAEGLQGWIDMARAHGHEVLLET 221

Query: 228 PMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEV 287
           P++  D   N+   YTL    +  +   +L + L R +GYFG+ NY G+  L++  + E 
Sbjct: 222 PLEPLDYPDNDPGPYTLMTDASPPETAKKLEWILSRASGYFGLTNYLGSRFLADDRAYEA 281

Query: 288 IFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEI 347
           +      RGL F DDG++ R          N+P   A+  +DDQ+    I ++L  LE  
Sbjct: 282 LAASLRARGLAFVDDGTAAR-------RGGNVPRATAERVIDDQLSAGAIDQQLLALEAG 334

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           A   GQA+G   A+  ++E +++W  +   R   + P S L 
Sbjct: 335 ALQRGQALGSGFAYPVTLETVARWANEVEQRGYQLAPASALM 376


>gi|114776726|ref|ZP_01451769.1| hypothetical protein SPV1_10941 [Mariprofundus ferrooxydans PV-1]
 gi|114552812|gb|EAU55243.1| hypothetical protein SPV1_10941 [Mariprofundus ferrooxydans PV-1]
          Length = 311

 Score =  192 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 45/247 (18%), Positives = 95/247 (38%), Gaps = 6/247 (2%)

Query: 148 NKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
             +  E  + P  + +    A+G  IA+++   G      QR +  L   + +A   +  
Sbjct: 55  PPLVDEPVQAPEPEISDAGKAAG--IALILDDAGYDLPELQR-MLKLGVPVAIAVIPDAP 111

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVT-QTVQQLLNRLRYSLRRGTG 266
              +    A + G   +L +PMQ   E Y+   S           QL       L     
Sbjct: 112 YARQAAVMAHQAGHVVMLHLPMQPVSEKYSSRMSDAFLTDQMNEMQLRRTFINDLALVPY 171

Query: 267 YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADL 326
             GV N+ G+ L   ++    + +   ++GL F D  +S +++   +A ++ L       
Sbjct: 172 VEGVNNHMGSALTQLEKPMHWVMQVCLEKGLFFVDSVTSGKSVAGRVATEMGLERGRRQF 231

Query: 327 YLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           +LD+ +D   ++   + +   AR   + + +     +++  +   +  +      +VPL 
Sbjct: 232 FLDNNLDTPALKAMWEKVRICARKGHRCVVIGHPHRQTVTFLENNISADDRA--MMVPLK 289

Query: 387 CLAKLSS 393
            L   +S
Sbjct: 290 RLLHPAS 296


>gi|320535663|ref|ZP_08035755.1| divergent polysaccharide deacetylase [Treponema phagedenis F0421]
 gi|320147491|gb|EFW39015.1| divergent polysaccharide deacetylase [Treponema phagedenis F0421]
          Length = 455

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 49/345 (14%), Positives = 118/345 (34%), Gaps = 13/345 (3%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
             S   P     +   +    P   + +     +   T  +++K      + +I+N    
Sbjct: 106 AESSFAPKVKPEKTPCLEKNKPPAQKTETIAHAQKQKTAQSEVKPAPHAEEKKIKNSEPA 165

Query: 113 KTVVNKPTRSTSIDSLPTIE---------ERLILGLSKKELLAKNKVGREDTEVPAMDKN 163
             V+ + T + +                       L K + +   K           +K 
Sbjct: 166 VKVIKERTAAQNEKKPVQPAQVKKQEQQKPVQEKKLEKPKPVQPAKKEPVAVAARP-EKP 224

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                    +  V    G +     +    LP   T+A            +  +  G+E 
Sbjct: 225 PVPKPHKGTLIFVFDDAGHNL-AQLQYFLRLPFPCTIAVLPRLAHSAEAARRIRAAGKEC 283

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           IL  PMQA +          +K   T  Q+   L  ++       G+ N+ G+++ +++ 
Sbjct: 284 ILHQPMQAIN-PNVNPGQGAIKPGMTAAQIREILNKNIEELWPIAGMNNHEGSLITADEN 342

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           + + +    A++ + F D  ++   +   +A + N+      +++D+  +R  +  ++K 
Sbjct: 343 AMQAVLDTVAEKHIYFLDSRTNVHTVVPRIAKERNMVIWERSVFIDNDKNRKAMENEIKK 402

Query: 344 LEEIARTTGQAIGVAVAFDESI-EVISQWLQQEHVRDVSVVPLSC 387
             +IA   G +I +   F   + E++++          S+  ++ 
Sbjct: 403 GLKIAEQRGCSIMIGHVFTVELAELLTEMYPTLVEEGYSLSTIAQ 447


>gi|152992040|ref|YP_001357761.1| hypothetical protein SUN_0444 [Sulfurovum sp. NBC37-1]
 gi|151423901|dbj|BAF71404.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
          Length = 354

 Score =  191 bits (485), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 43/241 (17%), Positives = 93/241 (38%), Gaps = 6/241 (2%)

Query: 152 REDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
           R    V   +      +   ++ I++    +S  G  + I  L   IT +     +   +
Sbjct: 120 RSKVPVSKENVVLAYRSKKPKLVIIIDD--VSNAGQLKRIKALNMPITPSIFPPSHLSMK 177

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
               AK      ++ +PM++           TLK + T  Q+  R+R   +       + 
Sbjct: 178 SHTLAKSLKH-YMIHLPMES-GSRQFNKQYKTLKTSFTKSQMEARIREIRQLFPTARYIN 235

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
           N+ G++   + ++   ++    K G +F D  +      R +A K    Y+  D+++D+ 
Sbjct: 236 NHTGSVFTDDYKAMHTLYGIMKKEGFIFIDSRTIGTTKVRKIAYKYGDAYVARDIFIDNT 295

Query: 332 VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKL 391
                I  +LK   +IA+  G AI +      +++ ++         DV +V +  + + 
Sbjct: 296 QSIPYIHNQLKKAVKIAKKKGYAIAIGHPHKVTMQALATVGDIFK--DVELVYIDQIFQK 353

Query: 392 S 392
            
Sbjct: 354 Q 354


>gi|149922796|ref|ZP_01911220.1| hypothetical protein PPSIR1_33531 [Plesiocystis pacifica SIR-1]
 gi|149816339|gb|EDM75841.1| hypothetical protein PPSIR1_33531 [Plesiocystis pacifica SIR-1]
          Length = 312

 Score =  190 bits (483), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 45/279 (16%), Positives = 110/279 (39%), Gaps = 14/279 (5%)

Query: 119 PTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVS 178
                   ++   ++ +   +++  +    +  R+        +     A+G  +AIV+ 
Sbjct: 38  TGPPPEPAAVDPKDKEIRARMAQWAVRDAEEWQRD----EGDHRIPWDQANG-HLAIVID 92

Query: 179 GLGISQTGTQRAINLLPANITLAFAS---NGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
            +G  +      +  L   ++ +          +   ++   ++ +E +L +PM+  D  
Sbjct: 93  DVG-RELDAFDKLLALRYPLSFSVLPNSVYTAGVQDRLRADHRRPREILLHLPMEPLDAR 151

Query: 236 YNEDDSYTL----KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
           +  +         +   +   L  ++  +L       GV N+ G+ L ++  +   +   
Sbjct: 152 HMSEGEELGEEFLRAGDSPASLRVKVLAALGNVPHAVGVNNHMGSKLTADNRAMAALMPV 211

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTT 351
             +R L F D  ++P  +  + A +  +P +   ++LD +  +  IR  L    E AR  
Sbjct: 212 LRERELYFLDSRTNPETVAAIEARRAGVPTISRKVFLDHEPGKAAIRRSLFEAAEFARDQ 271

Query: 352 GQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
              + +A    + +EV+ + L Q H + V + P+S L +
Sbjct: 272 PT-VAIAHPSMDVVEVLREELPQLHTQGVGIYPVSQLLR 309


>gi|328948890|ref|YP_004366227.1| hypothetical protein Tresu_2058 [Treponema succinifaciens DSM 2489]
 gi|328449214|gb|AEB14930.1| protein of unknown function DUF610 YibQ [Treponema succinifaciens
           DSM 2489]
          Length = 389

 Score =  190 bits (482), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 55/370 (14%), Positives = 131/370 (35%), Gaps = 14/370 (3%)

Query: 25  SRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPS 84
             L L  L             +  +      +    +V +++           ++K + +
Sbjct: 30  RVLLLSALIIFLCAVFLSMAFVFSSPK-KEKQPKVQNVEQQVLRQEQKNKFAEKNKVAEN 88

Query: 85  KRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKEL 144
           K     V  + K    Q   +IQ +I    V  K       +  P    +  +   + ++
Sbjct: 89  KNQPKNVQPEKKEAV-QKPLEIQPEIKKVPVEKKSE-----EKKPQPVSKQEIKKDEPKI 142

Query: 145 LAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFAS 204
            + N   ++  E+     +     +GA +  ++   G   T   +    LP  I +A   
Sbjct: 143 ASVNPPAKKTEEIKVEKYSIPPAKNGATLVFIIDDGGYD-TYNLKLYTSLPFPIAVAVLP 201

Query: 205 NGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRG 264
                       +  GQE +L  PMQA +       +  +    ++ ++  ++  ++   
Sbjct: 202 KLAHSKDCAAIVRNSGQELMLHQPMQAQNLK-LNPGAGAILPDMSLSEVYKQVSENIAEI 260

Query: 265 TGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVA 324
               G+ N+ G+++  +      +       G+ F D  +S +      A + ++  +  
Sbjct: 261 GPIKGLNNHEGSLITCDVMKIGAVLDAVLDNGIFFVDSRTSAQTKAPQAALERDMKILER 320

Query: 325 DLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL----QQEHVRDV 380
           D+++DD + +D++  ++     IA   G+ I +    D+S +++ Q L         +  
Sbjct: 321 DVFIDDIISKDEMLAQIYRGLGIANKNGKVIMIGHV-DKSAKILPQLLNDMYPYLKQKGY 379

Query: 381 SVVPLSCLAK 390
            +   S + K
Sbjct: 380 KIAFPSQIQK 389


>gi|225619872|ref|YP_002721129.1| putative divergent polysaccharide deacetylase [Brachyspira
           hyodysenteriae WA1]
 gi|225214691|gb|ACN83425.1| putative divergent polysaccharide deacetylase [Brachyspira
           hyodysenteriae WA1]
          Length = 302

 Score =  188 bits (478), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 39/220 (17%), Positives = 86/220 (39%), Gaps = 7/220 (3%)

Query: 173 IAIVVSGLGISQTGTQRAI-NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           I+I++   G +   + R        NIT A   +      +   A       IL IPM+ 
Sbjct: 86  ISIIIDDSGNTLDNSDRYFYLANEYNITFAVLPDSYHSTDFSYAAYSNNVNIILHIPMEG 145

Query: 232 FDESYNEDDSYTL-KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            D         TL +      ++   L YS  +     G+ N+ G++  S++     +  
Sbjct: 146 SDYF----GEQTLIRKGMNEDEIFRLLDYSFSKVPYANGMNNHTGSVASSDESVVSYMLD 201

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
                   F D  +   +L   +A +  +      ++LD++ D   I ++ + L ++++ 
Sbjct: 202 YAKNNDKYFVDSYTVSDSLIYDMAIEYGVKTARRSVFLDNERDHSSIMKQWRELIKLSKE 261

Query: 351 TGQAIGVAVA-FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            G A+G+     +E+++++   L       +  V ++ + 
Sbjct: 262 YGIAVGIGHYQSEETLKILEDNLPLLTDEGIISVSITEIL 301


>gi|165976247|ref|YP_001651840.1| hypothetical protein APJL_0838 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|165876348|gb|ABY69396.1| hypothetical protein APJL_0838 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
          Length = 226

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 37/192 (19%), Positives = 86/192 (44%), Gaps = 5/192 (2%)

Query: 200 LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD-ESYNEDDSYTLKVTQTVQQLLNRLR 258
           +A            ++A ++ ++ ++ +PMQ  +     E     L V  + + +   ++
Sbjct: 1   MAIIPVAPYATARAQKAYEQKRDVLIHLPMQPKNRHQPIESG--ALMVGASKENVARLIQ 58

Query: 259 YSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLN 318
            +  +     G+ N+ G+   +++++ E +  E +K+ L F D  + P ++   +A +L 
Sbjct: 59  AARNQVPYAIGLNNHMGSGATADRQTMEHLMTELSKQQLFFLDSKTGP-SVAAKVARELG 117

Query: 319 LPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVR 378
           +  +  +L+LDD     +++ +       AR  G AI +      SIEV+ + L      
Sbjct: 118 VNALERNLFLDDNDALHEVQNQFHLALHYARKHGSAILIGHPRKNSIEVLEKGLANLPE- 176

Query: 379 DVSVVPLSCLAK 390
           D+ +V +  L +
Sbjct: 177 DIQLVSMGSLWR 188


>gi|312879555|ref|ZP_07739355.1| protein of unknown function DUF610 YibQ [Aminomonas paucivorans DSM
           12260]
 gi|310782846|gb|EFQ23244.1| protein of unknown function DUF610 YibQ [Aminomonas paucivorans DSM
           12260]
          Length = 338

 Score =  187 bits (476), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 50/280 (17%), Positives = 103/280 (36%), Gaps = 6/280 (2%)

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSG 179
           T S + +   ++         +     +            +       +   R+A+VV  
Sbjct: 57  TPSGAREEASSVSATPSPQREEAADSEQEASAPTAPAPSPLFLPTPVPSGVGRVALVVDD 116

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
           +G       R +  L   +T A   +        K A+  G   ++ +PMQA      +D
Sbjct: 117 MGYDL-AVARRLVGLGLPLTWAILPDAPHAAATAKIARDAGIPYLVHLPMQAQG--DGDD 173

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF--AKRGL 297
             Y +    + + +  R   +     G FGV N+RG+   +++ + E        A+ G 
Sbjct: 174 GPYAVASGWSAEVIRERSLRAFEALPGAFGVNNHRGSRATADRVAMERFLSVLQEARPGW 233

Query: 298 LFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGV 357
           +F D  ++  +    +A +  +     D +LD + + + IR   +    +AR  GQAI +
Sbjct: 234 IFLDSRTNGASCGFSVAQEKGIRTSRNDRFLDHRDEDEAIRAAFEAGASLARRKGQAILI 293

Query: 358 AVAFDESIEVISQWLQQEH-VRDVSVVPLSCLAKLSSPSS 396
                 ++  + +  + +     V +  L  L  L S  +
Sbjct: 294 GHPRPRTVHFLERLSRGDAIPPGVELETLPDLMGLVSEEA 333


>gi|296127488|ref|YP_003634740.1| hypothetical protein Bmur_2471 [Brachyspira murdochii DSM 12563]
 gi|296019304|gb|ADG72541.1| protein of unknown function DUF610 YibQ [Brachyspira murdochii DSM
           12563]
          Length = 302

 Score =  187 bits (475), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 42/220 (19%), Positives = 91/220 (41%), Gaps = 7/220 (3%)

Query: 173 IAIVVSGLGISQTGTQRAI-NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
           I+I++   G +   T+R         IT A   +      +   A     + IL +PM+ 
Sbjct: 82  ISIIIDDSGNTLDYTERYFKLAYEYGITFAVLPDSPHSIDFSYAAYSNDVDVILHMPMEG 141

Query: 232 FDESYNEDDSYTL-KVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
            D         T+ +      ++ N L YS  +     G+ N+ G++   +      +  
Sbjct: 142 SDYF----GEKTIIRTGMNKDEVFNLLDYSFSKVPYANGMNNHTGSLACKDINIVSYMID 197

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
                   F D  +S  +L   LA + N+     +++LD+  D D I ++ + L ++++ 
Sbjct: 198 YAKNNNKYFVDSYTSAESLIYDLALENNVRTAKRNVFLDNDRDYDSIMKQWRELIKLSKE 257

Query: 351 TGQAIGVAVA-FDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            G AIG+     +E+++V+   +   +  ++  V ++ + 
Sbjct: 258 YGIAIGIGHYQSEETLKVLENNMPLLYEYNILSVNITEVL 297


>gi|269792105|ref|YP_003317009.1| hypothetical protein Taci_0491 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269099740|gb|ACZ18727.1| protein of unknown function DUF610 YibQ [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 325

 Score =  185 bits (470), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 51/290 (17%), Positives = 104/290 (35%), Gaps = 8/290 (2%)

Query: 97  NDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE 156
              S   G ++  +S      +P                       +        +   +
Sbjct: 26  ASRSPMPGPLEKMVSADLTGEEPPAEAPGTPPEAPPSGEGRVEGTPKGDEPQGHPKAGLK 85

Query: 157 VPAMDKNFCSNASG-ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
            P +++       G   +AIVV  +G   +  +R +  L   +T A         +  + 
Sbjct: 86  RPPVERPALPGGRGRPWLAIVVDDMGYDLSAARR-LAALRIPMTWAIIPGAPRASQVAEI 144

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A+  G   ++ +PMQA  +   +     + V    + +  R+R +     G  GV N+RG
Sbjct: 145 ARAHGIPYLVHLPMQALSDP--DGGESVIHVGMDAKDMRARVRRAFDSLPGAVGVNNHRG 202

Query: 276 AMLLSNKESAEVIFKEFAK--RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
           +   S+ ++     K  A+   G  F D  +SPR++ R  A +  +  +    ++D    
Sbjct: 203 SAATSDSKTMGDFVKVLAELRPGWFFLDSATSPRSVARKEALRRGIRSLRNGYFIDSVPG 262

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
           R+     L    + A  +G A+ +      ++E +S+         V +V
Sbjct: 263 RE--DRALAAAVKGALKSGGAVAIGHPRPGTLEALSRLAAGRAELPVRLV 310


>gi|83858363|ref|ZP_00951885.1| polysaccharide deacetylase family protein [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853186|gb|EAP91038.1| polysaccharide deacetylase family protein [Oceanicaulis alexandrii
           HTCC2633]
          Length = 322

 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 53/288 (18%), Positives = 111/288 (38%), Gaps = 7/288 (2%)

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN-- 167
                 V       S          + +  +++     +  G E   V        +   
Sbjct: 33  SGEPEAVASEIGVASETGSAFWPGVIRVEATQRIEAEVSLRGEEPIPVIESPTPVAAPML 92

Query: 168 -ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AI++  +G+        +  L A +TL+      +     + A   G+E  + 
Sbjct: 93  TPRRPQLAIIMDDVGLD-VAAAEQLLALDAPLTLSILPYAEAAPVIARRAADAGREVFVH 151

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM+       +   Y L   Q+  ++ +R+R++  R  G  G  N+ G+ L S++ + +
Sbjct: 152 LPMEPVGV--EDPGPYALTEFQSADEMSSRIRWAFSRVPGATGFNNHMGSRLTSDRRAMD 209

Query: 287 VIFKEFA-KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE 345
            +F   A    L+F D  + PR+     A    L  +  D++LD   D   +  +L    
Sbjct: 210 ALFTAGAFPSQLIFVDSLTHPRSQAARSARAAGLNALTRDVFLDHAPDEASVSAQLNLAL 269

Query: 346 EIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
            +A   GQAI +     +++ V++   ++     V +V +  L+  +S
Sbjct: 270 ALALQNGQAIAIGHPRPQTLAVLADLTRRAEAVGVELVTVQALSATAS 317


>gi|237750173|ref|ZP_04580653.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
 gi|229374360|gb|EEO24751.1| conserved hypothetical protein [Helicobacter bilis ATCC 43879]
          Length = 396

 Score =  183 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 30/235 (12%), Positives = 96/235 (40%), Gaps = 18/235 (7%)

Query: 160 MDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFAS------NGNSLDRWM 213
             KN        ++ I++  L  +     +    L   +TL+         N   + + +
Sbjct: 154 YTKNPQRFYKKPKVVIIIDDL--ANKKDIKNFQSLHLKLTLSLFPKQFFSKNNPDIAKTL 211

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           +         ++ +P++A +          L++  ++Q + + +    +       + N+
Sbjct: 212 EFY-------MIHLPLEAHNFEQQ--GVINLRIGDSLQTIESHIAQIKKDFPKLAYINNH 262

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+    ++E  + + +  A+  + F D  ++ +++   L  + +  ++  +++LD++ +
Sbjct: 263 TGSRYTESREDMQKLLQVLARHKISFVDSLTTSKSVAGKLLKEQHKIHIARNVFLDNETN 322

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
              I ++L     IA   G  I +      + +V+ ++ ++  + D  ++ ++ L
Sbjct: 323 IASITKQLNTALRIADKQGYVIAIGHPKQATYQVLKEY-KEILLNDYEMLYINEL 376


>gi|312149619|gb|ADQ29690.1| divergent polysaccharide deacetylase superfamily [Borrelia
           burgdorferi N40]
          Length = 293

 Score =  183 bits (464), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 32/218 (14%), Positives = 88/218 (40%), Gaps = 4/218 (1%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
           K      S  +  +++  +G            L   IT A            K  K   +
Sbjct: 64  KEDQKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKRLKNANK 122

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
             I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SN
Sbjct: 123 TVIIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSN 180

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           K+  ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L
Sbjct: 181 KDLMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKEL 240

Query: 342 KGLEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           +  + IAR  G    +   +   +++V+ +     +  
Sbjct: 241 EKAKNIARKNGMVKVIGHIWSKNTLKVLKKEGPNLNQE 278


>gi|83592567|ref|YP_426319.1| hypothetical protein Rru_A1231 [Rhodospirillum rubrum ATCC 11170]
 gi|83575481|gb|ABC22032.1| Protein of unknown function DUF610, YibQ [Rhodospirillum rubrum
           ATCC 11170]
          Length = 582

 Score =  183 bits (464), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 65/310 (20%), Positives = 116/310 (37%), Gaps = 10/310 (3%)

Query: 87  DNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLA 146
              +        +          +       +      + +  T     +      +LL 
Sbjct: 267 QRPSGALLPSEVAVALPRGSSPPLEEGFRPGRTPSYNDLPAPGTFPAPSLGDAPSSDLLR 326

Query: 147 KNKVGREDTEVPAMDKNFCSNASG-------ARIAIVVSGLGISQTGTQRAINLLPANIT 199
            ++ G            + + A          R+AI+VSGLG+ +  TQ AI  LP ++T
Sbjct: 327 SSEHGLLPVIAADGRMPWRTYARPFTGDATRPRVAIIVSGLGMREAATQAAITRLPPDVT 386

Query: 200 LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRY 259
           LAF     +L  WM +A++ G E +L++P++       +     L    +  +  +RL  
Sbjct: 387 LAFDPYAPALPAWMGKARQSGHETLLELPVEPTGYPAIDPGPLALLSGLSEIENRSRLET 446

Query: 260 SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNL 319
            L R  GY GV+            S   +      RGLL+   GS        +      
Sbjct: 447 VLGRSGGYVGVLATAAGRFTDTPASLRGLLDALKSRGLLYVHRGSPT---AVNVNGDAAP 503

Query: 320 PYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRD 379
           P  +    +DD  ++  I  +L+ L ++AR  G AIGV  A   ++  +++WL       
Sbjct: 504 PVNIVTARIDDTPNQRAIDARLEYLGQVARAQGYAIGVVGASPVALYRLNRWLGGLEGEG 563

Query: 380 VSVVPLSCLA 389
           + + P S + 
Sbjct: 564 LVLAPASAVM 573


>gi|312148129|gb|ADQ30788.1| divergent polysaccharide deacetylase superfamily [Borrelia
           burgdorferi JD1]
          Length = 293

 Score =  182 bits (463), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 89/216 (41%), Gaps = 4/216 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                S  +  +++  +G            L   IT A            K+ K   +  
Sbjct: 66  DKKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANKTV 124

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ+  ++  E   + + +    +++  ++  + ++      + N+ G+++ SNK+
Sbjct: 125 IIHFPMQSKHKNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKD 182

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+ 
Sbjct: 183 LMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEK 242

Query: 344 LEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 AKNIARKNGMVKVIGHIWSKNTLKVLKKEGPNLNQE 278


>gi|15595115|ref|NP_212904.1| hypothetical protein BB0770 [Borrelia burgdorferi B31]
 gi|218249494|ref|YP_002375268.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi ZS7]
 gi|226321469|ref|ZP_03796996.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi Bol26]
 gi|2688701|gb|AAC67110.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|218164682|gb|ACK74743.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi ZS7]
 gi|226233265|gb|EEH32017.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi Bol26]
          Length = 293

 Score =  182 bits (463), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 88/216 (40%), Gaps = 4/216 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                S  +  +++  +G            L   IT A            K+ K   +  
Sbjct: 66  DKKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANKTV 124

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+
Sbjct: 125 IIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKD 182

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+ 
Sbjct: 183 LMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEK 242

Query: 344 LEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 AKNIARKNGMVKVIGHIWSKNTLKVLKKEGPDLNQE 278


>gi|224533310|ref|ZP_03673904.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi CA-11.2a]
 gi|224513475|gb|EEF83832.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi CA-11.2a]
          Length = 293

 Score =  182 bits (461), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 88/216 (40%), Gaps = 4/216 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                S  +  +++  +G            L   IT A            K+ K   +  
Sbjct: 66  DKKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANKTV 124

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+
Sbjct: 125 IIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKD 182

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+ 
Sbjct: 183 LMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEK 242

Query: 344 LEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 AKNIARKNGMVKVIGHIWSKNTLKVLKKEGPNLNQE 278


>gi|221217888|ref|ZP_03589355.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 72a]
 gi|224532631|ref|ZP_03673253.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi WI91-23]
 gi|225548835|ref|ZP_03769812.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 94a]
 gi|225549946|ref|ZP_03770907.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 118a]
 gi|221192194|gb|EEE18414.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 72a]
 gi|224512487|gb|EEF82866.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi WI91-23]
 gi|225369405|gb|EEG98857.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 118a]
 gi|225370438|gb|EEG99874.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 94a]
          Length = 293

 Score =  182 bits (461), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 88/216 (40%), Gaps = 4/216 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                S  +  +++  +G            L   IT A            K+ K   +  
Sbjct: 66  DKKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANKTV 124

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+
Sbjct: 125 IIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKD 182

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+ 
Sbjct: 183 LMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEK 242

Query: 344 LEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 AKNIARKNGMVKVIGHIWSKNTLKVLKKEGPNLNQE 278


>gi|216264608|ref|ZP_03436600.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi 156a]
 gi|215981081|gb|EEC21888.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           burgdorferi 156a]
          Length = 293

 Score =  182 bits (461), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 31/216 (14%), Positives = 88/216 (40%), Gaps = 4/216 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                S  +  +++  +G            L   IT A            K+ K   +  
Sbjct: 66  DKKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANKTV 124

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+
Sbjct: 125 IIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKD 182

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+ 
Sbjct: 183 LMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDIFLDSKDTEESVTKELEK 242

Query: 344 LEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 AKNIARKNGMVKVIGHIWSKNTLKVLKKEGPDLNQE 278


>gi|223889391|ref|ZP_03623977.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 64b]
 gi|223885077|gb|EEF56181.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 64b]
          Length = 293

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 30/205 (14%), Positives = 86/205 (41%), Gaps = 4/205 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++  +G            L   IT A            K+ K   +  I+  PMQ+   
Sbjct: 77  LIIDDVGYD-EFMLEQFIKLNLKITYAIIPFLPKSMSLYKKLKNANKTVIIHFPMQSKHR 135

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
           +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+  ++I ++  +
Sbjct: 136 NSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKDLMKIILEKLKE 193

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
               FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + IAR  G  
Sbjct: 194 IDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEKAKNIARKNGMV 253

Query: 355 IGVAVAF-DESIEVISQWLQQEHVR 378
             +   +   +++V+ +     +  
Sbjct: 254 KVIGHIWSKNTLKVLKKEGPDLNQE 278


>gi|226320641|ref|ZP_03796200.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 29805]
 gi|226233964|gb|EEH32686.1| divergent polysaccharide deacetylase family protein [Borrelia
           burgdorferi 29805]
          Length = 293

 Score =  180 bits (456), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 31/218 (14%), Positives = 87/218 (39%), Gaps = 4/218 (1%)

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
           K      S  +  +++  +G            L   I  A            K  K   +
Sbjct: 64  KEDQKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKINYAIIPFLPKSMSLYKRLKNANK 122

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
             I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SN
Sbjct: 123 TVIIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSN 180

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKL 341
           K+  ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L
Sbjct: 181 KDLMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKEL 240

Query: 342 KGLEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           +  + IAR  G    +   +   +++V+ +     +  
Sbjct: 241 EKAKNIARKNGMVKVIGHIWSKNTLKVLKKEGPDLNQE 278


>gi|213582603|ref|ZP_03364429.1| hypothetical protein SentesTyph_15928 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
          Length = 230

 Score =  179 bits (454), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 27/151 (17%), Positives = 60/151 (39%), Gaps = 1/151 (0%)

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
            TL+   +  ++   +R ++       G+ N+ G+ + S+    + + +      L F D
Sbjct: 2   DTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQKVMQALEHYNLYFLD 61

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAF 361
             +   +     A    +  +   ++LDD  +   IR +     E+AR  G AI +    
Sbjct: 62  SMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRTIELARRNGSAIAIGHPH 121

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
             ++ V+ Q + +    D+++V    L    
Sbjct: 122 PATVRVLQQMVYRLPA-DITLVRPGSLLNEP 151


>gi|312128686|ref|YP_003993560.1| hypothetical protein Calhy_2497 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311778705|gb|ADQ08191.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           hydrothermalis 108]
          Length = 283

 Score =  179 bits (454), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 41/240 (17%), Positives = 97/240 (40%), Gaps = 5/240 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P       ++ + + +AI+    G+ +   Q+ +  +     +A        ++    + 
Sbjct: 41  PKPKIKEAASQTLSYVAIIFEDAGMDEEEVQK-LLSINVPFDIAIIPFLPFSNKISLTSH 99

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +KG+E IL + M+  +ES       ++       ++    + +L       G+  + G +
Sbjct: 100 EKGKEVILHLSMEPEEESTIWLCPRSIMNATPDDEIEKIFKDALANVANSKGLSIHLGTL 159

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           +  N+   + +     +  L   D   S  +L   +  ++ L  ++ D+ LD + +   I
Sbjct: 160 VCKNERIVKKLSTIAKENNLFIVDSTFSSESLFAKIGKQMGLQVVIPDIVLDSRNELKPI 219

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++K   L  IA+  G A+ +     +    +IE   Q +Q+    ++  V +S + KL  
Sbjct: 220 QDKFNLLFNIAKKKGFAVAIGHLGTDGGITTIEAFKQAIQKAEKENIKFVFVSEILKLQK 279


>gi|195941590|ref|ZP_03086972.1| hypothetical protein Bbur8_01736 [Borrelia burgdorferi 80a]
          Length = 293

 Score =  179 bits (453), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 30/216 (13%), Positives = 87/216 (40%), Gaps = 4/216 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                S  +  +++  +G            L   I  A            K+ K   +  
Sbjct: 66  DKKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKINYAIIPFLPKSMSLYKKLKNANKTV 124

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           I+  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+
Sbjct: 125 IIHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDAKIMNNHMGSLITSNKD 182

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
             ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+ 
Sbjct: 183 LMKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVTKELEK 242

Query: 344 LEEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 AKNIARKNGMVKVIGHIWSKNTLKVLKKEGPDLNQE 278


>gi|312878089|ref|ZP_07738024.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|311795131|gb|EFR11525.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           lactoaceticus 6A]
          Length = 283

 Score =  178 bits (452), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 37/240 (15%), Positives = 95/240 (39%), Gaps = 5/240 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P       ++   + +AI+    G+ +   Q+ +  +     +A        ++      
Sbjct: 41  PKPKIKEAASQVSSYVAIIFEDAGMDEEEVQK-LLSINVPFDIAIIPFLPFSNKISLMCH 99

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +KG+E +L + M+  + S       ++       ++    + +L       G+  + G +
Sbjct: 100 EKGKEVMLHLSMEPEEGSTVWLCPRSIMNATPDDEIEKIFKDALANVANSKGLSIHLGTL 159

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           +  N+   + +     +  L   D   S  +L   +  ++ L  ++ D+ +D + +   I
Sbjct: 160 VCKNERIVKKLSTIAKENNLFMVDSTFSSESLFAKIGKQMGLQVVIPDIVVDSRNELKPI 219

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++K   L  IA+  G A+ +     +    +IE   Q +Q+    ++  V +S +++L  
Sbjct: 220 QDKFNLLFNIAKKKGFAVAIGHLGLDGGITTIEAFKQAIQKAEKENIKFVFVSEISRLQK 279


>gi|146295404|ref|YP_001179175.1| protein of unknown function DUF610, YibQ [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145408980|gb|ABP65984.1| protein of unknown function DUF610, YibQ [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 282

 Score =  178 bits (451), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 43/243 (17%), Positives = 98/243 (40%), Gaps = 7/243 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAIN-LLPANITLAFASNGNSLDRWMKEA 216
           P       S  S A +A++    G+ +   Q+ +   LP ++  A        ++     
Sbjct: 41  PKPQAVETSAQSQAYVALIFEDAGMDEQEIQKLLEINLPFDV--AIIPFLPFSNKIALMC 98

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGA 276
            K  +E ++ + M+  D++       ++       ++    + ++       G   + G 
Sbjct: 99  SKNNKEVLMHLSMEPEDQNTVWLTPRSIMNNTPDDEVEKVFKDAMLNLPHSKGFSIHLGT 158

Query: 277 MLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK 336
           ++ +N++    +        ++  D  SSPR+L   +  +  +  +  D+ LD + +   
Sbjct: 159 LVCTNEKIVSHLVNLAKANNMIIVDSTSSPRSLFPKIGKQKGIDVIPHDVILDSKNELKP 218

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I++K K L   A+  G A+G+     E    +IE   + L+     ++  V +S +AKL 
Sbjct: 219 IQDKFKLLFNKAKKKGFAVGIGHLGQEGGLTTIEAFKEVLKDAQRENIKFVFVSDIAKLI 278

Query: 393 SPS 395
             +
Sbjct: 279 KQT 281


>gi|312794212|ref|YP_004027135.1| hypothetical protein Calkr_2051 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312181352|gb|ADQ41522.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           kristjanssonii 177R1B]
          Length = 283

 Score =  177 bits (450), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 38/240 (15%), Positives = 95/240 (39%), Gaps = 5/240 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P       ++   + +AI+    G+ +   Q+ +  +     +A        ++      
Sbjct: 41  PKPKTKEAASQVSSYVAIIFEDAGMDEEEVQK-LLSINVPFDIAIIPFLPFSNKISLMCH 99

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +KG+E +L + M+  + S       ++       ++    + +L       G+  + G +
Sbjct: 100 EKGKEVMLHLSMEPEEGSTVWLCPRSIMNATPDDEIEKIFKDALANVANSKGLSIHLGTL 159

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           +  N+   + +     +  L   D   S  +L   +  ++ L  ++ D+ +D + +   I
Sbjct: 160 VCKNERIVKKLSTIAKENNLFIVDSTFSSESLFAKIGKQMGLQVVIPDIVVDSRNELKPI 219

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++K   L  IA+  G A+ +     +    +IE   Q +Q+    ++  V +S ++KL  
Sbjct: 220 QDKFNLLFNIAKKKGFAVAIGHLGLDGGITTIEAFKQAIQKAEKENIKFVFVSEISKLQK 279


>gi|312623465|ref|YP_004025078.1| hypothetical protein Calkro_2448 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203932|gb|ADQ47259.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 283

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 39/240 (16%), Positives = 96/240 (40%), Gaps = 5/240 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P       ++ + + +AI+    G+ +   Q+ +  +     +A        ++    + 
Sbjct: 41  PKPKIKEAASQTLSYVAIIFEDAGMDEEEVQK-LLSINVPFDIAIIPFLPFSNKISLASY 99

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +KG+E IL + M+  D+        ++  +    ++    + +L       G+  + G +
Sbjct: 100 EKGKEVILHLSMEPEDQDTIWLCPRSIMNSTPDDEIEKIFKDALANVAYSKGLSIHLGTL 159

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           +  N+   + +     +  L   D   S  +L   +  ++ L  ++ D+ LD + +   I
Sbjct: 160 VCKNERIVKKLSAIAKENNLFIVDSTFSSESLFAKIGKQMGLQVVIPDIVLDSRNELKPI 219

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++K   L  IA+  G A+ +     +    +IE   Q +Q+    ++  V +S + K   
Sbjct: 220 QDKFNLLFNIAKKKGFAVAIGHLGTDGGITTIEAFKQTIQKAEKENIKFVFVSEILKFQK 279


>gi|153952202|ref|YP_001398408.1| putative periplasmic protein [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152939648|gb|ABS44389.1| putative periplasmic protein [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 207

 Score =  177 bits (449), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 32/165 (19%), Positives = 82/165 (49%), Gaps = 4/165 (2%)

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           ++ +P+ A D   N+ +  TL    + +++  +++   +       + N+ G++  SN+E
Sbjct: 44  LVHLPLAAIDY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEE 101

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKG 343
           +   +++    + + F D  +   +    +A +LN+PY+  D++LD++ D + ++++L+ 
Sbjct: 102 AMRKLYEALKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLDNEDDVNYVKKQLEN 161

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
             ++A+  G AI +      + + + Q         V +V LS +
Sbjct: 162 AVKLAQKKGFAIAIGYPRKNTFKALEQSKDLLK--GVELVYLSEI 204


>gi|260655308|ref|ZP_05860796.1| divergent polysaccharide deacetylase family protein [Jonquetella
           anthropi E3_33 E1]
 gi|260629756|gb|EEX47950.1| divergent polysaccharide deacetylase family protein [Jonquetella
           anthropi E3_33 E1]
          Length = 308

 Score =  176 bits (445), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 56/280 (20%), Positives = 103/280 (36%), Gaps = 7/280 (2%)

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARI 173
            +     +   +  L              + L            P   +     +  A +
Sbjct: 24  ALARPAPQKQPLPLLVISGGAEAPSGEAPQNLGTLPSPEPTIVEPEAGREPGERSGKALM 83

Query: 174 AIVVSGLGISQTGTQRAINLLPAN---ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
           A+V+   G S T  Q+ I  L       T A   + ++       A K GQ  I+ +PMQ
Sbjct: 84  ALVIDDFGTSLTIAQQ-IASLGGPSRSFTWAIMPDCSASLSCAHLADKIGQPYIVHLPMQ 142

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           A  +     D Y +    + +Q+  ++           GV N+RG+   S++ + E    
Sbjct: 143 AIIDPAGHRD-YLIGTDSSPEQVRRQVERMRSLFPRALGVNNHRGSKATSSQNTMEAFGA 201

Query: 291 EFA-KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIAR 349
             A + G  F D  +S +++ R    K  +P +    ++D   D D ++ +      IAR
Sbjct: 202 AMADQTGWGFLDSRTSGKSVARSTVAKYGVPALANMAFIDGVSDLDYMKGQFAKALRIAR 261

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           + G  I +  A   ++  + +W+  +    V  VPL  L 
Sbjct: 262 SRGVGIAICHARTGTLPFL-RWVCSQQFGGVQFVPLHQLW 300


>gi|32266725|ref|NP_860757.1| hypothetical protein HH1226 [Helicobacter hepaticus ATCC 51449]
 gi|32262776|gb|AAP77823.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 289

 Score =  175 bits (444), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 39/224 (17%), Positives = 89/224 (39%), Gaps = 8/224 (3%)

Query: 168 ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFAS---NGNSLDRWMKEAKKKGQEAI 224
           A+  ++ +++  L  S     + +  L  NIT +      +  S     +   K G+  +
Sbjct: 53  AAKPKVLLIMDDL--STLAQIKHLEYLKLNITPSIFPKTKHNPSTPHLAELVLKNGKSFM 110

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           + +P++A      E +   +KV  + + +   +            + N+ G+    +K  
Sbjct: 111 IHLPLEAQHFIQKELEP--IKVGASRESIKQDILAIKNDFPQLVYLNNHTGSKFTQSKAD 168

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
              +   F + GL F D  ++    +  +A +     M  D++LD+Q D    + +LK L
Sbjct: 169 MTNLLSVFDELGLKFIDSVTTSYPASESIAREQKRLIMARDIFLDNQSDVAYTKAQLKSL 228

Query: 345 EEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCL 388
            + A+  G AI +      +   ++Q   + +   + ++    L
Sbjct: 229 IKKAQKKGYAIAICHPHSTTFRALAQMRDEINST-LELISPQEL 271


>gi|225551830|ref|ZP_03772773.1| divergent polysaccharide deacetylase family protein [Borrelia sp.
           SV1]
 gi|225371625|gb|EEH01052.1| divergent polysaccharide deacetylase family protein [Borrelia sp.
           SV1]
          Length = 293

 Score =  175 bits (443), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 30/215 (13%), Positives = 86/215 (40%), Gaps = 4/215 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
               S  +  +++  +G            L   I  A            K+ K   +  I
Sbjct: 67  KKAKSKPKFYLIIDDVGYD-EFMLEQFIKLNLKINYAIIPFLPKSMSLYKKLKNANKTVI 125

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +  PMQ+   +  E   + + +    +++  ++  + ++      + N+ G+++ SNK+ 
Sbjct: 126 IHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKAFKKYPDSKIMNNHMGSLITSNKDF 183

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            ++I ++  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  
Sbjct: 184 MKIILEKLKEIDRYFFDSVTIAGSVPEIIGKEIGVKVEKRDVFLDSKDTEESVIKELEKA 243

Query: 345 EEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           + IAR  G    +   +   +++V+ +        
Sbjct: 244 KNIARKNGMVKVIGHIWSKNTLKVLKKEGPDLTQE 278


>gi|219684182|ref|ZP_03539126.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii PBr]
 gi|219672171|gb|EED29224.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii PBr]
          Length = 292

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 85/215 (39%), Gaps = 4/215 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                  +  +++  +G            L   I  A            K+ K   +  I
Sbjct: 66  KKFRIKPKFYLIIDDVGYD-EFMLEQFIKLNFEINYAIIPFLPKSMNLYKKLKNNNKTII 124

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +  PMQ+   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+ 
Sbjct: 125 IHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDL 182

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            ++I  +  +    FFD  +   ++  ++  ++ +     D++LD++   + + ++L+  
Sbjct: 183 MKIILIKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDNKDTEESVLKELEKA 242

Query: 345 EEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 KNIARKHGIVKVIGHIWSKSTLKVLEKEGPNLNQE 277


>gi|51599020|ref|YP_073208.1| hypothetical protein BG0793 [Borrelia garinii PBi]
 gi|51573591|gb|AAU07616.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 288

 Score =  174 bits (442), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 86/215 (40%), Gaps = 4/215 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
             +    +  +++  +G            L   I  A            K+ K   +  I
Sbjct: 62  KKSRIKPKFYLIIDDVGYD-EFMLEQFIKLNFEINYAIIPFLPKSMNLYKKLKNNNKTII 120

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +  PMQ+   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+ 
Sbjct: 121 IHFPMQSKHRNSIE--KFHINIKDKKEEIYKKIEKTFKMYPDAKIMNNHMGSLITSNKDL 178

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            ++I  +  +    FFD  +   ++  ++  ++ +     D++LD++   + + ++L+  
Sbjct: 179 MKIILIKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDNKDTEESVLKELEKA 238

Query: 345 EEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           + IAR  G    +   +   +++V+ +     +  
Sbjct: 239 KNIARKHGIVKVIGHIWSKSTLKVLEKEGPNLNQE 273


>gi|219685601|ref|ZP_03540417.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii Far04]
 gi|219672879|gb|EED29902.1| divergent polysaccharide deacetylase family protein [Borrelia
           garinii Far04]
          Length = 292

 Score =  174 bits (441), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 86/215 (40%), Gaps = 4/215 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
             +    +  +++  +G            L   I  A            K+ K   +  I
Sbjct: 66  KKSRIKPKFYLIIDDVGYD-EFMLEQFIKLNFEINYAIIPFLPKSMNLYKKLKNNNKTII 124

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +  PMQ+   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+ 
Sbjct: 125 IHFPMQSKHRNSIE--KFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDL 182

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            ++I  +  +    FFD  +   ++  ++  ++ +     D++LD++   + + ++L+  
Sbjct: 183 MKIILIKLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDNKDTEESVLKELEKA 242

Query: 345 EEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           + IAR  G    +   +   +++V+ +     +  
Sbjct: 243 KNIARKHGIVKVIGHIWSKSTLKVLKKEEPNLNQE 277


>gi|224534597|ref|ZP_03675173.1| divergent polysaccharide deacetylase family protein [Borrelia
           spielmanii A14S]
 gi|224514274|gb|EEF84592.1| divergent polysaccharide deacetylase family protein [Borrelia
           spielmanii A14S]
          Length = 288

 Score =  172 bits (437), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 83/209 (39%), Gaps = 4/209 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +  +++  +G            L   I  A            K+ K   +  I+  PMQ
Sbjct: 68  PKFYLIIDDVGYD-EFMLEQFIKLNLEINYAIIPFLPKSTSLYKKLKNNNKAVIIHFPMQ 126

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           +   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+   +I  
Sbjct: 127 SKHRNAIE--KFHINIKDKKEEIHKKIEKTFKMYPDVKIMNNHMGSLITSNKDLMRIILI 184

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           +  +    FFD  +   ++  ++  ++ +     D++LD +  ++ +  +L+  + IAR 
Sbjct: 185 KLKEIDRYFFDSVTIAGSVPEIIGKEIGVRVEKRDVFLDSKDTKEAVLNELEKAKNIARK 244

Query: 351 TGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            G    +   +   +++V+ +     +  
Sbjct: 245 HGIVKVIGHIWSKNTLKVLEKEGPSLNQE 273


>gi|111115601|ref|YP_710219.1| hypothetical protein BAPKO_0818 [Borrelia afzelii PKo]
 gi|110890875|gb|ABH02043.1| hypothetical protein BAPKO_0818 [Borrelia afzelii PKo]
          Length = 293

 Score =  172 bits (436), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 84/209 (40%), Gaps = 4/209 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +  +++  +G            L   I  A            K+ K   +  I+  PMQ
Sbjct: 73  PKFYLIIDDVGYD-EFMLEQFIKLNLEINYAIIPFLPKSTSLYKKLKNNNKTVIIHFPMQ 131

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           +   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+  ++I  
Sbjct: 132 SKHRNAIE--KFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDLMKIILI 189

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           +  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + IAR 
Sbjct: 190 KLKEIDRYFFDSVTIAGSIPEIIGKEIGVRVEKRDVFLDSKDTEEAVLKELEKAKNIARK 249

Query: 351 TGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            G    +   +   +++V+ +     +  
Sbjct: 250 HGIVKVIGHIWSKNTLKVLEKEEPNLNQE 278


>gi|302872758|ref|YP_003841394.1| hypothetical protein COB47_2162 [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302575617|gb|ADL43408.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           obsidiansis OB47]
          Length = 283

 Score =  172 bits (436), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 36/227 (15%), Positives = 95/227 (41%), Gaps = 5/227 (2%)

Query: 173 IAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF 232
           +AI+    G+ +   Q+ +  +     +A        ++     ++KG+E +L + M+  
Sbjct: 56  VAIIFEDAGMDEEEVQK-LLSINVPFDIAIIPFLPFSNKISLMCQEKGKEVLLHLSMEPE 114

Query: 233 DESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
           + S       ++       ++    + +L       GV  + G ++  N+   + +    
Sbjct: 115 EGSTIWLCPRSIMNATPDDEIEKIFKDALANVANSKGVSTHLGTLVCKNERIVKKLCTLA 174

Query: 293 AKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTG 352
            ++ ++  D   S  +L   +  ++ L  ++ D+ LD + +   I++K   L  +A+  G
Sbjct: 175 KEKDMVLVDSTFSSESLFSKMGKQIGLQVIIPDIILDSRNELKPIQDKFNILFNLAKKKG 234

Query: 353 QAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
            ++ +     +    +IE   Q +++    ++  V +S ++KL   S
Sbjct: 235 FSVAIGHLGVDGGITTIEAFKQAVEKAKKENIKFVFVSEISKLEKKS 281


>gi|317485790|ref|ZP_07944655.1| divergent polysaccharide deacetylase [Bilophila wadsworthia 3_1_6]
 gi|316922964|gb|EFV44185.1| divergent polysaccharide deacetylase [Bilophila wadsworthia 3_1_6]
          Length = 516

 Score =  171 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 53/307 (17%), Positives = 104/307 (33%), Gaps = 11/307 (3%)

Query: 88  NNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILG---LSKKEL 144
              V +  +      +G   +  +G            +++L    +              
Sbjct: 183 PPVVQDPAQQAPRNENGNAPSAETGDVKGPPEPVFRFLNALAESLDTWADRAVLTESPGK 242

Query: 145 LAKNKVGREDTEV-----PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANIT 199
           L     G    E+                   R+ IV++ LG  +  T  ++  L   IT
Sbjct: 243 LTLATKGVLTHEIWFEATTDAFPILPPTDKAPRLTIVMNELGGDKAVT-ASLLALKLPIT 301

Query: 200 LAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRY 259
            +              A + GQE ++ +PM+     + +     +    + + +   +  
Sbjct: 302 FSVLPFAKDAAATATAAHEAGQEVLVDMPMETMQSPFVKAGPGEITTKMSEEDMRILMDD 361

Query: 260 SLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNL 319
           +L       G  N+ G+ L ++  +     +  A+ GL   DD +   ++    A +  L
Sbjct: 362 ALGHVPYATGASNFMGSRLTTDTAATRRFCEILARSGLYVLDDVTHQESILYAEARRRGL 421

Query: 320 PYMVADLYL-DDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVR 378
           P     L L D       +   LK  EE AR  G A+ +A      +  + +W Q+   +
Sbjct: 422 PAWRRALTLNDGPKTEGAVLADLKKAEETARAKGHAVVIATPAPHVLAALKRWSQE-RDK 480

Query: 379 DVSVVPL 385
           D+ +VPL
Sbjct: 481 DIRLVPL 487


>gi|222530356|ref|YP_002574238.1| hypothetical protein Athe_2397 [Caldicellulosiruptor bescii DSM
           6725]
 gi|222457203|gb|ACM61465.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           bescii DSM 6725]
          Length = 283

 Score =  170 bits (430), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 37/241 (15%), Positives = 98/241 (40%), Gaps = 5/241 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P       ++ + + +AI+    G+ +   Q+ +  +     +A        ++     +
Sbjct: 41  PKPKIKEAASQASSYVAIIFEDAGMDEEEVQK-LLSINVPFDIAIIPFLPFSNKISLMCQ 99

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +KG+E +L + M+  + S       ++       ++    + +L       GV  + G +
Sbjct: 100 EKGKEVLLHLSMEPEEGSTIWLCPRSIMNATPDDEVEKIFKDALANVANSKGVSTHLGTL 159

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           +  N+   + +     ++ +   D   S  +L   +  ++ L  ++ D+ LD + +   I
Sbjct: 160 VCKNERIVKKLCLLAKEKDMTVIDSTFSSESLFAKIGKQMGLQVIIPDIVLDSRNELKPI 219

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++K   L  +A+  G A+ +     +    +IE   Q +++    ++  V +S ++KL  
Sbjct: 220 QDKFNLLFNMAKKKGFAVAIGHLGLDGGITTIEAFKQTVEKAKKENIKFVFVSEISKLEK 279

Query: 394 P 394
            
Sbjct: 280 K 280


>gi|216263687|ref|ZP_03435682.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           afzelii ACA-1]
 gi|215980531|gb|EEC21352.1| divergent polysaccharide deacetylase superfamily protein [Borrelia
           afzelii ACA-1]
          Length = 293

 Score =  170 bits (430), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/209 (13%), Positives = 84/209 (40%), Gaps = 4/209 (1%)

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
            +  +++  +G            L   I  A            K+ K   +  I+  PMQ
Sbjct: 73  PKFYLIIDDVGYD-EFMLEQFIKLNLEINYAIIPFLPKSTSLYKKLKNNNKTVIIHFPMQ 131

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
           +   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+  ++I  
Sbjct: 132 SKHRNAIE--KFHINIKDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDLMKIILI 189

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIART 350
           +  +    FFD  +   ++  ++  ++ +     D++LD +   + + ++L+  + IAR 
Sbjct: 190 KLKEIDRYFFDSVTIAGSIPEIIGKEIGVRVEKRDVFLDSKDTEEAVLKELEKAKNIARK 249

Query: 351 TGQAIGVAVAF-DESIEVISQWLQQEHVR 378
            G    +   +   +++V+ +     +  
Sbjct: 250 HGIVKVIGHIWSKNTLKVLEKEEHNLNQE 278


>gi|203288196|ref|YP_002223211.1| hypothetical protein BRE_777 [Borrelia recurrentis A1]
 gi|201085416|gb|ACH94990.1| uncharacterized conserved protein [Borrelia recurrentis A1]
          Length = 307

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 86/205 (41%), Gaps = 4/205 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++  +G  +      I  +  NI  +          +  + + K +  ++  PMQ+  +
Sbjct: 81  LIIDDVGYDEFMLDEFI-KINLNINFSIIPFLPKSMEFYNKLQNKNKIIMIHFPMQSKHK 139

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
           +  E   + + +      +  ++  +         + N+ G+++ SN+   +++  +  +
Sbjct: 140 NSIE--KFHININDDEITIRTKIETTFNTYPNAKIMNNHMGSLITSNENIMKIMLIKLKE 197

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           +   FFD  ++  +++      + +     D++LD++ +   + + L+  ++IART G  
Sbjct: 198 KNKYFFDSLTTKDSISIQTGKSIGILVEQRDIFLDNRDNEKSVIKALERAKQIARTKGIV 257

Query: 355 IGVAVAF-DESIEVISQWLQQEHVR 378
             +   +   +++++ Q  +     
Sbjct: 258 KVIGHIWSKNTLKILQQESENLKKE 282


>gi|203284663|ref|YP_002222403.1| hypothetical protein BDU_774 [Borrelia duttonii Ly]
 gi|201084106|gb|ACH93697.1| uncharacterized conserved protein [Borrelia duttonii Ly]
          Length = 307

 Score =  169 bits (428), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 26/205 (12%), Positives = 86/205 (41%), Gaps = 4/205 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++  +G  +      I  +  NI  +          +  + + K +  ++  PMQ+  +
Sbjct: 81  LIIDDVGYDEFMLDEFI-KINLNINFSIIPFLPKSMEFYNKLQNKNKIIMIHFPMQSKHK 139

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
           +  E   + + +      +  ++  +         + N+ G+++ SN+   +++  +  +
Sbjct: 140 NSIE--KFHININDDEITIRTKIETTFNTYPNAKIMNNHMGSLITSNENIMKIMLIKLKE 197

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
           +   FFD  ++  +++      + +     D++LD++ +   + + L+  ++IART G  
Sbjct: 198 KNKYFFDSLTTKDSISIQTGKSIGILVEQRDIFLDNRDNEKSVIKALERAKQIARTKGIV 257

Query: 355 IGVAVAF-DESIEVISQWLQQEHVR 378
             +   +   +++++ Q  +     
Sbjct: 258 KVIGHIWSKNTLKILQQESENLKKE 282


>gi|213852179|ref|ZP_03381711.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 165

 Score =  169 bits (427), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 28/148 (18%), Positives = 58/148 (39%), Gaps = 3/148 (2%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 79  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 136

Query: 287 VIFKEFAKRGLLFFDDGSSPRNLTRVLA 314
            + +      L F D  +   +     A
Sbjct: 137 KVMQALEHYNLYFLDSMTIGNSQAMRAA 164


>gi|224531917|ref|ZP_03672549.1| divergent polysaccharide deacetylase family protein [Borrelia
           valaisiana VS116]
 gi|224511382|gb|EEF81788.1| divergent polysaccharide deacetylase family protein [Borrelia
           valaisiana VS116]
          Length = 295

 Score =  168 bits (425), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 29/215 (13%), Positives = 82/215 (38%), Gaps = 4/215 (1%)

Query: 165 CSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                  +  +++  +G            L   I  A            K+ K   +  I
Sbjct: 69  KKPEIKPKFYLIIDDVGYD-EFMLEQFIKLNLEINYAIIPFLPKSTILYKKLKNNNKTII 127

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
           +  PMQ+   +  E   + + +    +++  ++  + +       + N+ G+++ SNK+ 
Sbjct: 128 IHFPMQSKHRNSIE--KFHINIEDKKEEIHKKIEKTFKMYPDAKIMNNHMGSLITSNKDL 185

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGL 344
            ++I  +  +    FFD  +   ++   +  ++ +     D++LD +     + ++L+  
Sbjct: 186 MKIILIKLKEIERYFFDSVTIAGSVPETVGKEIGVKVEKRDVFLDSKDTEKSVLKELEKA 245

Query: 345 EEIARTTGQAIGVAVAF-DESIEVISQWLQQEHVR 378
           + IAR  G    +   +   +++V+ +     +  
Sbjct: 246 KNIARKHGIVKVIGHIWSKNTLKVLEKEESNLNQE 280


>gi|312136102|ref|YP_004003440.1| hypothetical protein Calow_2131 [Caldicellulosiruptor owensensis
           OL]
 gi|311776153|gb|ADQ05640.1| protein of unknown function DUF610 YibQ [Caldicellulosiruptor
           owensensis OL]
          Length = 283

 Score =  167 bits (423), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 39/242 (16%), Positives = 98/242 (40%), Gaps = 5/242 (2%)

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           P       +  + + +AI+    G+ +   Q+ +  +     +A        ++     +
Sbjct: 41  PKPKIKEAAIQASSYVAIIFEDAGMDEEEVQK-LLNINVPFDIAIIPFLPFSNKISLMCQ 99

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           +K +E +L + M+  D S       ++       ++      +L   T   GV  + G +
Sbjct: 100 EKEKEVLLHLSMEPEDSSTIWLCPRSIMNVTPDDEVEKIFNDALVNVTNSKGVSIHLGTL 159

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           +  N+   + +     ++ ++  D   S  +L   +  ++ L  ++ D+ LD + +   I
Sbjct: 160 VCKNERIVKKLCTLAKEKDMVLIDSTFSAESLFSKMGKQIGLQVIIPDIILDSKNELKPI 219

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDE----SIEVISQWLQQEHVRDVSVVPLSCLAKLSS 393
           ++K   L  +A+  G A+ +     +    +IE   Q +++    ++  V +S ++KL  
Sbjct: 220 QDKFNILFNLAKKKGFAVAIGHLGVDGGITTIEAFKQAVEKAKKENIKFVFVSEISKLEK 279

Query: 394 PS 395
            S
Sbjct: 280 KS 281


>gi|303328258|ref|ZP_07358696.1| polysaccharide deacetylase family protein [Desulfovibrio sp.
           3_1_syn3]
 gi|302861588|gb|EFL84524.1| polysaccharide deacetylase family protein [Desulfovibrio sp.
           3_1_syn3]
          Length = 440

 Score =  167 bits (422), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 54/379 (14%), Positives = 111/379 (29%), Gaps = 36/379 (9%)

Query: 14  PKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTI 73
           P+ ++    +     L +      + L+ +       +           +          
Sbjct: 78  PEARAERMILARLDALVIQTLPLALPLARWQREEGLPLEDEGSAARAYRVTGPCAPLRLG 137

Query: 74  PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEE 133
              +E  +S +  D   +                       +  +PT             
Sbjct: 138 VALLEKLRSAADPDFPHLSAVDPERFRPRLAWTDQGALEIRLNGRPTHRFHFPGKERALA 197

Query: 134 RLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINL 193
            L   L +  L+                             +V+  LG S    +  +  
Sbjct: 198 DLARPLPQAALI-----------------------------LVIDDLGQSLEPAED-LAA 227

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAF---DESYNEDDSYTLKVTQTV 250
           LP  + LA   +          A + G + ++ +PM+     D    +     L    + 
Sbjct: 228 LPFPVVLAVWPHAPRAGATADLAGQMGLDCLVHLPMEPQPRADGFRPKPGPGALFADMSR 287

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
             L + L   L       G+ N+ G+    +  +  ++  + A RG    D  + P +  
Sbjct: 288 HALASVLEPDLAALPTALGLNNHMGSRFTGSSAACRLLCAQLAGRGFFVLDSLTQPHSRL 347

Query: 311 RVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQ 370
              A    L  +   ++LD + D   +   L      AR+ G A+ +   + E++  + +
Sbjct: 348 AEEARAAGLVSVARAVFLDTRRDVSAVLAALDAAAAKARSAGFAVAIGHPYAETLSALRR 407

Query: 371 WLQQEHVRDVSVVPLSCLA 389
           W        V+VVPL  L 
Sbjct: 408 WQ---DKAGVAVVPLRRLV 423


>gi|23015121|ref|ZP_00054907.1| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 474

 Score =  167 bits (422), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 70/394 (17%), Positives = 144/394 (36%), Gaps = 28/394 (7%)

Query: 17  KSFYSQIISRLGLF---LLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTI 73
           +    +  +  GL    +     + G    +        +   + P              
Sbjct: 85  RGEPPKPGTGSGLLTPPVAPGAAVPGNGEILKALPDDTPSPDSLPPALAPANAPANASLP 144

Query: 74  PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPT--- 130
           P   +     +         + ++  S+            + +       + D  P+   
Sbjct: 145 PAEAKPDTKTAALPPGDYVAEPESPVSKAFAPKPPPAVDSSGMPTQPNPRAADKPPSYEG 204

Query: 131 -----IEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG-------ARIAIVVS 178
                 E + +     KE+  +  +G      P   + +   A          ++A+VV 
Sbjct: 205 LPERKGEVKALPPAPNKEMQKRTAIGDLPVPSPDGKQPWQVYARPWSGPADRGKVAVVVM 264

Query: 179 GLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNE 238
            +G+ +  T+ AI  LP  +TLAF+     LD+W+K+A+  G E ++ +P  +      +
Sbjct: 265 DMGLDKVATEAAIAKLPPEVTLAFSPYAQGLDKWVKKARDYGHEVMMVLPADSNGTQPRD 324

Query: 239 DDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLL 298
                +  +   +  L RL   + RG  Y G+++  G    ++++    +  +   RGLL
Sbjct: 325 PGPLGMTNSVPPESNLARLEGVMSRGAAYTGLIS-LGDKFAASEQVV-QMLGQLRDRGLL 382

Query: 299 FFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVA 358
           +   G++P + T  LAP   +         D  + R+ I  +L  +   ART G+A+ V 
Sbjct: 383 YVGPGAAPADRTPALAPVTAVA--------DADLFREAIEMRLNQVSIAARTKGKALVVI 434

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
                S + +  WL     + + +VP+S L +  
Sbjct: 435 NPRPLSFDRLLPWLNDFDGQKLVIVPVSTLVQPP 468


>gi|258542077|ref|YP_003187510.1| hypothetical protein APA01_09810 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633155|dbj|BAH99130.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636212|dbj|BAI02181.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639267|dbj|BAI05229.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642321|dbj|BAI08276.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645376|dbj|BAI11324.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648431|dbj|BAI14372.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651484|dbj|BAI17418.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654475|dbj|BAI20402.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 363

 Score =  166 bits (421), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 59/317 (18%), Positives = 122/317 (38%), Gaps = 17/317 (5%)

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLIL 137
                        +     +   Q      +  + ++   + T      +     +    
Sbjct: 25  ATAAVALAIGLQVMGPPGLSIEGQDIDVSADSAAKQSSPAQRTTIPGPQADLLESKNGPG 84

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPAN 197
           G    ++ A ++  ++    P +D           +A+++ G+  +   T  AIN LP  
Sbjct: 85  GFPLPKVGAHDRTPKKVYAAPVVDVPP----GTPMVALLIDGIDQTDDLTTEAINSLPGP 140

Query: 198 ITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRL 257
           ++L  +    + +  M  A++   E +L +P+Q       +     L +  + QQ ++ L
Sbjct: 141 VSLGISPYAANPEELMNAARQHRHETLLSLPIQDNATKNTDAGPKALGLLLSPQQNMDNL 200

Query: 258 RYSLRRGTGYFGVMNYR----GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVL 313
            ++L    GY GV N      G       ES + + K   +RGLL+ D  ++P   T   
Sbjct: 201 NWALSHLAGYVGVTNAFAGQNGGSF-PQSESFKSLVKAIDQRGLLYLD--ATPGTQTEGA 257

Query: 314 APKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGV-AVAFDESIEVISQWL 372
           +         AD+ ++   D   I  +L  L+++AR  G+AIG+       ++  +  WL
Sbjct: 258 SS-----TATADVVVNTDTDIVNIDIQLLKLQQLARQNGRAIGILGPLRPVAMACLRAWL 312

Query: 373 QQEHVRDVSVVPLSCLA 389
                  +++VP+S + 
Sbjct: 313 PHLKDMGIALVPVSQIV 329


>gi|119953544|ref|YP_945754.1| cation transport ATPases [Borrelia turicatae 91E135]
 gi|119862315|gb|AAX18083.1| cation transport ATPases [Borrelia turicatae 91E135]
          Length = 303

 Score =  166 bits (419), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 90/205 (43%), Gaps = 4/205 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++  +G  +      I  +  NI  +          +  +   K +  ++ +PMQ+  +
Sbjct: 76  LIIDDVGYDEFMLDEFI-KIDLNINFSIIPFLPKSMDFYNKLASKNKIIMIHLPMQSKYK 134

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
           +  E   + + +      +  ++  + +  +    + N+ G+++ +N+   ++I  +  +
Sbjct: 135 NSIE--KFHININDNEFAIRTKIEKTFQTYSNAKIMNNHMGSLITANENIMQIILIKLKE 192

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
               FFD  ++ ++++  +  K+ +     D++LD++ +   + + L+  ++IART G  
Sbjct: 193 ENRYFFDSLTTQKSISAKIGKKIGIIVEQRDIFLDNKDNEKAVIKALERAKQIARTKGIV 252

Query: 355 IGVAVAF-DESIEVISQWLQQEHVR 378
             +   +   +++++ Q     +  
Sbjct: 253 KVIGHIWSKNTLKILKQEAVNLNKE 277


>gi|330980647|gb|EGH78750.1| hypothetical protein PSYAP_19071 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 155

 Score =  166 bits (419), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 29/140 (20%), Positives = 65/140 (46%)

Query: 253 LLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRV 312
           + +RL  +L +     G+ N+ G+ + +   +   +  E  +R LLF    +S + +   
Sbjct: 1   MESRLNAALLKVPYAAGINNHMGSRMTAEPVAMTWLMAELQRRHLLFVASRTSAKTVAAA 60

Query: 313 LAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWL 372
            A ++ L  +  D++LDD+   + I  +L+   +IAR  G A+ +   +  +++V+ + L
Sbjct: 61  EAQRIGLASVSRDVFLDDERTAEAITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLEREL 120

Query: 373 QQEHVRDVSVVPLSCLAKLS 392
                + V  + L  +    
Sbjct: 121 PNLKAQGVEWIDLRSMISER 140


>gi|83309401|ref|YP_419665.1| skin secretory protein xP2 precursor [Magnetospirillum magneticum
           AMB-1]
 gi|82944242|dbj|BAE49106.1| Skin secretory protein xP2 precursor [Magnetospirillum magneticum
           AMB-1]
          Length = 479

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/359 (18%), Positives = 133/359 (37%), Gaps = 25/359 (6%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
             +         +   +    P      +      +         + ++  S+       
Sbjct: 125 DSLPPALPPAEAAPGSKPEAKPDAKVAALPPDGKVTLPPGGDYVAEPESPVSKAFAPKPP 184

Query: 109 DISGKTVVNKPTRSTSIDSLPT--------IEERLILGLSKKELLAKNKVGREDTEVPAM 160
                + +       S +  P+         E + +     KE+  +  +G      P  
Sbjct: 185 PAVDSSGMPTQPNPRSAEKPPSYEGLPAHKGEVKALPPAPNKEMQKRTAIGDLPVPSPDG 244

Query: 161 DKNFCSNASG-------ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
            + +   A          ++A+VV  +G+ +  T+ AI  LP  +TLAF+     LD+W+
Sbjct: 245 KQPWQVYARPWSGPADRGKVAVVVMDMGLDKAATEAAIAKLPPEVTLAFSPYAQGLDKWV 304

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           K+A+  G E ++ +P  A      +     +  +   +  L RL   + RG  Y G+++ 
Sbjct: 305 KKARDYGHEVMMVLPADASGAQPRDPGPLGMTNSVPPESNLARLEGVMARGGAYTGLIS- 363

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G    ++++  +    +    GLL+   G++P + T  LAP   +         D  + 
Sbjct: 364 LGDKFAASEQIVQT-LGKLRDHGLLYVGPGAAPADRTPALAPVTAVA--------DADLF 414

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           R+ I  +   +   ART G+A+ V      S + +  WL     + + +VP+S L +  
Sbjct: 415 REAIEMRFNQVSIAARTKGKALVVINPRPLSFDRLLPWLNDFDGQKLVIVPVSTLVQPP 473


>gi|187918622|ref|YP_001884187.1| cation transport ATPases [Borrelia hermsii DAH]
 gi|119861470|gb|AAX17265.1| cation transport ATPases [Borrelia hermsii DAH]
          Length = 297

 Score =  164 bits (414), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 27/205 (13%), Positives = 86/205 (41%), Gaps = 4/205 (1%)

Query: 175 IVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDE 234
           +++  +G  +         +  NI  +          +  +   K +  ++  PMQ+  +
Sbjct: 81  LIIDDVGYDEFMLDE-FMKIDLNINFSIIPFLPKSMDFYNKLTSKNKITMIHFPMQSKYK 139

Query: 235 SYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAK 294
           +  E   + + +      +  ++  + +  +    + N+ G+++ SN++  ++I  +  +
Sbjct: 140 NSIE--KFHININDNEFAIRKKIEKTFQTYSNAKIMNNHMGSLITSNEDIMQIILIKLKE 197

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
               FFD  ++  +++      + +     D++LD++ +   + + LK  ++IART G  
Sbjct: 198 ENRYFFDSLTTQESISEKTGKNIGILVEQRDIFLDNKDNEKAVIQALKRAKQIARTKGIV 257

Query: 355 IGVAVAF-DESIEVISQWLQQEHVR 378
             +   +   +++++ Q  +     
Sbjct: 258 KVIGHIWSKNTLKILKQESENLKQE 282


>gi|315931831|gb|EFV10786.1| Divergent polysaccharide deacetylase family protein [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 325

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 30/183 (16%), Positives = 86/183 (46%), Gaps = 5/183 (2%)

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              ++AI++  +  +     R +  L   +  +F     +     K A K     ++ +P
Sbjct: 145 KKPKLAIIIDDM--ANASQVRGLKALNLKLNPSFFPPDKNHSETPKLALKFDF-YMVHLP 201

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           + A +   N+ +  TL    + +++  +++   +       + N+ G++  SN+E+   +
Sbjct: 202 LAAINY--NKPELDTLNPNDSKERIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKL 259

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIA 348
           ++    + + F D  +   +    +A +LN+PY+  D++LD++ D + ++++++   ++A
Sbjct: 260 YEVLKNQNIFFVDSKTIGNSKANKIAKELNVPYIQRDVFLDNEDDVNYVKKQIQNAVKLA 319

Query: 349 RTT 351
           +  
Sbjct: 320 QKK 322


>gi|300983577|ref|ZP_07176669.1| divergent polysaccharide deacetylase [Escherichia coli MS 200-1]
 gi|300306901|gb|EFJ61421.1| divergent polysaccharide deacetylase [Escherichia coli MS 200-1]
          Length = 168

 Score =  163 bits (413), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 26/156 (16%), Positives = 58/156 (37%), Gaps = 3/156 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVIAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +A   G E ++ +PM    +   E    TL+   +  ++   +R ++       G+ N+ 
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE--KNTLRPEMSSDEIERIIRSAVNNVPYAVGINNHM 124

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
           G+ + SN    + + +   +  L F D  +      
Sbjct: 125 GSKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQA 160


>gi|213023020|ref|ZP_03337467.1| hypothetical protein Salmonelentericaenterica_10610 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 133

 Score =  155 bits (391), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 54/133 (40%), Gaps = 3/133 (2%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 4   PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 62

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAE 286
           +PM    +   E    TL+   +  ++   +R ++       G+ N+ G+ + S+    +
Sbjct: 63  LPMAPLSKQPLE--KDTLRPDMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMQ 120

Query: 287 VIFKEFAKRGLLF 299
            + +      L F
Sbjct: 121 KVMQALEHYNLYF 133


>gi|329890925|ref|ZP_08269268.1| divergent polysaccharide deacetylase family protein [Brevundimonas
           diminuta ATCC 11568]
 gi|328846226|gb|EGF95790.1| divergent polysaccharide deacetylase family protein [Brevundimonas
           diminuta ATCC 11568]
          Length = 173

 Score =  154 bits (388), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 47/176 (26%), Positives = 78/176 (44%), Gaps = 7/176 (3%)

Query: 215 EAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
            A+  G E ++++PM+      N+   YTL  +     +  +L + L R TGYFGV NY 
Sbjct: 1   MARAHGHEVMIELPMEPTGYPDNDPGPYTLLSSGGADDVAVKLDWLLARATGYFGVTNYL 60

Query: 275 GAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDR 334
           G    ++ E    +     +RGL F DDGS  R                AD  +D++   
Sbjct: 61  GDRFATSDEGVSALMTNLRQRGLAFLDDGSMRR-------RPGAFARASADRVVDEEQTP 113

Query: 335 DKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             I  +   LE  A+T G A+G   ++  ++E  ++W      R + + P S + +
Sbjct: 114 AAILRQFNALEAAAKTNGAALGTGFSYPITVEAAARWTAGLEARGLQLAPASAMTR 169


>gi|330954793|gb|EGH55053.1| hypothetical protein PSYCIT7_26251 [Pseudomonas syringae Cit 7]
          Length = 135

 Score =  152 bits (383), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 55/117 (47%)

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
           + G+ + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+ 
Sbjct: 1   HMGSRMTAEPVAMTWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDER 60

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             + I  +L+   +IAR  G A+ +   +  +++V+ + L     + V  + L  + 
Sbjct: 61  TAEAITRQLQTAIKIARKYGSAVVIGHPYPVTLDVLERELPNLKAQGVEWIDLRSMI 117


>gi|329996912|ref|ZP_08302609.1| divergent polysaccharide deacetylase [Klebsiella sp. MS 92-3]
 gi|328539202|gb|EGF65231.1| divergent polysaccharide deacetylase [Klebsiella sp. MS 92-3]
          Length = 192

 Score =  147 bits (370), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 45/119 (37%), Gaps = 1/119 (0%)

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVD 333
            G+ + SN    + + +   +  L F D  +         A    +  +   ++LDD  +
Sbjct: 1   MGSAMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKGIKRKVFLDDTQN 60

Query: 334 RDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
              IR +      +AR  G AI +      ++ V+ Q +      D+++V  S L    
Sbjct: 61  EADIRNQFNRAIALARRNGSAIAIGHPHPTTVRVLQQMVYNLPP-DITLVRPSSLLNEP 118


>gi|218658574|ref|ZP_03514504.1| hypothetical protein RetlI_02356 [Rhizobium etli IE4771]
          Length = 170

 Score =  146 bits (369), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 65/150 (43%), Positives = 86/150 (57%), Gaps = 6/150 (4%)

Query: 140 SKKELLAKNKVGREDTEVPAMDKN------FCSNASGARIAIVVSGLGISQTGTQRAINL 193
             + LL     GR     P   +         S A G RIAIVVSGLG+SQTGTQRAI  
Sbjct: 2   PNEALLEDTAFGRLPIIGPDGRRPMDQYARPSSGARGIRIAIVVSGLGLSQTGTQRAITE 61

Query: 194 LPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQL 253
           LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ V + 
Sbjct: 62  LPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKPVARN 121

Query: 254 LNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +  L  ++   T Y G+MNY G   LS+  
Sbjct: 122 IENLHKAMGEITNYTGIMNYLGGRFLSDPR 151


>gi|163736557|ref|ZP_02143976.1| hypothetical protein RGBS107_15536 [Phaeobacter gallaeciensis
           BS107]
 gi|161390427|gb|EDQ14777.1| hypothetical protein RGBS107_15536 [Phaeobacter gallaeciensis
           BS107]
          Length = 557

 Score =  144 bits (362), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 48/387 (12%), Positives = 92/387 (23%), Gaps = 20/387 (5%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPI 69
                   +         G   L      G      +      T   ++P         +
Sbjct: 189 GGDEASATASLPVPDVATGGPAL-SGAEAGGDQGPALGAVPGPTAIPVVPGLGQAGPTEV 247

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
                 N            +   N+        D       +          S      P
Sbjct: 248 GTQPAANASQADGAQPETTDEDANEDAGARRIADLPTTKPTTEPDSAVDEAGSRPRIGTP 307

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                     +   + ++    ++        + F   A  A ++IV+     +      
Sbjct: 308 VRPLTERDQATAPAVGSQTSAQQDGVPFERNAEAFTPEADRALMSIVLIDD--ADAIGAE 365

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           A+   P  ++ A           M   +  G E +L                  L     
Sbjct: 366 ALQDFPYPLSFALDPQDPEAAAKMARHRAAGFEVML---------------IADLPRDAA 410

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
            Q     L+  L        V+         N+  A+ +       G       +    +
Sbjct: 411 PQDAETALQVWLESLPEAVAVLEGVNTGFQGNRPLADQMATALGAMGYGMVTQDAGLNTV 470

Query: 310 TRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
            + LA +  +P  V     D    D   IR  L      A   G  I +     ++I  +
Sbjct: 471 -QKLALREGVPAGVVFRDFDGAGQDPRAIRRFLDQAAFRAGQEGAVIMLGRVQPDTISAL 529

Query: 369 SQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             W  Q+    V++ P+S   +    +
Sbjct: 530 LIWGLQDRANRVALAPVSASLRAKLQA 556


>gi|218509896|ref|ZP_03507774.1| hypothetical protein RetlB5_21730 [Rhizobium etli Brasil 5]
          Length = 234

 Score =  143 bits (361), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 69/243 (28%), Positives = 98/243 (40%), Gaps = 27/243 (11%)

Query: 26  RLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSK 85
                 L    I G S+Y       +             E A  P T     +    P  
Sbjct: 5   GRIAASLCLFAIGGFSLYTAFRGEGL-------------ERAKPPATEQAASQTLSKPPT 51

Query: 86  RDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNKPTRSTSIDSLPTIEE------RLIL 137
              +   N +     +    ++  I+G    V               ++         + 
Sbjct: 52  ATADQAANGMPRADPRSGANVEQMITGDGSVVTKYSPHPRDGSGPVLVDAMQIGQDPRMA 111

Query: 138 GLSKKELLAKNKVGREDTEVPAMDKN------FCSNASGARIAIVVSGLGISQTGTQRAI 191
               + LL     GR     P   +         S A G RIAIVVSGLG+SQTGTQRAI
Sbjct: 112 AQPNEALLEDTAFGRLPIVGPDGRRPMDQYARPSSGARGIRIAIVVSGLGLSQTGTQRAI 171

Query: 192 NLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQ 251
             LP  ITLAFA++GNSL RWM+EA++ G E +LQ+P++ FD   N+    TL  ++ V 
Sbjct: 172 AELPEEITLAFAASGNSLQRWMQEARRGGHEILLQVPLEPFDYPANDPGPETLLTSKPVA 231

Query: 252 QLL 254
           + +
Sbjct: 232 RNI 234


>gi|108809471|ref|YP_653387.1| hypothetical protein YPA_3480 [Yersinia pestis Antiqua]
 gi|108813948|ref|YP_649715.1| hypothetical protein YPN_3788 [Yersinia pestis Nepal516]
 gi|145601083|ref|YP_001165159.1| hypothetical protein YPDSF_3843 [Yersinia pestis Pestoides F]
 gi|229836175|ref|ZP_04456343.1| putative periplasmic protein [Yersinia pestis Pestoides A]
 gi|229839911|ref|ZP_04460070.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229841993|ref|ZP_04462148.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904478|ref|ZP_04519589.1| putative periplasmic protein [Yersinia pestis Nepal516]
 gi|270488477|ref|ZP_06205551.1| divergent polysaccharide deacetylase [Yersinia pestis KIM D27]
 gi|294502167|ref|YP_003566229.1| hypothetical protein YPZ3_0057 [Yersinia pestis Z176003]
 gi|108777596|gb|ABG20115.1| hypothetical protein YPN_3788 [Yersinia pestis Nepal516]
 gi|108781384|gb|ABG15442.1| hypothetical protein YPA_3480 [Yersinia pestis Antiqua]
 gi|145212779|gb|ABP42186.1| hypothetical protein YPDSF_3843 [Yersinia pestis Pestoides F]
 gi|229678596|gb|EEO74701.1| putative periplasmic protein [Yersinia pestis Nepal516]
 gi|229690303|gb|EEO82357.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696277|gb|EEO86324.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706623|gb|EEO92629.1| putative periplasmic protein [Yersinia pestis Pestoides A]
 gi|262360246|gb|ACY56967.1| hypothetical protein YPD4_0058 [Yersinia pestis D106004]
 gi|262364193|gb|ACY60750.1| hypothetical protein YPD8_0060 [Yersinia pestis D182038]
 gi|270336981|gb|EFA47758.1| divergent polysaccharide deacetylase [Yersinia pestis KIM D27]
 gi|294352626|gb|ADE62967.1| hypothetical protein YPZ3_0057 [Yersinia pestis Z176003]
          Length = 145

 Score =  141 bits (355), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 54/130 (41%), Gaps = 3/130 (2%)

Query: 163 NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
              S A   +++IV+   G      +  I  +P  I++A   N         +A  +G+E
Sbjct: 16  FIASTAQAGKLSIVIDDFGYRPQN-ENKILQMPLPISVAILPNAPYAREMATKAHNQGRE 74

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            ++ +PM    +   E    TL+ + + +++   +R +        G+ N+ G+ + ++ 
Sbjct: 75  ILIHLPMAPQSKQPLE--RDTLQPSMSSEEIQRIIRQAANNVPYAKGMNNHMGSAMTASL 132

Query: 283 ESAEVIFKEF 292
              + + +  
Sbjct: 133 PGMQKVMQAL 142


>gi|163742795|ref|ZP_02150180.1| hypothetical protein RG210_15660 [Phaeobacter gallaeciensis 2.10]
 gi|161384050|gb|EDQ08434.1| hypothetical protein RG210_15660 [Phaeobacter gallaeciensis 2.10]
          Length = 545

 Score =  140 bits (354), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/387 (12%), Positives = 91/387 (23%), Gaps = 20/387 (5%)

Query: 10  RKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPI 69
                   +             L      G      +      T   ++P         +
Sbjct: 177 GGDEASATASLPVPDVATAGPAL-SGAEAGGDQGPALGAVPGPTAIPVVPGLGQAGPTEV 235

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
                 N            +   N+        D       +          S      P
Sbjct: 236 GTQPAANASQADGAQPETTDEDANEDAGARRIADLPTTKPTTESDSAVDEAGSRPRIGTP 295

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                     +   + ++    ++        + F   A  A ++IV+     +      
Sbjct: 296 VRPLTERDQANAPAVGSQTSAQQDGVPFERNAEAFTPEADRALMSIVLIDD--ADAIGAE 353

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           A+   P  ++ A           M   +  G E +L                  L     
Sbjct: 354 ALQDFPYPLSFALDPKDPEAAAKMARHRAAGFEVML---------------IADLPRDAA 398

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
            Q     L+  L        V+         N+  A+ +       G       +    +
Sbjct: 399 PQDAETALQVWLESLPEAVAVLEGVNTGFQGNRPLADQMATALGAMGYGMVTQDAGLNTV 458

Query: 310 TRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
            + LA +  +P  V     D    D   IR  L      A   G  I +     ++I  +
Sbjct: 459 -QKLALREGVPAGVVFRDFDGAGQDPRAIRRFLDQAAFRAGQEGAVIMLGRVQPDTISAL 517

Query: 369 SQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             W  Q+    V++ P+S   +    +
Sbjct: 518 LIWGLQDRANRVALAPVSASLRAKLQA 544


>gi|289672249|ref|ZP_06493139.1| hypothetical protein PsyrpsF_03340 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 159

 Score =  140 bits (354), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 30/151 (19%), Positives = 59/151 (39%), Gaps = 7/151 (4%)

Query: 156 EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
              A           A +++++  LG +Q    R    LP  +TLA   +      + ++
Sbjct: 16  VAHAAPAENSGKPPKAYLSLIIDDLGQNQDRDSRT-LALPGPVTLAIMPDTPHATEFARQ 74

Query: 216 AKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRG 275
           A + G+  +L +PM            Y       + +L +RL  +L +     G+ N+ G
Sbjct: 75  AHRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHMG 128

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSP 306
           + + +   +   +  E  +R L F D  +S 
Sbjct: 129 SRMTAEPVAMTWLMAELQRRHLFFVDSRTSA 159


>gi|83953833|ref|ZP_00962554.1| hypothetical protein NAS141_06398 [Sulfitobacter sp. NAS-14.1]
 gi|83841778|gb|EAP80947.1| hypothetical protein NAS141_06398 [Sulfitobacter sp. NAS-14.1]
          Length = 564

 Score =  140 bits (352), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 50/353 (14%), Positives = 108/353 (30%), Gaps = 30/353 (8%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLN---IEDKQSPSKRDNNTVCNQLKNDSSQHDGQ 105
             +G  +   P     E    P++   +        +P  +      + +     Q    
Sbjct: 234 DALGIETRTAPPVTADESVDTPVSPTPDTDVATAPSAPDAQPEEAPADVVFGAPEQRTDG 293

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
                +   + ++     +I+ LPT +         +       + R         + F 
Sbjct: 294 RPTIGTPAAITSERDTGVTINRLPTAQSGEQAAPEAQATAQSPAITRYG-------QPFA 346

Query: 166 SNASGARIAIVVSGLGISQTGTQ---RAINLLPANITLAFASNGNSLDRWMKEAKKKGQE 222
           +      +++++  +G    G +    A+   P  ++ A   +       M+  + +G E
Sbjct: 347 NPDDKPLMSVLLMDVGSDLQGGEVGIAALRSFPYPLSFAVDVSLPDAAERMQTYRNEGFE 406

Query: 223 AILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNK 282
            +  +                L            L  +  R     GV+  +GA L  ++
Sbjct: 407 VLAMV---------------DLPQGAQPSDAETTLAVAFSRMPEVIGVLEGQGAGLQPDR 451

Query: 283 ESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKL 341
            +A+ +     + G            +   LA K  +P        D +      IR  L
Sbjct: 452 ATADQVTAILGQGGYGLVTQDKGLNTM-PKLAVKEGVPAAPVFRDFDSKGQTPTVIRRFL 510

Query: 342 KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
                 A   G  I +     E+I  +  W  Q+    V++ P+S + K ++P
Sbjct: 511 DQAAFKAGIEGSVIMMGRMRPETISALLVWGLQDRASQVALAPVSAVLKNATP 563


>gi|148259913|ref|YP_001234040.1| protein of unknown function DUF610, YibQ [Acidiphilium cryptum
           JF-5]
 gi|146401594|gb|ABQ30121.1| protein of unknown function DUF610, YibQ [Acidiphilium cryptum
           JF-5]
          Length = 327

 Score =  139 bits (350), Expect = 9e-31,   Method: Composition-based stats.
 Identities = 64/305 (20%), Positives = 115/305 (37%), Gaps = 12/305 (3%)

Query: 90  TVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK 149
                +     Q  G   +D +  T        ++I                 ++     
Sbjct: 24  AAAALIGAVVLQVIGPPDHDTAMLTGPVLHRSGSAIPPPNPALLVASKANPAWKIPHPAP 83

Query: 150 VGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSL 209
            G       A             +A+++ G+G ++  ++ AI  LP  ++LA    G  L
Sbjct: 84  DGMTPMRYYAAAAPVPVPQGLHPVAVMMGGIGEARQASRDAIRSLPPAVSLALTPYGPHL 143

Query: 210 DRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
              +  A+  G E ++ IPMQ   E    +    L+ ++     L  L ++L R  GY G
Sbjct: 144 RSVVAAARAAGHETLMGIPMQTDREPAITEGDEALRGSELDPVNLKHLDWALSRSAGYVG 203

Query: 270 VMNYRGAM----LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
           V +  G       L+   +   + K+    GLL     +S  +          +P  VAD
Sbjct: 204 VTDEIGMSVDETYLTQLLNRHWLGKQLRPTGLLLVT--ASQGSGVPS-----GVPGRVAD 256

Query: 326 LYLDDQVDRDKIREKLKGLEEIARTTGQAIG-VAVAFDESIEVISQWLQQEHVRDVSVVP 384
           + +  ++  D+ R  LK L   A  +G A+G ++    + I V++QW Q      + +VP
Sbjct: 257 VVIHPEMSVDEQRAALKRLAATAVASGSALGVISSPTADDIAVLAQWCQGLKADGLVLVP 316

Query: 385 LSCLA 389
           +S L 
Sbjct: 317 VSALV 321


>gi|254477484|ref|ZP_05090870.1| Divergent polysaccharide deacetylase family [Ruegeria sp. R11]
 gi|214031727|gb|EEB72562.1| Divergent polysaccharide deacetylase family [Ruegeria sp. R11]
          Length = 536

 Score =  138 bits (348), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 51/395 (12%), Positives = 98/395 (24%), Gaps = 27/395 (6%)

Query: 8   PLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSV----- 62
           PL + T + +                 +     +  +        T     P        
Sbjct: 161 PLGETTAEPRPESPGETVTDPSTSPASSDGTQGATALPAPDVASSTPGLAAPDLGGPSLG 220

Query: 63  -IREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
              +    PL         +    +       +  +  +Q         +  T     T 
Sbjct: 221 SAPDPTATPLLPGQGQPAPEQVGTQTPEVAAQESDDSGAQPSRIAALPTTTNTGEAVETT 280

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLG 181
              I +               E  + +  G +     A         +   I ++     
Sbjct: 281 RPRIGTPAGSLVDRDRTDEGTEPASVSPRGLDPFVANAEAFTPEEGRALMSIVLIDD--- 337

Query: 182 ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDS 241
            +      A+   P  +T A   N       M+  +  G E ++                
Sbjct: 338 -ADAIGAEALQDFPYPLTFALDPNDPRAVEKMRAHRAAGFEVMVMA-------------- 382

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
             L    + Q     L   L +      V+         N+  A+ +       G     
Sbjct: 383 -DLARDASPQDAETALAVWLDQLPSSVAVLEGVQTGFQGNRPLADQMAAALDAMGYGMVT 441

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVA 360
             +    + + LA +  +P  V     D    D   IR  L      A   G  I +   
Sbjct: 442 QDAGLNTV-QKLALRNGMPAGVVFRDFDGAGQDPRAIRRFLDQAAFRAGQEGAVIMLGRV 500

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPS 395
             ++I  +  W  Q+    VS+ P+S   +   P+
Sbjct: 501 QPDTISALLLWGLQDRASRVSLAPVSASLRAKLPT 535


>gi|326403133|ref|YP_004283214.1| hypothetical protein ACMV_09850 [Acidiphilium multivorum AIU301]
 gi|325049994|dbj|BAJ80332.1| hypothetical protein ACMV_09850 [Acidiphilium multivorum AIU301]
          Length = 321

 Score =  138 bits (347), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 64/305 (20%), Positives = 115/305 (37%), Gaps = 12/305 (3%)

Query: 90  TVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK 149
                +     Q  G   +D +  T        ++I                 ++     
Sbjct: 18  AAAALIGAVVLQVIGPPDHDTAMLTGPVLHRSGSAIPPPNPALLVASKANPAWKIPHPAP 77

Query: 150 VGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSL 209
            G       A             +A+++ G+G ++  ++ AI  LP  ++LA    G  L
Sbjct: 78  DGMTPMRYYAAAAPVPVPQGLHPVAVMMGGIGEARQASRDAIRSLPPAVSLALTPYGPHL 137

Query: 210 DRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
              +  A+  G E ++ IPMQ   E    +    L+ ++     L  L ++L R  GY G
Sbjct: 138 RSVVAAARAAGHETLMGIPMQTDREPAITEGDEALRGSELDPVNLKHLDWALSRSAGYVG 197

Query: 270 VMNYRGAM----LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVAD 325
           V +  G       L+   +   + K+    GLL     +S  +          +P  VAD
Sbjct: 198 VTDEIGMSVDETYLTQLLNRHWLGKQLRPTGLLLVT--ASQGSGVPS-----GVPGRVAD 250

Query: 326 LYLDDQVDRDKIREKLKGLEEIARTTGQAIG-VAVAFDESIEVISQWLQQEHVRDVSVVP 384
           + +  ++  D+ R  LK L   A  +G A+G ++    + I V++QW Q      + +VP
Sbjct: 251 VVIHPEMSVDEQRAALKRLAATAVASGSALGVISSPTADDIAVLAQWCQGLKADGLVLVP 310

Query: 385 LSCLA 389
           +S L 
Sbjct: 311 VSALV 315


>gi|83942592|ref|ZP_00955053.1| hypothetical protein EE36_16167 [Sulfitobacter sp. EE-36]
 gi|83846685|gb|EAP84561.1| hypothetical protein EE36_16167 [Sulfitobacter sp. EE-36]
          Length = 568

 Score =  137 bits (346), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 52/358 (14%), Positives = 109/358 (30%), Gaps = 29/358 (8%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                + + P      ++P P T P++     +P     +T      +       +   D
Sbjct: 226 PTPDTTPVSPTPDTTPVSPTPDTTPVSPTPDTTPVSPTPDTEVATAPSAPDARPEEAPAD 285

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILG-----LSKKELLAKNKVGREDTEVPAM---- 160
           +       +     +I +   I      G     L   +   +     + T         
Sbjct: 286 VVFGAPEQRTDGRPTIGTPAAITSERDTGVTINRLPNAQSGEQTAPEAQATAQSPAITRY 345

Query: 161 DKNFCSNASGARIAIVVSGLGISQTGTQ---RAINLLPANITLAFASNGNSLDRWMKEAK 217
            + F +      +++++  +G    G +    A+   P  ++ A   +       M+  +
Sbjct: 346 GQPFANPDDKPLMSVLLMDVGSDLQGGEVGIAALRSFPYPLSFAVDVSLPDAAERMQTYR 405

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
            +G E +  +                L            L  +  R     GV+  +GA 
Sbjct: 406 NEGFEVLAMV---------------DLPQGAQPSDAETTLAVAFSRMPEVIGVLEGQGAG 450

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDK 336
           L  ++ +A+ +     + G            +   LA K  +P        D +      
Sbjct: 451 LQPDRATADQVTAILGQGGYGLVTQDKGLNTM-PKLAVKEGVPAAPVFRDFDSKGQTPTV 509

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
           IR  L      A   G  I +     E+I  +  W  Q+    V++ P+S + K ++P
Sbjct: 510 IRRFLDQAAFKAGIEGSVIMMGRMRPETISALLVWGLQDRASQVALAPVSAVLKNATP 567


>gi|237802213|ref|ZP_04590674.1| hypothetical protein POR16_25584 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025070|gb|EGI05126.1| hypothetical protein POR16_25584 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 130

 Score =  137 bits (344), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 21/112 (18%), Positives = 51/112 (45%)

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKI 337
           + +   +   +  E  +R L F D  +S + +    A ++ L  +  D++LDD+   + I
Sbjct: 1   MTAEPVAMAWLMAELQRRHLFFVDSRTSAKTVAAAEAQRIGLASVSRDVFLDDERTAEAI 60

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             +L+   E+A   G  + +   +  +++V+ + L +   + V  + L  + 
Sbjct: 61  TRQLQTAIELAHKQGSVVVIGHPYPVTLDVLERELPKLKAQGVEWIDLRSMI 112


>gi|195936178|ref|ZP_03081560.1| hypothetical protein EscherichcoliO157_06888 [Escherichia coli
           O157:H7 str. EC4024]
          Length = 194

 Score =  136 bits (342), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 21/117 (17%), Positives = 44/117 (37%), Gaps = 1/117 (0%)

Query: 276 AMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRD 335
           + + SN    + + +   +  L F D  +         A    +  +   ++LDD  +  
Sbjct: 1   SKMTSNLFGMQKVMQALERYNLYFLDSVTIGNTQAMRAAQGTGVKVIKRKVFLDDSQNEA 60

Query: 336 KIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
            IR +     ++AR  G  I +      ++ V+ Q +      D+++V  S L    
Sbjct: 61  DIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP-DITLVKASSLLNEP 116


>gi|126731361|ref|ZP_01747168.1| hypothetical protein SSE37_06829 [Sagittula stellata E-37]
 gi|126708272|gb|EBA07331.1| hypothetical protein SSE37_06829 [Sagittula stellata E-37]
          Length = 420

 Score =  135 bits (339), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 44/345 (12%), Positives = 97/345 (28%), Gaps = 20/345 (5%)

Query: 51  VGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDI 110
           + +  E    +    +      +     +  +P   +         +D  +  G+     
Sbjct: 88  IESPPEPAAEAGPEAVEDAAPPVETATSEVPAPVTLEPEDAPELAADDPKETPGRPTIGT 147

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLIL-GLSKKELLAKNKVGREDT-EVPAMDKNFCSNA 168
              ++ ++    +         E        + E L            +      F    
Sbjct: 148 PAGSLADRAPAVSEGRLPTIGAEAETPVATEEPEALETVADPLGPDSPLVKYASRFTPQT 207

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
              R+++++   G    G +  +   P  ++ A +          +  +++G E +    
Sbjct: 208 DVPRMSLILVDDGSGPMGPEE-LETFPFPVSFAISPAHPDPKGAAEGYRERGFEVLA--- 263

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
                          +        +   L        G  GV+      L  ++E +   
Sbjct: 264 ------------LGDMPEGAVASDVEVSLTGLFDAIPGAVGVLEDPSGGLQGSREVSMQA 311

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEI 347
                  G              + LA K  +P       LD +  D+  IR  L      
Sbjct: 312 AAFLGSTGHGLVMVPKGLNT-AQKLAAKEGVPSATLFRDLDSEGQDQGLIRRTLDQAAFR 370

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           AR  G  I +     ++I  +  W  Q+    +++VP+S + K S
Sbjct: 371 ARQEGAVIMLGRLRADTISALLLWGLQDRGNTIALVPISTVLKES 415


>gi|126737882|ref|ZP_01753612.1| hypothetical protein RSK20926_19612 [Roseobacter sp. SK209-2-6]
 gi|126721275|gb|EBA17979.1| hypothetical protein RSK20926_19612 [Roseobacter sp. SK209-2-6]
          Length = 527

 Score =  132 bits (332), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 41/362 (11%), Positives = 90/362 (24%), Gaps = 20/362 (5%)

Query: 32  LFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTV 91
                + G  +        +G   E      +      P ++P    + +  +     T 
Sbjct: 178 AGSAAVPGAQLVTTTDGPAIGQAPEETALPQLSIGEASPPSLPNVALEGEEAAAGPEETS 237

Query: 92  CNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVG 151
              L            +  + +    +P  ++ I +                +L  ++  
Sbjct: 238 DADLAVAGETEGAGEGDPSADQPATEEPIVTSRIGTKVVPLTERDDEGPASSILGGDQAE 297

Query: 152 REDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
                     +            I++            A+   P  ++ A      +   
Sbjct: 298 ELPPFEANAAEFSLEGDRPVMSIILIDD---ENGFGAEALAEFPYPLSFAIDPADPAAQE 354

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
            M+  +  G E ++                  L      Q                  V+
Sbjct: 355 KMERWRAAGFEVLI---------------LADLPQDAAPQDAETSFAVWQNALPKAVAVL 399

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
                    N+  A+ +       G       +    + + LA +  +P  V     D  
Sbjct: 400 EGVKTGFQGNRALADQMSLLLQDTGYGMVTQNNGLNTV-QKLALRDGMPAGVVFRDFDGA 458

Query: 332 -VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             +   IR  L      AR  G  I +     +++  +  W  Q+    V++ P+S   K
Sbjct: 459 GQNPRAIRRFLDQAAFRARQEGAVIMLGRLQPDTVSALLLWGLQDRAAQVNLAPVSAGLK 518

Query: 391 LS 392
             
Sbjct: 519 AK 520


>gi|86138846|ref|ZP_01057418.1| hypothetical protein MED193_03722 [Roseobacter sp. MED193]
 gi|85824493|gb|EAQ44696.1| hypothetical protein MED193_03722 [Roseobacter sp. MED193]
          Length = 567

 Score =  130 bits (328), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 43/360 (11%), Positives = 97/360 (26%), Gaps = 27/360 (7%)

Query: 46  ISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQ 105
           +S   +G          I  +              ++ +  +        + +      +
Sbjct: 225 LSGPQIGAAPTATVRPSIAVMPVATPNAARADTQAEAETDAEETASAVGAEPEQEATLAE 284

Query: 106 IQNDISGKTVVNKPTRSTSIDS--------LPTIEERLILGLSKKELLAKNKVGREDTEV 157
            Q+ +S                          T   R    +      A      + T  
Sbjct: 285 RQSVLSPSDQDQTEADQQETTGSRLASRVVPLTERSRTPTLIGNNAEPAVEATSPQGTPF 344

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
               + F +      ++IV+    +       A+   P  +T A +    +     +  +
Sbjct: 345 EINAEEFTAPEGRPLMSIVLIDDAV--AIGAEALESFPYPLTFAISPQDPNAAEKTQARR 402

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
             G E ++                  L    + Q     +   +++     G++      
Sbjct: 403 AAGFEVLM---------------LADLPREASPQDAETAMAVWIQQMPQAVGILEGVQTG 447

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDK 336
              N+  A+ +       G       +    + + LA +  +P  V     D    +   
Sbjct: 448 FQGNRALADQMVAVMQASGFGMVTQNNGLNTV-QKLALRDGIPSGVVFRDFDGAGQNPRA 506

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           IR  L      AR  G  I +     ++I  +  W  Q+    V + P+S   + +  S+
Sbjct: 507 IRRFLDQAAFRARQEGAVIMLGRLRPDTISALLLWGLQDRASQVGLAPISAGLRANLTST 566


>gi|254460615|ref|ZP_05074031.1| Divergent polysaccharide deacetylase family [Rhodobacterales
           bacterium HTCC2083]
 gi|206677204|gb|EDZ41691.1| Divergent polysaccharide deacetylase family [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 463

 Score =  129 bits (325), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 50/358 (13%), Positives = 106/358 (29%), Gaps = 33/358 (9%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
                 +E+    V       P T+  +  + +  +K +     +  K    + + + + 
Sbjct: 116 DPEAGEAELETAEVAETEQAEPETVGADAVEAEPEAKPEAEAEVSGAKTPVPEVEIEPET 175

Query: 109 DISGK--------------TVVNKPTRSTSIDSLPTIEERLILGLSKKEL-LAKNKVGRE 153
                                       T  D  P +    +  L+ +E+    +     
Sbjct: 176 AAEETLENANAAESITDKIIAALPKPVGTVGDLAPEVTTNRLPSLATEEVETEDSPSTVA 235

Query: 154 DTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWM 213
                              ++IV+   G S  G   A++  P  +T A  ++  +    M
Sbjct: 236 SPPFERFASTAPIENDKPHMSIVLIDTGDSSLGV-EALDSFPYPLTFAVDASIPNAVERM 294

Query: 214 KEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNY 273
           +  + KG E +  I                L +  T   +   +   L       G++  
Sbjct: 295 QVYRDKGFEVLALI---------------DLPLGATASDVEVAMSAYLAAVPEAVGILEG 339

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD-DQV 332
               + +++E A+ + +     G       S      R LA +  +P        D +  
Sbjct: 340 VETGVQTSREMADQLTQIILDSGHGMLLQKSGLNT-ARKLAEREGIPAATVFRDFDGNGQ 398

Query: 333 DRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +R  L      A   G  + +     E+I  +  W   +    V++VP+S + K
Sbjct: 399 SASVMRRFLDQAAFRAAQEGGVVMMGRLQAETISALLIWGLADRASRVALVPVSAVLK 456


>gi|254510103|ref|ZP_05122170.1| YibQ protein [Rhodobacteraceae bacterium KLH11]
 gi|221533814|gb|EEE36802.1| YibQ protein [Rhodobacteraceae bacterium KLH11]
          Length = 512

 Score =  129 bits (324), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 47/337 (13%), Positives = 102/337 (30%), Gaps = 22/337 (6%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKND-SSQHDGQIQNDISGKT 114
           E  P   + E AP      + + + +  S  +  ++  +       + D +        T
Sbjct: 184 EATPEEQVVESAPQEDAPQVAVVEPEPESVPEIESLPQENPIAVEGEEDTRPVRQPRVLT 243

Query: 115 VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIA 174
           +       +        +  + L           +V      +     +F +  +   ++
Sbjct: 244 LPQIGGEQSESSGTLIGKRVVPLTERDNPPAETPEVVVATKPIDEYAASFDNPEAKPLMS 303

Query: 175 IV-VSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFD 233
           I+ +   G        A+   P  I+ A + N       M   ++ G E +  I      
Sbjct: 304 IILIDDEG---AFGAEALQDFPYPISFAVSPNDPDAAEKMVRHREAGFEVLALI------ 354

Query: 234 ESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFA 293
                     L    + Q     L   L       G++    + +  N++ A+ +     
Sbjct: 355 ---------DLHEAASAQDAEVSLSVWLDELPYTVGLLEGVESGIQGNRKLADQVAAIAG 405

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTG 352
             G       S    + + LA +  +P  V     D  + D   +R  L      A   G
Sbjct: 406 GTGRGLVTQDSGLNTV-QKLAARNGIPSSVVFRDFDGARQDPKVMRRFLDQAAFRAGQEG 464

Query: 353 QAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
             + +     E+I  +  W  ++    V++ P+S + 
Sbjct: 465 AVVMLGRLRPETISALLLWGLEDRGNRVAMAPISAVM 501


>gi|304320591|ref|YP_003854234.1| hypothetical protein PB2503_05087 [Parvularcula bermudensis
           HTCC2503]
 gi|303299493|gb|ADM09092.1| hypothetical protein PB2503_05087 [Parvularcula bermudensis
           HTCC2503]
          Length = 388

 Score =  129 bits (324), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 71/392 (18%), Positives = 127/392 (32%), Gaps = 24/392 (6%)

Query: 17  KSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVG---TISEMIPYSVIREIAPIPLTI 73
           ++  S +    G+         G  ++     A       +          E  P     
Sbjct: 3   RAGVSYLRVAWGVLAAVMVIAAGAVLWAPDPDAPQPMVLDLPGEADRYAGAETGPGTEIE 62

Query: 74  PLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSI-------- 125
                   +           + + +    +        G  +                  
Sbjct: 63  AGAEASALADGAETAGVRIIRGEAELPSPEVAAAGSGDGDGLATATESRGDGSVRITIVG 122

Query: 126 DSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG------ARIAIVVSG 179
                             L  K   G            F +            +A++VSG
Sbjct: 123 GGDKAAARVPEPRHLDTSLTVKTAAGLRPARNARGATPFAAYRQAMPAKTAPALAVMVSG 182

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
           LG+    T RA+  LPA I ++F++   ++D  +  A   G+EA L+IPM     S    
Sbjct: 183 LGLDPVTTDRALLALPAEIGVSFSAYARNVDARLSAALAAGREAALEIPMATRGLSEAVL 242

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLF 299
               L   +  +    RL + L R   Y  V N+ G +  SN E+ +       + GL +
Sbjct: 243 GPAALSPDRAAEGNATRLDWVLSRAPAYPYVTNFEGDLFASNAEAMQAFLNALDRAGLGY 302

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV 359
            DD          +A  LNLPY   DL L  + +  +  ++L+ +   A +  + + V V
Sbjct: 303 LDD----TGKGGAIARALNLPYGEVDLVL--EPNDPEAADRLRAVSRRALSAERPLIVKV 356

Query: 360 -AFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            A D +++ +  W+      +V +VP S   +
Sbjct: 357 YASDGNLDAVMAWVDTLQSGEVGLVPPSAAMR 388


>gi|260433614|ref|ZP_05787585.1| YibQ protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417442|gb|EEX10701.1| YibQ protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 484

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 43/356 (12%), Positives = 100/356 (28%), Gaps = 34/356 (9%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNT-----------VCNQLKND 98
                 +          +P   + P     + +   ++                   ++ 
Sbjct: 148 PTAPEPQDQDTIEASGPSPDQGSQPDADSAEIAALPQEPEANVPSVTSQSPIAVEGDEDT 207

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVP 158
           + +   +I            P+ S     +  + ER      + E+        +     
Sbjct: 208 APRKRARIAALPQIGAEPTAPSTSGVGKRVVPLTERDDPPADQTEITQPEAPPGDPI--D 265

Query: 159 AMDKNFCSNASGARIAIV-VSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
           A    F +      ++IV +   G        A+   P  ++ A   +       +K  +
Sbjct: 266 AYAAPFENPEGKPLMSIVLIDDEG---AFGAEALKDFPYPLSFAIDPSDPQAAEKVKRYR 322

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
           + G E ++                  L  + + Q     L   L       G++      
Sbjct: 323 EAGFEVLI---------------LTDLPRSFSAQDAEVSLSVWLEALPETVGLLEGVETG 367

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLD-DQVDRDK 336
           +  N+  A+ +       G            + + LA +  +P  +    +D    + D 
Sbjct: 368 IQGNRRLADQVAAIAGATGRGLVVQDKGLNTV-QKLAARNGIPSSIVFRDIDRAGQEADV 426

Query: 337 IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +R  L      A   G  + +     E+I  +  W  ++    V++ P+S + K  
Sbjct: 427 MRRFLDQAAFRASQEGAVVMLGRLRPETISALLLWGLEDRSSRVALAPISAVMKSQ 482


>gi|56697013|ref|YP_167375.1| hypothetical protein SPO2148 [Ruegeria pomeroyi DSS-3]
 gi|56678750|gb|AAV95416.1| hypothetical protein SPO2148 [Ruegeria pomeroyi DSS-3]
          Length = 481

 Score =  128 bits (321), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 49/376 (13%), Positives = 103/376 (27%), Gaps = 43/376 (11%)

Query: 39  GLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQL--K 96
           G  +  L   +         P       A           +  +PS  D+     +    
Sbjct: 119 GSGVTQLQLASPAAPQDRAEPEVNTEAPAQPSAPETGVTAEVTAPSLPDSTPAVPETATD 178

Query: 97  NDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE 156
              +Q    +    +  T     T + + ++    E+  I  L +     +    R  T 
Sbjct: 179 AQPAQESASVAEAPATDTAPVPDTATAAPEAPQEEEKPRIAALPQIGGAEEGAAPRVGTP 238

Query: 157 VPAMDKNFCSNASGAR----------------------IAIVVSGLGISQTGTQRAINLL 194
           V  + +   + A                          ++IV+     ++     A+   
Sbjct: 239 VVPLTERDSAVAEAPAEGGPRPIEAYAATFDNPEDKPLMSIVLIDD--AEGLGSEALRDF 296

Query: 195 PANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLL 254
           P  +T A           M   +  G E +L                  L    + Q   
Sbjct: 297 PYPLTFALDPADPQAAEKMARHRAAGVEVML---------------IADLPAAASAQDAE 341

Query: 255 NRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLA 314
             +   L+      G++   G  +  N+  ++ +       G       +    + + LA
Sbjct: 342 VSMAVWLKALPETVGILEGTGTGIQGNRALSDQVTAIVGGSGRGLLTQDNGLNTV-QKLA 400

Query: 315 PKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQ 373
            +  +P  V     D        +R  L      A   G  + +     ++I  +  W  
Sbjct: 401 ARDGVPSAVVFRDFDGAGQSPTVMRRFLDQAAFRAGQEGAVVMLGRLRPDTISALLLWGL 460

Query: 374 QEHVRDVSVVPLSCLA 389
           Q+    V++ P+S + 
Sbjct: 461 QDRASRVALAPVSAVL 476


>gi|218462232|ref|ZP_03502323.1| hypothetical protein RetlK5_23383 [Rhizobium etli Kim 5]
          Length = 234

 Score =  124 bits (311), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 62/230 (26%), Positives = 84/230 (36%), Gaps = 27/230 (11%)

Query: 1   MSIDLNHPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPY 60
           M  DL+ PL +           +        L    I G S+Y       +         
Sbjct: 1   MGTDLHAPLGRNRKTASRRPGVLRLGRIAASLCLFAIGGFSLYTAFRGDGL--------- 51

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK--TVVNK 118
               E A  P       +    P     +   + +     +    ++  I+G    V   
Sbjct: 52  ----ERAKPPTAEQAATQASGKPPTAAADQAADGMPRADPRSGANVEQMITGDGSVVTKY 107

Query: 119 PTRSTSIDSLPTIEE------RLILGLSKKELLAKNKVGREDTEVPAMDKN------FCS 166
             R         ++         +     + LL     GR     P   +         S
Sbjct: 108 SPRPRDGSGPVLVDAMQIGQDPRMAAQPNEALLEDTAFGRLPIVGPDGRRPMDQYARPSS 167

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
            A G RIAIVVSGLG+SQTGTQRAI  LP  ITLAFA++GNSL RWM+EA
Sbjct: 168 GARGIRIAIVVSGLGLSQTGTQRAIAELPEEITLAFAASGNSLQRWMQEA 217


>gi|83951840|ref|ZP_00960572.1| hypothetical protein ISM_14795 [Roseovarius nubinhibens ISM]
 gi|83836846|gb|EAP76143.1| hypothetical protein ISM_14795 [Roseovarius nubinhibens ISM]
          Length = 480

 Score =  124 bits (311), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/357 (14%), Positives = 99/357 (27%), Gaps = 21/357 (5%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNT-VCNQLKNDSSQH 102
              + A  G+                          +      D+       +     + 
Sbjct: 137 TGFASAESGSFPSSELADAATAPEGAGAVSQETGAAEDGAQTPDSERNEAEHMLPVVPEP 196

Query: 103 DGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM-D 161
             ++      KTV N     T+        E            A  ++   D        
Sbjct: 197 APKVTEPEPSKTVGNLAKNVTTNRLPSIGAETEAAQTETDTAEALPELAPTDLPAIEAHA 256

Query: 162 KNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQ 221
             F +      ++IV+   G S  G   A+   P  ++ A   N +     M   +  G 
Sbjct: 257 AEFDNPEGKPMVSIVLIDNGRSPIG-LEALAAFPYPLSFAVDPNSDGAAEAMARYRAAGF 315

Query: 222 EAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSN 281
           E ++                  L    +       ++           VM   G  L S+
Sbjct: 316 EVLI---------------LTDLPQGASAADTETTMQTLFAELPEAVAVMEGTGTGLQSS 360

Query: 282 KESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREK 340
           +E+AE +     + G             ++++A +  +P        D        IR  
Sbjct: 361 REAAEQLAPILKETGHGLLMFPKGLDTASKLIARE-GVPTATIFRDFDSDGQTATVIRRF 419

Query: 341 LKGLEEIA-RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSPSS 396
           L      A R  G  I +     E++  +  W  Q+ V  V++ P+S + K  +  +
Sbjct: 420 LDQGAFKASRLEGGVIMLGRLRAETVSALLIWGLQDRVSQVALAPVSAVLKAGNEDA 476


>gi|163746562|ref|ZP_02153920.1| hypothetical protein OIHEL45_14195 [Oceanibulbus indolifex HEL-45]
 gi|161380447|gb|EDQ04858.1| hypothetical protein OIHEL45_14195 [Oceanibulbus indolifex HEL-45]
          Length = 520

 Score =  123 bits (309), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/327 (11%), Positives = 89/327 (27%), Gaps = 39/327 (11%)

Query: 67  APIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSID 126
             +       +E+ ++ +  +        +         + +  SG  +          D
Sbjct: 225 TAVEAEASAPVEEPEAETTSEPEETVAASRPAIGTPAATLADRNSGVVI-----NRPGAD 279

Query: 127 SLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTG 186
                +  ++                +   V               +++V+   G S T 
Sbjct: 280 IATDGDAEIV--------------IEDPRPVVVNSIASEQVEGKPLMSVVLIDDGTSVTA 325

Query: 187 TQRAINLL---PANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT 243
               +  L   P  ++ A  S   +    ++  ++ G E +  +                
Sbjct: 326 GSAGLAALRSFPYPLSFAVDSGLPNAAERVEIYREAGFEVLAMV---------------D 370

Query: 244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDG 303
           L               +L R      V+    +    ++   + +    A+ G       
Sbjct: 371 LPQGAQPSDAETAFAATLDRIGPVVAVLEGTESGFQGSRALTDQVTDILAQSGHGLVTQD 430

Query: 304 SSPRNLTRVLAPKLNLPYMVADLYLDD-QVDRDKIREKLKGLEEIARTTGQAIGVAVAFD 362
                +   LA K  +P        D        IR  L      A   G  I +     
Sbjct: 431 KGLNTM-PKLARKAGVPADPVFRDFDSKDQTARVIRRFLDQAAFRAGQEGAVIMLGRLRP 489

Query: 363 ESIEVISQWLQQEHVRDVSVVPLSCLA 389
           +++  +  W  Q+ + DV++VP+S + 
Sbjct: 490 DTVSALLLWGLQDRINDVALVPISAVL 516


>gi|260426890|ref|ZP_05780869.1| YibQ protein [Citreicella sp. SE45]
 gi|260421382|gb|EEX14633.1| YibQ protein [Citreicella sp. SE45]
          Length = 512

 Score =  123 bits (309), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 41/350 (11%), Positives = 91/350 (26%), Gaps = 18/350 (5%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD 103
           +  ++A     +           A   L          +P     +    + +       
Sbjct: 178 VAAANAPRRGEATSPVTEAPEAEASPELATETAAPPMPAPYGGATSEPEPEAEAIPEVVV 237

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN 163
                  S              D     +    +G                  +      
Sbjct: 238 LPQTGGESRPATGTPAGSLIGRDGTGPSDRLPRIGDDTAASADSTDGAGGLRPLDVFSAP 297

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
                    ++IV+   G S       +   P  ++ A + +        +  +++G E 
Sbjct: 298 SNLTPGEPHMSIVLIDDG-SGPLGPETVGEFPFPVSFAISPSHPDAIGAARAYREEGFEV 356

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +    M +  +                  +   L  +L       GV+   G  L +++ 
Sbjct: 357 LT---MASAPD------------GAQASDVEISLEGALGAVPEAIGVLEAPGDGLQASRA 401

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLK 342
            A+   +     G              + LA +  +P        D +  D   +R  L 
Sbjct: 402 IADQTARFLHASGHGLLMLPKGLNT-GQALALREGVPSATVFRDFDGEGQDPRVMRRFLD 460

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
                AR  G  + +     +++  +  W  Q+    V +VP+S + + S
Sbjct: 461 QAAFKARQEGPVVMLGRLRADTVSALLLWGLQDRASSVELVPVSAILRES 510


>gi|254486563|ref|ZP_05099768.1| YibQ protein [Roseobacter sp. GAI101]
 gi|214043432|gb|EEB84070.1| YibQ protein [Roseobacter sp. GAI101]
          Length = 469

 Score =  122 bits (306), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/341 (14%), Positives = 91/341 (26%), Gaps = 21/341 (6%)

Query: 54  ISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN-DISG 112
             E +         P+                +   TV  +     S+            
Sbjct: 139 EEETVAEEAPTVDVPVETADEAPQATPTEAQPKMPVTVIVEAAPKKSEVTAMPAPKMAKI 198

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGAR 172
            +        T     P    RL   LS +      +    +  +    + F +      
Sbjct: 199 PSANRTADADTDPRGAPVTVNRLPTALSGERTEEDPQQAASEGAISRYARPFENPDDKPL 258

Query: 173 IAIVVSGLGISQTGTQRAINLL---PANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
           + I++   G      +  I  L   P  I+ A   +       M   + +G E +  +  
Sbjct: 259 MGILLIDQGTDLEDGEVGIAALRNFPYPISFAIDVSLPDAANRMAIYRNEGFEVLAMV-- 316

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
                         L            L  +L R     GV+   G  L  ++  A+ + 
Sbjct: 317 -------------DLPEGAQASDAETTLAVALTRMPDVIGVLEGLGNGLQPDRGLADQVT 363

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIA 348
              A+ G            +   LA K  +P        D +      IR  L      A
Sbjct: 364 AILAQGGHGLVTQDKGLNTM-PKLAIKEGVPASAIFRDFDSKGQTATVIRRFLDQAAFKA 422

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              G  I +     E+I  +  W  Q+    V++ P+S + 
Sbjct: 423 GIEGSVIMMGRLRPETISALLVWGLQDRASQVALAPISAVL 463


>gi|149913761|ref|ZP_01902293.1| hypothetical protein RAZWK3B_17198 [Roseobacter sp. AzwK-3b]
 gi|149812045|gb|EDM71876.1| hypothetical protein RAZWK3B_17198 [Roseobacter sp. AzwK-3b]
          Length = 500

 Score =  122 bits (305), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 52/354 (14%), Positives = 98/354 (27%), Gaps = 19/354 (5%)

Query: 38  VGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKN 97
            G    +  + A     +   P     E A      P     + +  +            
Sbjct: 161 SGAFPGVGTAPAEAPADAAPEPEIAAPEPAAPETAEPETPAPEPAVPETARTEQPAPRTI 220

Query: 98  DSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV 157
            + +  G I N   G T    P+   + +             +      +         +
Sbjct: 221 GTGEPSGTIDNLAQGVTTDRLPSLRETPEDPAPEAAPEAGQGADSAQTPEAVDDTSRPAI 280

Query: 158 PAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAK 217
                 F +  +   ++IV+   G S  G   A+   P  I++A  ++     +     +
Sbjct: 281 ERFAVEFANPDNKPLMSIVLIDDGSSPIGPD-AVLDFPYPISMAVDASWPGALQRSGAYR 339

Query: 218 KKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAM 277
             G E +                   L    +       +   L+       VM   G  
Sbjct: 340 AAGFEVLA---------------ITDLPDGASAIDTEVAMETFLKAVPEAVAVMEAPGDA 384

Query: 278 LLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDK 336
           L +N++++E +     + G              + LA K  +P        D    D   
Sbjct: 385 LQANRDASEQMAAILLETGHGLVMFPDGLDT-AQKLAAKAGVPSATVFRDFDSAGQDDAA 443

Query: 337 IREKLKGLEEIARTTGQ-AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           IR  L      A       I V     ++I  +  W  Q+    V++ P+S L 
Sbjct: 444 IRRFLDQAAFRAGQEEVGVIMVGRLRPDTISALLLWGLQDRASRVALAPVSALL 497


>gi|259418547|ref|ZP_05742464.1| divergent polysaccharide deacetylase family [Silicibacter sp.
           TrichCH4B]
 gi|259344769|gb|EEW56623.1| divergent polysaccharide deacetylase family [Silicibacter sp.
           TrichCH4B]
          Length = 499

 Score =  119 bits (297), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 42/367 (11%), Positives = 95/367 (25%), Gaps = 38/367 (10%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD 103
            +++               +           L+ E + +P+    ++   +     +  +
Sbjct: 143 AIVNDPAAAPEVADSGEPALTAPEEETPAPELSQEAEDTPAPVRLDSAAVEAPGIGTPPN 202

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDT-------- 155
                +++   V +  T       L   +     G    E                    
Sbjct: 203 ATPSPNLTTPPVRSDETGENDTGELRIADLPQTAGDEGTEPGPSIGTRVVPLTERNKAAP 262

Query: 156 -----------EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFAS 204
                            +          ++I++  +         A+   P  +T A   
Sbjct: 263 ETDAEATPETPPFVRNAEPASPEPGVPLMSIIL--IEEEGAVGAEALEDFPYPLTFAIDP 320

Query: 205 NGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRG 264
           +       MK  +  G E ++                  L      Q     +     R 
Sbjct: 321 SDPDAVARMKARRAAGFEVMV---------------LADLPREGQPQDAETAMPVWFDRL 365

Query: 265 TGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVA 324
               G++    + +  N+  A+ +    A  G       +    + + +A +  +P  V 
Sbjct: 366 PEAVGILEGIDSGVQGNRPLADQVATIAADLGYGLVLQDNGLNTV-QKMALRDGIPSGVV 424

Query: 325 DLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
               D    D   +R  L      +   G  I +     ++I  +  W  Q+    V +V
Sbjct: 425 FRDFDGAGQDPRAMRRFLDQAAFRSGQEGAVIMLGRLKPDTISALLIWGLQDRASRVELV 484

Query: 384 PLSCLAK 390
           P+S   K
Sbjct: 485 PISTSLK 491


>gi|254463730|ref|ZP_05077141.1| Divergent polysaccharide deacetylase family [Rhodobacterales
           bacterium Y4I]
 gi|206684638|gb|EDZ45120.1| Divergent polysaccharide deacetylase family [Rhodobacterales
           bacterium Y4I]
          Length = 522

 Score =  118 bits (296), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/356 (13%), Positives = 93/356 (26%), Gaps = 30/356 (8%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                 E    +  ++ AP+P           +     +     Q              D
Sbjct: 184 PEQPAQEPDTAAQPQDAAPLPAVRHAPDTQAAAAVLAPDIGAAPQATTLPVIGAAPSVPD 243

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAK---------NKVGREDTEVPAM 160
            S            + ++         +G     L  +              ++    A 
Sbjct: 244 ASAGDEALPSEAVPAAEAPQQEALAPRIGTPVVPLTDRDDAQEIAVAAAQPLDNPPFQAF 303

Query: 161 DKNFCSNASGARIAIV-VSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
            + F +  +   ++IV +   G        A+   P  ++ A        +  M   +  
Sbjct: 304 SEPFHNLENRPLMSIVLIDDAG---AVGAEALAAFPYPLSFAIDPGDPDSEAKMAARRAA 360

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           G E ++                  L    T Q     L     R      ++      + 
Sbjct: 361 GFEVLM---------------LADLPRAATPQDAEMALEVWRSRVPEAVAILEGVETGVQ 405

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIR 338
            N+  A+ +    A  G       S    + + LA +  +P  V     D        IR
Sbjct: 406 GNRPLADQVAAMAASAGYGLVTQNSGLNTV-QRLALRDGVPAGVVFRDFDGAGQTPRAIR 464

Query: 339 EKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
             L      A   G  I +     ++I  +  W  ++    V++ P+S   +   P
Sbjct: 465 RFLDQAAFRAGQEGSVIMLGRLRPDTISALLIWGLEDRAARVALAPVSASLEAQLP 520


>gi|114764292|ref|ZP_01443520.1| hypothetical protein 1100011001356_R2601_25206 [Pelagibaca
           bermudensis HTCC2601]
 gi|114543240|gb|EAU46257.1| hypothetical protein R2601_25206 [Roseovarius sp. HTCC2601]
          Length = 586

 Score =  118 bits (295), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 48/344 (13%), Positives = 93/344 (27%), Gaps = 28/344 (8%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                 E  P    +   P      +  ED          +  ++         G     
Sbjct: 266 PDAPQDEAAPEVSTQTPTPPLPAPLVPGEDALPRVSTLPGSPTSETAGAGRPAIGTPAGS 325

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
           ++ +      +R  SI      E       +  EL    +                +   
Sbjct: 326 LADRGAGESASRLPSIGEAAPAEPTPAPEAAPSELSPLERYAV----------PTEAEDD 375

Query: 170 GARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPM 229
             R+AIV+   G    G    +   P  ++ A  ++        +  +  G E +     
Sbjct: 376 APRMAIVLIDDGTGPLGPD-TVGEFPFAVSFAIPASHPDAAATAQGYRDAGFEVLA---- 430

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
                         +        +   L  SL        VM   G  L + +  +E   
Sbjct: 431 -----------IAGVPEGAQATDVEVTLEGSLGAVPEAVAVMEAPGDGLQATRAISEQAA 479

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIA 348
           +     G                LA +  +P +      D +  D   +R  L      A
Sbjct: 480 QYLGASGHGLLMQPKGLNT-GEALARREAVPTVTVFRDFDGEGQDPRVMRRFLDQAAFKA 538

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           R  G  + +     +++  +  W  Q+    V++VP+S + + S
Sbjct: 539 RQEGAVVMLGRLRADTVSALLLWGLQDRASSVALVPISLVLRES 582


>gi|255264466|ref|ZP_05343808.1| YibQ protein [Thalassiobium sp. R2A62]
 gi|255106801|gb|EET49475.1| YibQ protein [Thalassiobium sp. R2A62]
          Length = 589

 Score =  117 bits (292), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/331 (11%), Positives = 91/331 (27%), Gaps = 18/331 (5%)

Query: 60  YSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP 119
              + E          +  + Q     +           S +    + +  +     +KP
Sbjct: 270 EPTVAETEGQDDPNEQDETNVQVAEAVNQELEGTPSDETSLEPQTNVDDLFASLVEPSKP 329

Query: 120 TRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSG 179
             + + D      E  +  L+  E    +        +      F +      +++V+  
Sbjct: 330 AGTPAGDLAKLAPEIKVNRLTDTETEDTSDADVSRNALVDYAIAFDNPDDKPLLSVVLID 389

Query: 180 LGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNED 239
            G    G   A+      +T+A  +   +    M+  +  G E ++              
Sbjct: 390 DGAGGLGPT-ALTSFTFPVTVAINAAQQNATELMQSYRDAGAEVMV-------------- 434

Query: 240 DSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLF 299
               +        L                V++        ++     + +  A RG   
Sbjct: 435 -LTNVPRGAQAADLEVAFEAYRTAVPEAVAVLDGGENGFQEDRALVSQVTEILASRGQGL 493

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVA 358
                   ++ + +A +  +   +    LD    D   IR  L      AR  G  + + 
Sbjct: 494 LTQAKGLNSV-QRVAQEAGVASALVFRDLDVAGQDARVIRRFLDQAAFTARQKGDVVVLG 552

Query: 359 VAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
               ++I  +  W   +    V + P+S + 
Sbjct: 553 RMRADTISALLLWGAGDRADQVELAPISAVL 583


>gi|126735659|ref|ZP_01751404.1| hypothetical protein RCCS2_17326 [Roseobacter sp. CCS2]
 gi|126714846|gb|EBA11712.1| hypothetical protein RCCS2_17326 [Roseobacter sp. CCS2]
          Length = 530

 Score =  116 bits (291), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 46/342 (13%), Positives = 89/342 (26%), Gaps = 26/342 (7%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A V   +E     V  E AP        +            T  +  + ++SQ    I  
Sbjct: 208 APVVDTAESNEAVVEVEPAPDAGESETVVAQDAVRPAGVPETTTDVAEENTSQQGTAIVA 267

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
           D    T                  E        +       + R        +       
Sbjct: 268 DALPPTNTAVRINRPGTTEEEPQPEIAEPAAVDEIADDAPALLRYGVPFDPAEA------ 321

Query: 169 SGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIP 228
             A I++++   G        A+  L    T+A  +  +       + +  G E      
Sbjct: 322 -TALISVILIDDGQ-MADAPAAVAELGFVATVAVNALSSVSTDLAADYRAAGVEVA---- 375

Query: 229 MQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVI 288
           MQA            L        +      +         + +  G   + ++     +
Sbjct: 376 MQAE-----------LPPGAQPTDVEVAFEAARGLVPEVAMLFSD-GTGAMQDRAVTAQV 423

Query: 289 FKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEI 347
            +  A  G  F        +     A +  +     +  +D    D+  I   L      
Sbjct: 424 MEILASDGYGFVTVQRGL-SNAARAADQAGVSAATIERDIDGAGEDQRMILRALDQAAFR 482

Query: 348 ARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
           AR TG A+ +     E++  +  W        + + P+S + 
Sbjct: 483 ARQTGTAVLLGRVTPETLAALRDWAADIDRETLEIAPVSAVL 524


>gi|213025716|ref|ZP_03340163.1| hypothetical protein Salmonelentericaenterica_26088 [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 158

 Score =  115 bits (289), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 20/99 (20%), Positives = 38/99 (38%), Gaps = 1/99 (1%)

Query: 294 KRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQ 353
              L F D  +   +     A    +  +   ++LDD  +   IR +     E+AR  G 
Sbjct: 2   HYNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRTIELARRNGS 61

Query: 354 AIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           AI +      ++ V+ Q + +    D+++V    L    
Sbjct: 62  AIAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 99


>gi|289806397|ref|ZP_06537026.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 176

 Score =  115 bits (288), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 38/98 (38%), Gaps = 1/98 (1%)

Query: 295 RGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQA 354
             L F D  +   +     A    +  +   ++LDD  +   IR +     E+AR  G A
Sbjct: 1   YNLYFLDSMTIGNSQAMRAASGTGVKVIKRKVFLDDTQNEADIRRQFNRTIELARRNGSA 60

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           I +      ++ V+ Q + +    D+++V    L    
Sbjct: 61  IAIGHPHPATVRVLQQMVYRLPA-DITLVRPGSLLNEP 97


>gi|46205339|ref|ZP_00048666.2| COG2861: Uncharacterized protein conserved in bacteria
           [Magnetospirillum magnetotacticum MS-1]
          Length = 143

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/130 (32%), Positives = 66/130 (50%)

Query: 261 LRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLP 320
           + R  G+ GV+N  GA L++   + + + K+ A RGL F DDG+ PR+     A K  LP
Sbjct: 1   MSRFPGFVGVVNAMGAKLMNEASALDPVLKDLAARGLGFVDDGTVPRSQLAGAAAKAKLP 60

Query: 321 YMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDV 380
              A+  +D     D I  +L  LE +AR  G  +    A   +I+ +S+W +    R V
Sbjct: 61  SARAESVIDAVARPDAIDAELTRLETLARQKGFVLASGSASPMTIDRLSRWSRDLETRGV 120

Query: 381 SVVPLSCLAK 390
            +VP+S   +
Sbjct: 121 RLVPVSVALR 130


>gi|99080983|ref|YP_613137.1| hypothetical protein TM1040_1142 [Ruegeria sp. TM1040]
 gi|99037263|gb|ABF63875.1| hypothetical protein TM1040_1142 [Ruegeria sp. TM1040]
          Length = 519

 Score =  114 bits (286), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/361 (11%), Positives = 87/361 (24%), Gaps = 34/361 (9%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD 103
              S   +      IP   +   A         ++ +        +   + +        
Sbjct: 171 SAASDLPLQAPDAEIPTPDLSTEADPAPLRQETLQVEAPDIGTPPDVTASPVLTTPPVRS 230

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDT-------- 155
               + +               D     E+                  R+ T        
Sbjct: 231 LTPSDPVEDNA--GANGGVRIADLPQASEDPETNAGPSIGTRVLPLTERDTTGADASSAA 288

Query: 156 -----EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
                      +          ++IV+  +         A+   P  +T     +     
Sbjct: 289 DSSAAPFVRNSEPANPEPGLPLMSIVL--VEEEGAVGAEALEDFPYPLTFTIDPSDPDAV 346

Query: 211 RWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGV 270
             MK  +  G E ++                  L      Q     +     R     G+
Sbjct: 347 ARMKARRAAGFEVMV---------------LADLPREGQPQDAETAMPVWFDRLPEAVGI 391

Query: 271 MNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDD 330
           +    + +  N+  A+ +       G       +    +   +A +  +P  V     D 
Sbjct: 392 LEGIDSGVQGNRALADQVASIAGDLGYGLVLQDNGLNTV-HKMALRDGIPSGVVFRDFDG 450

Query: 331 Q-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
              D   +R  L      +   G  I +     ++I  +  W  Q+    V++VP+S   
Sbjct: 451 AGQDPRAMRRFLDQAAFRSGQEGAVIMLGRLKPDTISALLIWGLQDRASSVALVPISTSL 510

Query: 390 K 390
           K
Sbjct: 511 K 511


>gi|261491697|ref|ZP_05988278.1| hypothetical protein COK_0131 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261312650|gb|EEY13772.1| hypothetical protein COK_0131 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 114

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 14/91 (15%), Positives = 37/91 (40%)

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
             + +    +++   +  S  +     G+ N+ G+   S+  + + + K   +  L F D
Sbjct: 4   GGIHIGDNEEKIRKLIHTSRGQVPYAIGLNNHMGSGATSDSATMQHLMKVLKENTLFFLD 63

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
             +   ++    A +  +  +  D++LDD  
Sbjct: 64  SKTIGSSVAAKTARQFGINTLERDIFLDDSD 94


>gi|221638404|ref|YP_002524666.1| YibQ protein [Rhodobacter sphaeroides KD131]
 gi|221159185|gb|ACM00165.1| YibQ protein [Rhodobacter sphaeroides KD131]
          Length = 477

 Score =  113 bits (283), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/322 (10%), Positives = 80/322 (24%), Gaps = 17/322 (5%)

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
               P   E    P         +             +  +  +                
Sbjct: 172 TAATPARSEGAARPGAPAAEADPSAADLPPPPPLTPEEEAMLAEAAGQPAPAEPRRIEPD 231

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                       +          E+  +    + F +       +I++   G      + 
Sbjct: 232 PPRAPSEASRLPRIGDPAPAAEEEEPPLRRYAQPFENPGRKPLFSILLQDTG-GPLLDRE 290

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           A+  LP  +T                 +  G E ++               +  L     
Sbjct: 291 ALAALPFPVTFVIDPQAPDAATAAGIYRAAGHEVLM--------------LASGLPEGAR 336

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
                  L  +        G+++         +  +  + +  A +G             
Sbjct: 337 PADAEVTLESAAAALPEAVGLIDLPAGGFQEARPLSTQVVEILAAQGRGLVTHDHGLNA- 395

Query: 310 TRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
              +A +  LP  V    LD  + D   +R  L      A   G+A+ +     E+++ +
Sbjct: 396 ADQVARREGLPAAVVFRRLDEGEADAASVRRALDRAAFKAAQDGRAMVLGDTRPETLKGL 455

Query: 369 SQWLQQEHVRDVSVVPLSCLAK 390
            +W  +     V++ P + L +
Sbjct: 456 MEWSLEGRADGVALAPATALLR 477


>gi|332557435|ref|ZP_08411757.1| YibQ protein [Rhodobacter sphaeroides WS8N]
 gi|332275147|gb|EGJ20462.1| YibQ protein [Rhodobacter sphaeroides WS8N]
          Length = 486

 Score =  112 bits (279), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/322 (10%), Positives = 80/322 (24%), Gaps = 17/322 (5%)

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
               P   E    P         +             +  +  +                
Sbjct: 181 TAATPARSEGAARPGAPAAEADPSAADLPPPPPLTPEEEAMLAEAAGEPAPAEPRRIEPD 240

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                       +          ++  +    + F +       +I++   G      + 
Sbjct: 241 PPRAPSEASRLPRIGDPAPAAEEKEPPLRRYAQPFENPGRKPLFSILLQDTG-GPLLDRE 299

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           A+  LP  +T                 +  G E ++               +  L     
Sbjct: 300 ALAALPFPVTFVIDPQAPDAATAAGIYRAAGHEVLM--------------LASGLPEGAR 345

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
                  L  +        G+++         +  +  + +  A +G             
Sbjct: 346 PADAEVTLESAAAALPEAVGLIDLPAGGFQEARPLSTQVVQILAAQGRGLVTHDHGLNA- 404

Query: 310 TRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
              +A +  LP  V    LD  + D   +R  L      A   G+A+ +     E+++ +
Sbjct: 405 ADQVARREGLPSAVVFRRLDEGEADAASVRRALDRAAFKAAQDGRAMVLGDTRPETLKGL 464

Query: 369 SQWLQQEHVRDVSVVPLSCLAK 390
            +W  +     V++ P + L +
Sbjct: 465 MEWSLEGRADGVALAPATALLR 486


>gi|110680390|ref|YP_683397.1| hypothetical protein RD1_3208 [Roseobacter denitrificans OCh 114]
 gi|109456506|gb|ABG32711.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 648

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 52/355 (14%), Positives = 106/355 (29%), Gaps = 22/355 (6%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD 103
            ++         E             P          Q           + +    +   
Sbjct: 310 AILPDDSADAQVEADQSVAAPLDVAAPENTVAAPLSIQPAPAPSTAPPLDAVALADTAAL 369

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDT--EVPAMD 161
                D   ++   +  R   + +L    ++   G  ++        G E          
Sbjct: 370 LPDTEDAPVESRSGQDVRVNQLPTLGAAPQQEGAGGPERTAQEPETAGPEAALTPFARFA 429

Query: 162 KNFCSNASGARIAIVVSGLG---ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKK 218
             F +  +   +A+V+   G    S T    A+N LP  +T A  +        MK  + 
Sbjct: 430 TGFENPDAKPLMAVVLMDTGRDLSSATVGLAALNALPFPVTFAVDALRPDAAARMKAYRD 489

Query: 219 KGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAML 278
            G E +  +                L    T       L  +L+      GV+      +
Sbjct: 490 AGFEVLATV---------------DLPAGATAADAEVNLSVALQAVPEALGVLEGVETGV 534

Query: 279 LSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKI 337
            ++ ++   + +  A+ G  F        ++ + LA +  +P  V    LD +      I
Sbjct: 535 QTSADAGRQVARILAQTGHGFVTQNRGLNSI-QKLAAREGVPSGVVFRDLDAEGQSSLLI 593

Query: 338 REKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           R  L      A   G  I +    +E++  + +W  Q+    V++ P+S +  + 
Sbjct: 594 RRFLDQAAFRAAQEGDVIMLGRVSEETLAALMKWTLQDRASTVAMAPVSAVLAIR 648


>gi|149203714|ref|ZP_01880683.1| hypothetical protein RTM1035_06598 [Roseovarius sp. TM1035]
 gi|149142831|gb|EDM30873.1| hypothetical protein RTM1035_06598 [Roseovarius sp. TM1035]
          Length = 477

 Score =  111 bits (277), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/324 (13%), Positives = 94/324 (29%), Gaps = 23/324 (7%)

Query: 73  IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVN-KPTRSTSIDSLPTI 131
                     P   D   V +      +Q +     +   +TV    P   T  +    +
Sbjct: 169 PSEEPAPVLIPDATDGEGVADLSPEAEAQAEVAPVPEADAETVAKTLPALGTIGNRAEGV 228

Query: 132 EERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG---ARIAIVVSGLGISQTGTQ 188
               +  L          +   +    A+ +N  +  +      +AI++   G S  G  
Sbjct: 229 TTNRLPSLGDPAPEVAEAIAEPEAAEGALVRNRVAFDNPEGKPLMAIILMDDGQSPIG-I 287

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
            A+   P  +  A     +      +  +  G E +                   L    
Sbjct: 288 EALQSFPYPLNFAVDVTWSGAADAAERYRAAGFEVLAMA---------------DLPEGA 332

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
             +     ++    +      V+   GA L S++E+   +     + G       +    
Sbjct: 333 RPEDAEVAMQAWFTQVPQAVAVLEGAGAGLQSSREATAQLAPILKESGHGLVMHPNGLNT 392

Query: 309 LTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIA-RTTGQAIGVAVAFDESIE 366
             +++A +  +P        D Q  +   IR  L      A +     I +     ++I 
Sbjct: 393 AQKLIARE-GVPSASLFRDFDGQGQNVAAIRRFLDQAAMRADQQEDGVIMLGRLRADTIS 451

Query: 367 VISQWLQQEHVRDVSVVPLSCLAK 390
            +  W   +    V++ P+S + +
Sbjct: 452 ALLLWGLADRAASVALAPVSAVLR 475


>gi|163731984|ref|ZP_02139430.1| hypothetical protein RLO149_00997 [Roseobacter litoralis Och 149]
 gi|161394282|gb|EDQ18605.1| hypothetical protein RLO149_00997 [Roseobacter litoralis Och 149]
          Length = 636

 Score =  110 bits (274), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 52/409 (12%), Positives = 113/409 (27%), Gaps = 43/409 (10%)

Query: 11  KKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIP 70
           +K+ ++    +   ++     +       +S     S    G      P    R   P  
Sbjct: 244 QKSAQQPPEVAPAPTQPAQTAVVSNAPDLVSPQADHSVDTTGAEGLQKPEPQRRATLPGD 303

Query: 71  LTIPLNIED----KQSPSKRDNNTVCNQL---KNDSSQHDGQIQNDISGKTVVNKPTRST 123
                   D      +      NTV   L         +   ++      +         
Sbjct: 304 SADAQVDADQSVEAPARVALPENTVAVPLSIKPVPMPSNVQPLEGVALADSAAMVSETPA 363

Query: 124 SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS-------------- 169
                 + ++  +  L       +    +         +     A+              
Sbjct: 364 PPAKARSGQDVRVNQLPSLGAAPQEVETKTPDGTAPEPETIAPEAALTPFEMFATDFENP 423

Query: 170 --GARIAIVVSGLG---ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAI 224
                +A+V+   G    S      A+  LP  ++ A  +        MK  ++ G E +
Sbjct: 424 DAKPLMAVVLMDTGSDLTSGAAGLAALKQLPFPVSFAVDALRPDAAARMKAFREAGFEVL 483

Query: 225 LQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKES 284
             +                L    T       L  +L+      GV+      + +  ++
Sbjct: 484 AAVN---------------LPSGATAADAEVNLSVALQTLPEVLGVLEGVDTGVQTTVDA 528

Query: 285 AEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKG 343
              + +  A+ G  F         + + LA +  +P  V     D +      IR  L  
Sbjct: 529 GRQVARILAQTGHGFVTQNRGLNTV-QKLAAREGVPSGVVFRDFDAEDQSALLIRRFLDQ 587

Query: 344 LEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
               A   G+ I +    +E++  + +W  Q+    V++ P+S +  + 
Sbjct: 588 AAFRAAQEGEVIMLGRMREETLAALMKWTLQDRASTVAMAPVSAVLAIR 636


>gi|126461484|ref|YP_001042598.1| protein of unknown function DUF610, YibQ [Rhodobacter sphaeroides
           ATCC 17029]
 gi|126103148|gb|ABN75826.1| protein of unknown function DUF610, YibQ [Rhodobacter sphaeroides
           ATCC 17029]
          Length = 477

 Score =  109 bits (273), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 35/322 (10%), Positives = 80/322 (24%), Gaps = 17/322 (5%)

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
               P   E    P         +             +  +  +                
Sbjct: 172 TAATPARSEGAARPGAPAAEADPSAADLPPPPPLTPEEEAMLAEAAGEPAPAEPRRIETD 231

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                       +          E+  +    + F +       +I++   G      + 
Sbjct: 232 PPRAPSEASRLPRIGDPAPAAEEEEPPLRRYAQPFENPGRKPLFSILLQDTG-GPLLDRE 290

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           A+  LP  +T                 +  G E ++               +  L     
Sbjct: 291 ALAALPFPVTFVIDPQAPDAATAAGIYRAAGHEVLM--------------LASGLPEGAR 336

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
                  L  +        G+++         +  +  + +  A +G             
Sbjct: 337 PADAEVTLESAAAALPEAVGLIDLPAGGFQEARPLSTQVVEILAAQGRGLVTHDHGLNA- 395

Query: 310 TRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
              +A +  LP  V    LD  + D   +R  L      A   G+A+ +     E+++ +
Sbjct: 396 ADQVARREGLPSAVVFRRLDEGEADAAAVRRALDRAAFKAAQDGRAMVLGDTRPETLKGL 455

Query: 369 SQWLQQEHVRDVSVVPLSCLAK 390
            +W  +     V++ P + L +
Sbjct: 456 MEWSLEGRADGVALAPATALLR 477


>gi|58038808|ref|YP_190772.1| hypothetical protein GOX0333 [Gluconobacter oxydans 621H]
 gi|58001222|gb|AAW60116.1| Hypothetical protein GOX0333 [Gluconobacter oxydans 621H]
          Length = 266

 Score =  109 bits (272), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 42/257 (16%), Positives = 89/257 (34%), Gaps = 22/257 (8%)

Query: 139 LSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANI 198
           ++++ L          +   +        A    IAIV+ G G S   T   ++ +PA +
Sbjct: 1   MTQQALPPVVSSAASPSPQASAPLPTDKTA----IAIVLQGFGYSDALTYDVLSRIPAPV 56

Query: 199 TLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLR 258
            +  +   +++   +  A    +E  + +PMQ+      ++  + L    +       L 
Sbjct: 57  AVGISPYVSNISDIIARAHASHREVYVTLPMQSAHPERVDEGPHALGYGNSAADDQRELE 116

Query: 259 YSLRRGTGYFGVMNY-------RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTR 311
           + L R  G  G+ +         G    ++ +    I    + +GLL+            
Sbjct: 117 WCLSRAAGAEGLTDASENGDDQPGGGYATSPD-FSPIASAISSKGLLYL---------AG 166

Query: 312 VLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLE-EIARTTGQAIGVAVAFDESIEVISQ 370
                     M A  ++D   D   +  +L  L  +  +     + V       I+ ++ 
Sbjct: 167 SAQDGRRTRGMTATAWIDGDTDAATLDSRLAALLPQDGKPAKILLMVGPITPVMIDRLAN 226

Query: 371 WLQQEHVRDVSVVPLSC 387
           WL+    ++  VVP S 
Sbjct: 227 WLKGPAAQNFVVVPPSA 243


>gi|85703589|ref|ZP_01034693.1| hypothetical protein ROS217_22647 [Roseovarius sp. 217]
 gi|85672517|gb|EAQ27374.1| hypothetical protein ROS217_22647 [Roseovarius sp. 217]
          Length = 481

 Score =  107 bits (267), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/329 (12%), Positives = 92/329 (27%), Gaps = 27/329 (8%)

Query: 64  REIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRST 123
            E  P P+ IP   +                                 G T+ N+    T
Sbjct: 176 PEEEPAPVLIPEASDGDDMTDMSPEAEAQAATATAPEDETVSKTLPALG-TIGNRADGVT 234

Query: 124 SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGIS 183
           +       +    +  + + +  +  + R        +           +AI++   G S
Sbjct: 235 TNRLPSLADPAPEVEAAVEPVTQEGALARNRVAFDNPE-------GKPLMAIILMDDGKS 287

Query: 184 QTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT 243
             G   A+   P  +  A            +  +  G E +                   
Sbjct: 288 PIG-LEALQSFPYPLNFAVDVGWPGAAAAAERYRAAGFEVLAM---------------TD 331

Query: 244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDG 303
           L      +     ++    +      V+   G  L S++E++  +     + G       
Sbjct: 332 LPEGARPEDAEVAMQAWFAQVPQAVAVLEGTGTGLQSSREASAQLAPILKESGHGLVMHP 391

Query: 304 SSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIA-RTTGQAIGVAVAF 361
           +      +++A +  +P        D +  +   IR  L      A +     I +    
Sbjct: 392 NGLNTAQKLIARE-GVPSASLFRDFDGEGQNAAAIRRFLDQAAMKADQQEEGVIMLGRMR 450

Query: 362 DESIEVISQWLQQEHVRDVSVVPLSCLAK 390
            ++I  +  W  Q+    V++ P+S + +
Sbjct: 451 ADTISALLLWGLQDRAASVALAPVSAVLR 479


>gi|4185554|gb|AAD09126.1| YibQ [Rhodobacter sphaeroides]
          Length = 266

 Score =  105 bits (263), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/257 (12%), Positives = 70/257 (27%), Gaps = 27/257 (10%)

Query: 134 RLILGLSKKELLAKNKVGREDTE----------VPAMDKNFCSNASGARIAIVVSGLGIS 183
           R I     +     +++ R              +    + F +       +I++   G  
Sbjct: 15  RRIEPDPPRAPSEASRLPRIGDPAPAAEEEEPPLRRYAQPFENPGRKPLFSILLQDTG-G 73

Query: 184 QTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYT 243
               + A+  LP  +T                 +  G E ++               +  
Sbjct: 74  PLLDREALAALPFPVTFVIDPQAPDAATAAGIYRAAGHEVLM--------------LASG 119

Query: 244 LKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDG 303
           L            L  +        G+++         +  +  + +  A +G       
Sbjct: 120 LPERARPADAEVTLESAAAALPEAVGLIDLPAGGFQEARPLSTQVVEILAAQGRGLVTHD 179

Query: 304 SSPRNLTRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFD 362
                    +A +  LP  V    LD  + D   +R  L      A   G+A+ +     
Sbjct: 180 HGLNA-ADQVARREGLPSAVVFRRLDEGEADAASVRRALDRAAFKAAQDGRAMVLGDTRP 238

Query: 363 ESIEVISQWLQQEHVRD 379
           E+++ + +W  +     
Sbjct: 239 ETLKGLMEWSLEGRADG 255


>gi|254440542|ref|ZP_05054036.1| Divergent polysaccharide deacetylase family [Octadecabacter
           antarcticus 307]
 gi|198255988|gb|EDY80302.1| Divergent polysaccharide deacetylase family [Octadecabacter
           antarcticus 307]
          Length = 488

 Score =  103 bits (258), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 46/338 (13%), Positives = 93/338 (27%), Gaps = 18/338 (5%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
           E     V  + A     + L      +P   D+           +      +  +  + +
Sbjct: 168 EPTALEVPVQPANDTFVVDLGANSDTAPEGLDDVAADPPADEGLAAVVPSEEPPVVPRLL 227

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAI 175
           +     +   + +  +  R  L         + +   +   +           S   ++I
Sbjct: 228 LQGGGNTLLSERVSGVTVRRPLEDEAVAAQGETEAATQMNALVDFAAASGDVGSKPLLSI 287

Query: 176 VVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDES 235
           V+   G S +    A+  L   +T+A     +     M   +  G E  +          
Sbjct: 288 VLIDDG-SMSAAAAALAGLSFPVTIALDPGQDDARALMAMYRDDGFEVAV---------- 336

Query: 236 YNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKR 295
                   L        +                V++     L S++  A+      A +
Sbjct: 337 -----LAKLPKGALPSDVEITFESVFSTLPESIAVLDIGNGGLHSDRNLADQAMNILASQ 391

Query: 296 GLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQA 354
           G  F   G     +    A +  +P  V    LD    D   +R  +      AR     
Sbjct: 392 GRGFVTVGQGLN-MAGRAAEQAGVPVAVVFRDLDSDGQDARVVRRFVDQAAFRARQESGV 450

Query: 355 IGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           + V     ++I  +  W        V++VPLS +    
Sbjct: 451 VLVGRVRADTISALILWGSANQDEQVAIVPLSAILNAQ 488


>gi|146279130|ref|YP_001169289.1| protein of unknown function DUF610, YibQ [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145557371|gb|ABP71984.1| protein of unknown function DUF610, YibQ [Rhodobacter sphaeroides
           ATCC 17025]
          Length = 474

 Score =  103 bits (258), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/330 (10%), Positives = 84/330 (25%), Gaps = 19/330 (5%)

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
            +     +  T    +   ++            L  +      +                
Sbjct: 163 SLAAPVRLEGTAQPGVPAAEADPAAAELPPPPPLTPEEEAMLAEAAGITDPARPRMIEAD 222

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLG 181
                +  +   R+       ++    +            + F +       A+++   G
Sbjct: 223 PPRTTADGSRLPRIGDPDPTTQVTVAPETDLPPIR--RYARPFENPMQKPLFAVLLRDTG 280

Query: 182 ISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDS 241
                 + A+  LP  +T                 +  G E ++               +
Sbjct: 281 -GPALDREALAGLPFPVTFVIDPQEPGATTAAAMYRAAGHEVLM--------------LA 325

Query: 242 YTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFD 301
             L    T       L  +        G+++         +  A  +      +G     
Sbjct: 326 TGLPEGATAADAEVMLESAALAVPEAVGMIDLPSGGFQEARTLATQVVGILEAQGRGLVT 385

Query: 302 DGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVA 360
                      +A + +LP  V    LD +  +  +IR  L      A   G+       
Sbjct: 386 HDRGLNA-ADQVARRQSLPAAVVFRSLDAEGANAAEIRRVLDRAAFKAAQEGRVAVYGDT 444

Query: 361 FDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
             E+++ + +W  +     V++ P++ L +
Sbjct: 445 RPETVQGLLEWTVEGRADAVALAPVTALMR 474


>gi|48243708|gb|AAT40823.1| hypothetical protein [Haemophilus influenzae]
          Length = 127

 Score =  103 bits (256), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 17/91 (18%), Positives = 38/91 (41%), Gaps = 1/91 (1%)

Query: 300 FDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAV 359
            D  +  +++   +A +  +  +   ++LDD  +   ++ + K     AR  G AI +  
Sbjct: 1   LDSRTIGKSVAGKIAKEQGVRSLDRHIFLDDSNEFADVQRQFKAAIHYARKHGSAIAIGH 60

Query: 360 AFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
               +I V+   L      D+ +V +  L +
Sbjct: 61  PRANTIAVLQAGLNNLPE-DIQLVGMGNLWR 90


>gi|89054372|ref|YP_509823.1| hypothetical protein Jann_1881 [Jannaschia sp. CCS1]
 gi|88863921|gb|ABD54798.1| protein of unknown function DUF610 YibQ [Jannaschia sp. CCS1]
          Length = 575

 Score =  100 bits (250), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 42/344 (12%), Positives = 85/344 (24%), Gaps = 23/344 (6%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
           E     V  E   +PL  P+           +                  +         
Sbjct: 248 EETLAIVDPEPEIVPLPTPVFPSIGDQALSEEETATGAPDLPADIGDAPSLSRPAEDVAA 307

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK----VGREDTEVPAMDKNFCSNASGA 171
           +  P    +                ++ L  ++     +G       A    F       
Sbjct: 308 LPTPAFPQTSGLPQVAIPMEREAEVEEPLPEEDPAPVDLGDLPAI-QAFAAPFDGAGDRP 366

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQA 231
            +A+V+     SQ      +      +  A               ++ G E ++   M  
Sbjct: 367 LMAVVLIDEPESQI-DIETLTRFTFPVAFAVDPLHPDGAARAAAYREAGFEVVILGAMVP 425

Query: 232 FDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKE 291
              +  +                  L  +L        V++     +  ++   + +   
Sbjct: 426 DGATAVDT--------------EVALMAALADLPEAVAVIDTPEGRIQGDRPVLDAMVGA 471

Query: 292 FAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK-IREKLKGLEEIART 350
            A  G                 A +  +P      YLD + +R   I   L      A  
Sbjct: 472 LADSGHGLVAFPRGLNA-AEQSASRAGVPGATVFRYLDGEDERATVITRFLSRAAFAAAQ 530

Query: 351 TGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSC-LAKLSS 393
            G  + V     +++  +  W        V++ PLS  L + +S
Sbjct: 531 EGTVVVVGRTRPDTVTALFSWALGGRSEAVALAPLSATLLRAAS 574


>gi|77462550|ref|YP_352054.1| YibQ protein [Rhodobacter sphaeroides 2.4.1]
 gi|77386968|gb|ABA78153.1| YibQ protein [Rhodobacter sphaeroides 2.4.1]
          Length = 477

 Score = 99.8 bits (247), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/311 (10%), Positives = 73/311 (23%), Gaps = 17/311 (5%)

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
               P   E    P         +             +  +  +                
Sbjct: 172 TAATPARSEGAARPGAPAAEADPSAADLPPPPPLTPEEEAMLAEAAGEPAPAEPRRIEPD 231

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQR 189
                       +          E+  +    + F +       +I++   G      + 
Sbjct: 232 PPRAPSEASRLPRIGDPAPAAEEEEPPLRRYAQPFENPGRKPLFSILLQDTG-GPLLDRE 290

Query: 190 AINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQT 249
           A+  LP  +T                 +  G E ++               +  L     
Sbjct: 291 ALAALPFPVTFVIDPQAPDAATAAGIYRAAGHEVLM--------------LASGLPERAR 336

Query: 250 VQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNL 309
                  L  +        G+++         +  +  + +  A +G             
Sbjct: 337 PADAEVTLESAAAALPEAVGLIDLPAGGFQEARPLSTQVVEILAAQGRGLVTHDHGLNA- 395

Query: 310 TRVLAPKLNLPYMVADLYLD-DQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVI 368
              +A +  LP  V    LD  + D   +R  L      A   G+A+ +     E+++ +
Sbjct: 396 ADQVARREGLPSAVVFRRLDEGEADAASVRRALDRAAFKAAQDGRAMVLGDTRPETLKGL 455

Query: 369 SQWLQQEHVRD 379
            +W  +     
Sbjct: 456 MEWSLEGRADG 466


>gi|237802214|ref|ZP_04590675.1| hypothetical protein POR16_25589 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331025071|gb|EGI05127.1| hypothetical protein POR16_25589 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 127

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/108 (19%), Positives = 43/108 (39%), Gaps = 7/108 (6%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
             S A +++++  LG +     R    LP  +TLA   +      + ++  + G+  +L 
Sbjct: 27  KPSKAYLSLIIDDLGQNADRDSRT-LALPGPVTLAIMPDTPHATDFARQVHRAGKTVMLH 85

Query: 227 IPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYR 274
           +PM            Y       + +L +RL  +L +     G+ N+ 
Sbjct: 86  MPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAGINNHM 127


>gi|126726376|ref|ZP_01742217.1| hypothetical protein RB2150_01709 [Rhodobacterales bacterium
           HTCC2150]
 gi|126704239|gb|EBA03331.1| hypothetical protein RB2150_01709 [Rhodobacterales bacterium
           HTCC2150]
          Length = 426

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 52/350 (14%), Positives = 112/350 (32%), Gaps = 37/350 (10%)

Query: 64  REIAPIPLTIPLNIEDKQSPSKRDNNT-VCNQLKNDSSQHDGQIQNDISGKTVVNKPTRS 122
            + A +P     +  D  +P+  DN T     +K  S + D       SG        R 
Sbjct: 92  TQSAAVPEVTLDSPSDMPAPNVNDNETFASGPVKLPSEEGDVPFLLGTSGAATEEPAPRL 151

Query: 123 TSIDSLP---------TIEERLILGLSKKELLAKNKVG----------REDTEVPAMDKN 163
             ID+                + +G+  + L+++++             +   +      
Sbjct: 152 IQIDTATDDAPALNTEPAAPSIAIGVPVEPLVSQSQTPTAPVVEEAAAADPRALVRNAVK 211

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F +      ++I++      QT     ++     +T A   N        +     G E 
Sbjct: 212 FENPDDKPLVSIILI-TPPDQTLAATLLDAFSFPVTFAVDPNDPQAAERAQIYHDAGFEV 270

Query: 224 ILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKE 283
           +                +  ++   T Q +   L  S+       GV++    +L S+++
Sbjct: 271 VF--------------LANGIQTGATAQDVEVALEASIGMVPVAVGVLDTTEGVLNSSRD 316

Query: 284 SAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDK-IREKLK 342
                 ++F+  G             +R  A KL++        LD + +    I+  L 
Sbjct: 317 IQAQTAEKFSITGHGLISYEGGLNGSSRE-ADKLDVKNTSVFRVLDAEGEAANLIKRYLS 375

Query: 343 GLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
                A   G  + V      +++ + +W   E   ++ + P+S +  L 
Sbjct: 376 RAAFRAGQAGDVVVVGQTNANTLQAVIEWSLDERPDEIVLAPISAVLSLP 425


>gi|84686959|ref|ZP_01014842.1| hypothetical protein 1099457000244_RB2654_01595 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664933|gb|EAQ11414.1| hypothetical protein RB2654_01595 [Rhodobacterales bacterium
           HTCC2654]
          Length = 461

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 45/359 (12%), Positives = 94/359 (26%), Gaps = 35/359 (9%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIP----LNIEDKQSPSKRDNNTVCNQLKNDSSQHDG 104
                +             P     P        +  +P   D       +    S    
Sbjct: 117 DPEPMVEAEPETVSEAAPVPAVSDTPDEDLAEAPEADAPKATDTEVAQLPMVIAPSNPTE 176

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELL-------------AKNKVG 151
                        +   ++  D  P  ++ L        ++                   
Sbjct: 177 PDVAMPETGNDTVRAEGASVFDPPPLEDDTLEEPAPSGPVVTGRLPTIGESAADEAAVDA 236

Query: 152 REDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDR 211
                +      +   A    +A+++  +G  +      + ++P  +++A  ++      
Sbjct: 237 GPQPAIRRNAVPYDGIAELPEMAVLLMDMGPGREDVGD-LAVMPFPMSVAVDASSPDAAE 295

Query: 212 WMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVM 271
            +   +  G E +L +P+              L     V          +        VM
Sbjct: 296 AIAFYRANGAEVVLIVPL------------PELATAMDVDVTFQAYDPLMTDI---VAVM 340

Query: 272 NYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ 331
               A      ++A  +     +RGL               +A   ++P       LD  
Sbjct: 341 FPPEAGFQGLGDAAAQVVTNLDERGLGLVTYPEGLNT-GHKVAVSEDVPAGQIFRDLDGD 399

Query: 332 -VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
               D +R  L  +   AR     I VA    ESI+ + +W      + V+  P+S + 
Sbjct: 400 GQAGDVMRRFLDNVAFRARNDDGVIAVARVRPESIQALLEWSLGNRAQSVNFAPVSAVL 458


>gi|84503093|ref|ZP_01001189.1| hypothetical protein OB2597_01432 [Oceanicola batsensis HTCC2597]
 gi|84388637|gb|EAQ01509.1| hypothetical protein OB2597_01432 [Oceanicola batsensis HTCC2597]
          Length = 779

 Score = 93.6 bits (231), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 53/345 (15%), Positives = 95/345 (27%), Gaps = 23/345 (6%)

Query: 54  ISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
                  + +   AP   T       + S    ++    + +  D        +      
Sbjct: 454 EDPSATVAGLAPDAPASATQTDEAAPRPSAPVTEDPVTEDPVTEDPGLAQRAARTAPDSG 513

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK---NFCSNASG 170
            V  +P               ++           +     +   P +D+    F + A  
Sbjct: 514 AVDPRPAMPGEPALRLVETAPVVPLSDPDAAPDASAGAAPEAVGPPIDRFAQPFDNPADM 573

Query: 171 ARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQ 230
             ++IV+   G             P  +++A           M+  ++ G E +      
Sbjct: 574 PLVSIVLIDDGRGDASLP---ADFPYPLSIAIPVTRPDAPEAMRRYREGGYEVLA----- 625

Query: 231 AFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFK 290
                        +    T   L         R     GV+   G  L S +   E +  
Sbjct: 626 ----------LAGVPAGATPADLEAAAGDWFTRLDQVVGVIETPGRGLQSGRAMGERLAA 675

Query: 291 EFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIAR 349
              + G              R LA +  +P       LD +      IR  L      A 
Sbjct: 676 ILEESGHGLLLFPEGLDT-ARKLATRRGVPAATVFRDLDSEGQSATVIRRFLDNSAFKAG 734

Query: 350 TTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLSSP 394
             GQ I VA    E+IE +  W   +    V++ P+S   K ++P
Sbjct: 735 IEGQVILVARLRPETIEALLVWGLADRAGRVALAPVSHALKAAAP 779



 Score = 39.7 bits (91), Expect = 0.80,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 30/127 (23%), Gaps = 2/127 (1%)

Query: 48  HAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
                      P + + E A      P   E   +      +    + +  +        
Sbjct: 354 EEPAPERPAPGPVAGVEEPASGEPASPPVAEAGDAARDAPASATIAEWRESAPDAPAPAS 413

Query: 108 NDISGKTVVNKPTRSTSIDS--LPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
           +  SG  V      + + ++   P     +    S++                A      
Sbjct: 414 DASSGAPVPPAAGTAPASEAGDAPLAAPSVQGTDSQEAADEDPSATVAGLAPDAPASATQ 473

Query: 166 SNASGAR 172
           ++ +  R
Sbjct: 474 TDEAAPR 480


>gi|294677878|ref|YP_003578493.1| hypothetical protein RCAP_rcc02356 [Rhodobacter capsulatus SB 1003]
 gi|294476698|gb|ADE86086.1| conserved hypothetical protein [Rhodobacter capsulatus SB 1003]
          Length = 497

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 45/359 (12%), Positives = 83/359 (23%), Gaps = 42/359 (11%)

Query: 52  GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
              +E         I   P   P        P           L          I    S
Sbjct: 128 PPQAEPAMPLPPSVITAAPDLPPAETAPAPVPGGEITLMPDGALVPPGPVRPRVIVPGQS 187

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD---------- 161
           G           S +         +    +   +  + V         +           
Sbjct: 188 GSGQGGPGAGFASAEGTKVNRLPQVGSAPQGSSVPPSGVPVTPFVADPVPPAAAPAPEAT 247

Query: 162 --------KNFCSNASGARIAIVVSGLGISQTGTQRA-INLLPANITLAFASNGNSLDRW 212
                     F        + +++  +G +  G     I  L   +T+        +   
Sbjct: 248 GPALTRFGAAFVEKPGKPYVTVLLVDVGTTAGGLDAQTIAALGNWVTVVLDPAAPGVTEA 307

Query: 213 MKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMN 272
            +  +  G E  +               +  L      Q L   L    R       ++ 
Sbjct: 308 AESYRAAGLEVAM--------------LAGPLPAGAVAQDLEVALAAWQRAVPQAVALVE 353

Query: 273 YRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLN-LPYMVADLYLDDQ 331
               +L           K  A  G+ +            + A     +P       LD +
Sbjct: 354 PETPVLQGKAPLLAQAEKALAAEGMAYVTQP------GGIGARATGDVPRAGIFRVLDTR 407

Query: 332 VDRDK-IREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLA 389
            D+   I   L      A   G  + +  A+ ES+  ++ W  +      ++ PLS L 
Sbjct: 408 RDKAAVITRTLDRAGFEAARDGATVVMLSAWPESVAGLTAWAAE-EGAKYNLAPLSALI 465


>gi|108809472|ref|YP_653388.1| hypothetical protein YPA_3481 [Yersinia pestis Antiqua]
 gi|108813949|ref|YP_649716.1| hypothetical protein YPN_3789 [Yersinia pestis Nepal516]
 gi|145601084|ref|YP_001165160.1| hypothetical protein YPDSF_3844 [Yersinia pestis Pestoides F]
 gi|229836174|ref|ZP_04456342.1| putative periplasmic protein [Yersinia pestis Pestoides A]
 gi|229839910|ref|ZP_04460069.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229841992|ref|ZP_04462147.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229904479|ref|ZP_04519590.1| putative periplasmic protein [Yersinia pestis Nepal516]
 gi|270488478|ref|ZP_06205552.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|294502166|ref|YP_003566228.1| hypothetical protein YPZ3_0056 [Yersinia pestis Z176003]
 gi|108777597|gb|ABG20116.1| conserved hypothetical protein [Yersinia pestis Nepal516]
 gi|108781385|gb|ABG15443.1| conserved hypothetical protein [Yersinia pestis Antiqua]
 gi|145212780|gb|ABP42187.1| conserved hypothetical protein [Yersinia pestis Pestoides F]
 gi|229678597|gb|EEO74702.1| putative periplasmic protein [Yersinia pestis Nepal516]
 gi|229690302|gb|EEO82356.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229696276|gb|EEO86323.1| putative periplasmic protein [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229706622|gb|EEO92628.1| putative periplasmic protein [Yersinia pestis Pestoides A]
 gi|262360245|gb|ACY56966.1| hypothetical protein YPD4_0057 [Yersinia pestis D106004]
 gi|262364192|gb|ACY60749.1| hypothetical protein YPD8_0059 [Yersinia pestis D182038]
 gi|270336982|gb|EFA47759.1| conserved hypothetical protein [Yersinia pestis KIM D27]
 gi|294352625|gb|ADE62966.1| hypothetical protein YPZ3_0056 [Yersinia pestis Z176003]
          Length = 166

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 33/74 (44%), Gaps = 1/74 (1%)

Query: 322 MVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVS 381
           +   ++LDD  +   IR++      +AR  G AI +      +I+V+ Q L Q    D+ 
Sbjct: 2   IKRKIFLDDSQNEAAIRQQFNRAVALARRNGSAIAIGHPHPATIKVLQQMLPQLPA-DIV 60

Query: 382 VVPLSCLAKLSSPS 395
           +V  S L      S
Sbjct: 61  LVRPSALLNEPVQS 74


>gi|261415081|ref|YP_003248764.1| hypothetical protein Fisuc_0670 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261371537|gb|ACX74282.1| hypothetical protein Fisuc_0670 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302328102|gb|ADL27303.1| conserved domain protein [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 369

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/208 (16%), Positives = 77/208 (37%), Gaps = 15/208 (7%)

Query: 191 INLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTV 250
           +N L     L     G +   +    K   +E +L + M++   +   +  + L++  T 
Sbjct: 171 LNSLDFPFDLLIPPFGLNESFYKDLDKIHNKEIVLWLAMESTKLNQVHNKLHPLRIHHTA 230

Query: 251 QQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLT 310
           +Q+   +  + +      G+    G   + +K+  + I K   K  + F D     R + 
Sbjct: 231 EQIEETIDSAKKVLPSAAGIATRYGEQAVKHKQLLQAILKPTDKYNMWFMDLSKEDRTVV 290

Query: 311 RVLAPKLNL------PYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDES 364
                 L +      PY       ++    D + +KL+     A  +G +I +    +++
Sbjct: 291 PQTCKDLKITCKIAFPYNP-----ENSSVEDYVHQKLRE----APKSGISIMILPLTEQN 341

Query: 365 IEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +  I    ++   +  ++V LS L    
Sbjct: 342 LSKIEDIAKKAAKQGTTLVELSTLLNSK 369


>gi|254450366|ref|ZP_05063803.1| YibQ protein [Octadecabacter antarcticus 238]
 gi|198264772|gb|EDY89042.1| YibQ protein [Octadecabacter antarcticus 238]
          Length = 434

 Score = 90.1 bits (222), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 40/354 (11%), Positives = 90/354 (25%), Gaps = 33/354 (9%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT 114
           +   P  V+         I  +            +T    L       +    +  + + 
Sbjct: 98  TPAQPTVVVEPEVDESEIIADDPAVSDVAVPPSEDTFVVDLGAAPEGIEDAPTDQPADEV 157

Query: 115 VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN------- 167
           + +      +        +     L  +              V A ++   +        
Sbjct: 158 LASGTQSEDAPAIPRLQLQGGENTLLAERATGVTVRRPTGDAVAAPEETETTAQINALLD 217

Query: 168 --------ASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKK 219
                    S   ++IV+   G S +    A+  L   +T+A      +    M   +  
Sbjct: 218 FAATSGDDGSKPLMSIVLIDDG-SMSAAAAALAGLAFPVTIALDPLQENASALMARYRDD 276

Query: 220 GQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLL 279
           G E  +                  L        +                V++     L 
Sbjct: 277 GFEVAV---------------LAKLPEGAVPSDVEITFESVFSTLPETIAVLDIGNGGLQ 321

Query: 280 SNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQVDRDKIRE 339
           +++   + +    A +G  F         +    A +  +P  V    LDD     ++  
Sbjct: 322 THRAVTDQVMNVLASQGRGFVTMSQGLN-MAVRAAEQAGVPAAVVYTDLDDDDQDARVVR 380

Query: 340 KL-KGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAKLS 392
           +         R     + V     ++I  +  W        +++VPLS + +  
Sbjct: 381 RFVDQAAFRTRQESGVVLVGRMRPDTISALILWGSTSQDDQIAIVPLSAVLRAQ 434


>gi|261491696|ref|ZP_05988277.1| hypothetical protein COK_0130 [Mannheimia haemolytica serotype A2
           str. BOVINE]
 gi|261494459|ref|ZP_05990945.1| hypothetical protein COI_0247 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309843|gb|EEY11060.1| hypothetical protein COI_0247 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261312649|gb|EEY13771.1| hypothetical protein COK_0130 [Mannheimia haemolytica serotype A2
           str. BOVINE]
          Length = 101

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 35/79 (44%), Gaps = 1/79 (1%)

Query: 164 FCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA 223
           F      A++AIV+  +G  +    R I  LP  +++A            K+A  + ++ 
Sbjct: 21  FTPLVQAAQMAIVIDDVGY-RIKEDREILALPKAVSVAIIPVAPYATERAKDAYNQKRDI 79

Query: 224 ILQIPMQAFDESYNEDDSY 242
           ++ +PM+   +   E+  Y
Sbjct: 80  LIHLPMEPKSKQPIEEGGY 98


>gi|84515598|ref|ZP_01002960.1| hypothetical protein SKA53_03031 [Loktanella vestfoldensis SKA53]
 gi|84510881|gb|EAQ07336.1| hypothetical protein SKA53_03031 [Loktanella vestfoldensis SKA53]
          Length = 442

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 40/322 (12%), Positives = 86/322 (26%), Gaps = 18/322 (5%)

Query: 69  IPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSL 128
               I       Q   ++D   V        +  D   +   + +        ++   S 
Sbjct: 132 PDAPITPPQAPAQPAPEQDLPVVTLPAPVPPALQDTPAEPLPAPQVRPQTSPSASLPQST 191

Query: 129 PTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQ 188
             +                   G   + +     +F   A    IA+V+    +      
Sbjct: 192 ADVRVNRPRTAPAAGPEEPALDGDLASPLLRYAADFDYAADLPMIAVVLMDNALILDAPD 251

Query: 189 RAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQ 248
             ++ LP   T+   +    +   M+  +  G E +LQ                 L    
Sbjct: 252 -VLSGLPFVPTIVLNAAAADVTARMRAYRAAGIEVLLQA---------------DLPQGA 295

Query: 249 TVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRN 308
               +      +         + +        ++  A+   +     G  F         
Sbjct: 296 LPSDVETTYVGAFGLVPEAIAIFSDGTGPEAQDRMLADQALRLIGDEGRGFVTLPRGMGG 355

Query: 309 LTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEV 367
             R +     +P       +D     RD I   L+     AR +G  + +     E++  
Sbjct: 356 ALRNITAD-GVPVAQITRDIDGAGETRDAIERSLQQAALRARQSGHVVLLGRTTPETLAA 414

Query: 368 ISQWLQQEHVRDVSVVPLSCLA 389
           I  W ++     +S+ P+S + 
Sbjct: 415 IRNWAERSDPSQISLAPVSAIL 436


>gi|300983576|ref|ZP_07176668.1| conserved domain protein [Escherichia coli MS 200-1]
 gi|300306900|gb|EFJ61420.1| conserved domain protein [Escherichia coli MS 200-1]
          Length = 151

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 31/74 (41%), Gaps = 1/74 (1%)

Query: 319 LPYMVADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVR 378
           +  +   ++LDD  +   IR +     ++AR  G  I +      ++ V+ Q +      
Sbjct: 1   MKVIKRKVFLDDSQNEADIRVQFNRAIDLARRNGSTIAIGHPHPSTVRVLQQMVYNLPP- 59

Query: 379 DVSVVPLSCLAKLS 392
           D+++V  S L    
Sbjct: 60  DITLVKASSLLNEP 73


>gi|213852110|ref|ZP_03381642.1| hypothetical protein SentesT_04072 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 147

 Score = 84.4 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 324 ADLYLDDQVDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVV 383
             ++LDD  +   IR +     E+AR  G AI +      ++ V+ Q + +    D+++V
Sbjct: 1   RKVFLDDTQNEADIRRQFNRTIELARRNGSAIAIGHPHPATVRVLQQMVYRLPA-DITLV 59

Query: 384 PLSCLAKLS 392
               L    
Sbjct: 60  RPGSLLNEP 68


>gi|89069547|ref|ZP_01156891.1| hypothetical protein OG2516_03188 [Oceanicola granulosus HTCC2516]
 gi|89044882|gb|EAR50972.1| hypothetical protein OG2516_03188 [Oceanicola granulosus HTCC2516]
          Length = 710

 Score = 84.0 bits (206), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 44/342 (12%), Positives = 98/342 (28%), Gaps = 23/342 (6%)

Query: 52  GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
           GT  + +  +             L    + +P+            ++       ++   +
Sbjct: 386 GTEDDTLDAAPEAGAPAATAPPGLAAPAEDAPADVATAPAAPPPPDEEQVETIVVEVAPA 445

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
              V ++P    S  +L +     + G     +    +   + T + A    +  +    
Sbjct: 446 EPAVPDEPETPASRFALLSESGSTLPGQPVTPVTETPEPEADATALEAYAAPYEPDGRPM 505

Query: 172 RIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEA--ILQIPM 229
              I++    +       A       +T+A               + +G E   + ++P 
Sbjct: 506 MSIILLDDGALPGAAAALAGLP--VAVTVAVDPAHADAAALAATYRAQGFEVGVLARVP- 562

Query: 230 QAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIF 289
                              T Q +   +  +         + +  G  L  N+ + E   
Sbjct: 563 ----------------PGATPQDVEVAMEVAFSAVPEAVILFDAGGDGLQGNRAALEQTT 606

Query: 290 KEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQ-VDRDKIREKLKGLEEIA 348
              A  G           +     A +  +P +     LD    +   IR  L+     A
Sbjct: 607 AALAADGRGLVAYAEGLNS-GVRAAERAGVPAIEVYRDLDGDGQEARVIRRFLEQAAFRA 665

Query: 349 RTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           R     + +A    ++I  ++ W   +    V+V P+S L K
Sbjct: 666 RQESGVVVMARVRPDTISALNLWGTAQREGQVAVAPVSALLK 707


>gi|195935143|ref|ZP_03080525.1| hypothetical protein EscherichcoliO157_01585 [Escherichia coli
           O157:H7 str. EC4024]
          Length = 92

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 31/84 (36%), Gaps = 1/84 (1%)

Query: 155 TEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMK 214
               A      S     ++AIV+   G  +   +  +  +P+ I++A   +         
Sbjct: 8   VLAFAALLALSSPVLAGKLAIVIDDFGY-RPHNENQVLAMPSAISVAVLPDSPHAREMAT 66

Query: 215 EAKKKGQEAILQIPMQAFDESYNE 238
           +A   G E ++ +PM    +   E
Sbjct: 67  KAHNSGHEVLIHLPMAPLSKQPLE 90


>gi|330954792|gb|EGH55052.1| hypothetical protein PSYCIT7_26246 [Pseudomonas syringae Cit 7]
          Length = 122

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/113 (18%), Positives = 41/113 (36%), Gaps = 7/113 (6%)

Query: 157 VPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEA 216
             A           A +++++  LG +     R    LP  +TLA   +      + ++A
Sbjct: 17  AHAAPAESSGKPPKAYLSLIIDDLGQNPQRDSRT-LALPGPVTLAIMPDTPHATEFARQA 75

Query: 217 KKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGYFG 269
            + G+  +L +PM            Y       + +L +RL  +L +     G
Sbjct: 76  HRAGKTVMLHMPMDPAT------GPYAWHPELPLPELESRLNAALLKVPYAAG 122


>gi|261494460|ref|ZP_05990946.1| hypothetical protein COI_0248 [Mannheimia haemolytica serotype A2
           str. OVINE]
 gi|261309844|gb|EEY11061.1| hypothetical protein COI_0248 [Mannheimia haemolytica serotype A2
           str. OVINE]
          Length = 79

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 11/59 (18%), Positives = 25/59 (42%)

Query: 274 RGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLYLDDQV 332
            G+   S+  + + + K   +  L F D  +   ++    A +  +  +  D++LDD  
Sbjct: 1   MGSGATSDSATMQHLMKVLKENTLFFLDSKTIGSSVAAKTARQFGINTLERDIFLDDSD 59


>gi|213620697|ref|ZP_03373480.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 83

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 28/65 (43%), Gaps = 1/65 (1%)

Query: 167 NASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKEAKKKGQEAILQ 226
                ++AIV+   G  +  T+  +  LP NI++A   N         +A   G E ++ 
Sbjct: 20  PVFAGKLAIVIDDFGY-RPHTENQVLALPPNISVAVLPNAPHAREMATKAHNSGHEVLIH 78

Query: 227 IPMQA 231
           +PM  
Sbjct: 79  LPMAP 83


>gi|159044346|ref|YP_001533140.1| hypothetical protein Dshi_1797 [Dinoroseobacter shibae DFL 12]
 gi|157912106|gb|ABV93539.1| hypothetical protein Dshi_1797 [Dinoroseobacter shibae DFL 12]
          Length = 608

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/363 (12%), Positives = 84/363 (23%), Gaps = 36/363 (9%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           S             S  R            +      +          L  D        
Sbjct: 257 SGPPEPVELARPDSSPPRLALAPADLPLPPVAAAPMEASEPPVPAAGPLPADLRPAADTP 316

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK---- 162
                 +              L    ++              ++G       A D     
Sbjct: 317 APPADDRRTALVVPPRELPRRLVLGSDQSFGTRGPGLSSRIPRIGETAAVAEADDPLTPE 376

Query: 163 ---------------NFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGN 207
                           F       R+A+V+             ++ +   + +A      
Sbjct: 377 PEVPAPLGALARNALPFEGAEGVPRLALVL-RATSDARAITDVLSRIADPVAVALDPTWP 435

Query: 208 SLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTGY 267
             D    E +  G E ++ +                L      + +   L   + R  G 
Sbjct: 436 EADARAAELRAAGHEVLITL--------------TGLPDPVEPRDIDTALAVHIARLPGA 481

Query: 268 FGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADLY 327
            GV   R + +  ++E    +       G       S    +    A  + LP +     
Sbjct: 482 MGVWLPRTSPVFGDRELLRHLVAVLGDTGHGLVAPLSGLDAV-GQEARAIGLPAISVGRV 540

Query: 328 LDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLS 386
           L       D +R  L      A   GQA+ +     E++  +  W   +    + + P+S
Sbjct: 541 LGGSGEGEDALRRSLDQGALRAGADGQAVLLGETRAETLSALRDWSAAQDPDALRLAPIS 600

Query: 387 CLA 389
            L 
Sbjct: 601 ALL 603


>gi|260577284|ref|ZP_05845258.1| protein of unknown function DUF610 YibQ [Rhodobacter sp. SW2]
 gi|259020528|gb|EEW23850.1| protein of unknown function DUF610 YibQ [Rhodobacter sp. SW2]
          Length = 362

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 30/304 (9%), Positives = 77/304 (25%), Gaps = 18/304 (5%)

Query: 88  NNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP-TIEERLILGLSKKELLA 146
              + +     +     +         ++       +            I          
Sbjct: 72  PEPILDAQPLPAGDATSEPLPMPEQTAILRPVPALETQALDVTANRLPRIGDAEAAPPAE 131

Query: 147 KNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNG 206
                 + T +    + F + ++    A+++   G      +  +  LP  ++ A     
Sbjct: 132 TALPDEDQTALQRFARAFENPSAKPMFALILIDTG-GPDVDRTGLASLPFPVSFAIDPAA 190

Query: 207 NSLDRWMKEAKKKGQEAILQIPMQAFDESYNEDDSYTLKVTQTVQQLLNRLRYSLRRGTG 266
                     +   QE I+               +  +    T   L    + +      
Sbjct: 191 RDAATAAAIYRAADQEVIM--------------LATGIPQGATASDLAVSFQANAAALPE 236

Query: 267 YFGVMNYRGAMLLSNKESAEVIFKEFAKRGLLFFDDGSSPRNLTRVLAPKLNLPYMVADL 326
              V++       +N+  A  +       G                +A +  L   +   
Sbjct: 237 SVAVLDLEEGGFQTNRPLATEVVPVIKDIGRGLITWDKGLNA-GDQVARREGLAACMVFR 295

Query: 327 YLDDQ-VDRDKIREKLKGLEEIARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPL 385
            LD        +R  L      A   G+   V     ++++ + +W  +     V++ P+
Sbjct: 296 RLDGAGESVPTMRRYLDRAAFKAAQDGRVTVVGTTNPDTVKALLEWTVEGRAASVALAPI 355

Query: 386 SCLA 389
           S + 
Sbjct: 356 SAVL 359


>gi|330980648|gb|EGH78751.1| hypothetical protein PSYAP_19076 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 103

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 31/83 (37%), Gaps = 1/83 (1%)

Query: 156 EVPAMDKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLDRWMKE 215
              A           A +++++  LG +Q    R    LP  +TLA          + ++
Sbjct: 16  VAHAAPAENSGKPPKAYLSLIIDDLGQNQDRDSRT-LALPGPVTLAIMPATPHATEFARQ 74

Query: 216 AKKKGQEAILQIPMQAFDESYNE 238
           A + G+  +L +PM      Y  
Sbjct: 75  AHRAGKTVMLHMPMDPATGPYAW 97


>gi|167538573|ref|XP_001750949.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163770537|gb|EDQ84225.1| predicted protein [Monosiga brevicollis MX1]
          Length = 1536

 Score = 63.9 bits (154), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/128 (10%), Positives = 34/128 (26%), Gaps = 1/128 (0%)

Query: 46   ISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQS-PSKRDNNTVCNQLKNDSSQHDG 104
            +          + P +    +   P   P  +E   + P   +       L    +    
Sbjct: 1247 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPP 1306

Query: 105  QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
             ++   +   VV  P     +   P  +  L+   + K  + +    +     P   K  
Sbjct: 1307 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPP 1366

Query: 165  CSNASGAR 172
                +  +
Sbjct: 1367 VVEPTATQ 1374



 Score = 63.2 bits (152), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 32/119 (26%)

Query: 58   IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVN 117
             P +    + P     P+       P   +       +    +     ++   +   VV 
Sbjct: 1250 PPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVE 1309

Query: 118  KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIV 176
             P     +   P  +  ++   + K  L +    +     P   K        A+  +V
Sbjct: 1310 PPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVV 1368



 Score = 60.5 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/123 (9%), Positives = 32/123 (26%)

Query: 54   ISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
             +E +        +      P+       P   +       +    +     ++   +  
Sbjct: 1226 KTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKP 1285

Query: 114  TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARI 173
             VV  P     +   P  +  ++   + K  + +    +     P   K        A+ 
Sbjct: 1286 PVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKP 1345

Query: 174  AIV 176
             +V
Sbjct: 1346 PVV 1348



 Score = 60.1 bits (144), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 36/125 (28%), Gaps = 2/125 (1%)

Query: 54   ISEMIPYSVIREIAPIPLTIPLNIED--KQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
                +P +  R  AP         E    ++P+   +      +    +     ++   +
Sbjct: 1204 EVAPVPVAKPRPEAPASEVAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAA 1263

Query: 112  GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
               VV  P     +   P  +  ++   + K  L +    +     P   K        A
Sbjct: 1264 KPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAA 1323

Query: 172  RIAIV 176
            +  +V
Sbjct: 1324 KPPVV 1328



 Score = 60.1 bits (144), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/126 (10%), Positives = 31/126 (24%), Gaps = 1/126 (0%)

Query: 52   GTISEMIPYSVIREIAPIPLTIP-LNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDI 110
                         +  P+    P  +      P   +       +    +     ++   
Sbjct: 1213 PRPEAPASEVAKPKTEPVDAEAPTADSSAAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPA 1272

Query: 111  SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
            +   VV  P     +   P  +  L+   + K  + +    +     P   K        
Sbjct: 1273 AKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPA 1332

Query: 171  ARIAIV 176
            A+  +V
Sbjct: 1333 AKPPLV 1338



 Score = 58.9 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/127 (10%), Positives = 34/127 (26%), Gaps = 1/127 (0%)

Query: 46   ISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQS-PSKRDNNTVCNQLKNDSSQHDG 104
            +          + P +    +   P   P  +E   + P   +       +    +    
Sbjct: 1257 VVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPP 1316

Query: 105  QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
             ++   +   VV  P     +   P  +  ++   + K  + +    +     P   +  
Sbjct: 1317 VVEPPAAKPPVVEPPAAKPPLVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPTATQGA 1376

Query: 165  CSNASGA 171
               A  A
Sbjct: 1377 ELEAIPA 1383



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/127 (8%), Positives = 35/127 (27%)

Query: 50   FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                  +++  + + +       +      K  P    +     + +   ++      + 
Sbjct: 1182 PTSEPVKVLNVAGLPQGESTVDEVAPVPVAKPRPEAPASEVAKPKTEPVDAEAPTADSSA 1241

Query: 110  ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
             +   VV  P     +   P  +  ++   + K  + +    +     P   K       
Sbjct: 1242 AAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPVVEPPAAKPPLVEPP 1301

Query: 170  GARIAIV 176
             A+  +V
Sbjct: 1302 AAKPPVV 1308


>gi|194209578|ref|XP_001915278.1| PREDICTED: similar to piccolo [Equus caballus]
          Length = 5117

 Score = 63.2 bits (152), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 9/130 (6%), Positives = 21/130 (16%), Gaps = 2/130 (1%)

Query: 47  SHAFVGTISEMIPYSVIREIA--PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDG 104
           S                +     P P   P           +         +        
Sbjct: 396 SQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAPPQQPGPAKPA 455

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
             Q   +                   ++         K    +    +   + P   K  
Sbjct: 456 PQQPGPAKPPPQQPGPAKPPPQQPGPVKAPPQQPGPAKPPPQQPGPAKPAPQQPGPAKPT 515

Query: 165 CSNASGARIA 174
                 A+++
Sbjct: 516 PQQPGPAKVS 525



 Score = 61.6 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/121 (9%), Positives = 22/121 (18%), Gaps = 3/121 (2%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                         +     P         +  P+K               Q  G  +  
Sbjct: 369 PGPAKPAPQQPGPAKPPPQQPGPAKPA-SQQPGPAKPPPQQPGPAK--APPQQPGPAKPP 425

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                 V  P +       P  +        ++   AK    +     P   +     A 
Sbjct: 426 PEQPGPVKAPPQQPGPAKAPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPPPQQPGPVKAP 485

Query: 170 G 170
            
Sbjct: 486 P 486



 Score = 61.6 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 7/123 (5%), Positives = 16/123 (13%), Gaps = 1/123 (0%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                             P P          Q P                 Q  G  +  
Sbjct: 386 PQQPGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAP 445

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                      +       P  +        ++         ++        +       
Sbjct: 446 PQQPGPAKPAPQQPGPAKPPPQQPGPAKPPPQQP-GPVKAPPQQPGPAKPPPQQPGPAKP 504

Query: 170 GAR 172
             +
Sbjct: 505 APQ 507



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 10/125 (8%), Positives = 18/125 (14%), Gaps = 2/125 (1%)

Query: 50  FVGTISEMIPYSVIREIA--PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
                         +     P P   P        P       V    +          Q
Sbjct: 389 PGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAPPQQ 448

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
              +                    +         K    +    +   + P   K     
Sbjct: 449 PGPAKPAPQQPGPAKPPPQQPGPAKPPPQQPGPVKAPPQQPGPAKPPPQQPGPAKPAPQQ 508

Query: 168 ASGAR 172
              A+
Sbjct: 509 PGPAK 513



 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 9/123 (7%), Positives = 22/123 (17%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              + ++    +      P P   P        P+ +         +          Q  
Sbjct: 341 PAKSPAQQPGPAKAASQQPGPAKPPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPASQQPG 400

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
            +                    +         K    +    +   + P   K       
Sbjct: 401 PAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAPPQQPGPAKPAPQQPG 460

Query: 170 GAR 172
            A+
Sbjct: 461 PAK 463



 Score = 60.5 bits (145), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 9/127 (7%), Positives = 20/127 (15%), Gaps = 2/127 (1%)

Query: 50  FVGTISEMIPYSVIREIA--PIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
                         +  +  P P   P           +         +          Q
Sbjct: 379 PGPAKPPPQQPGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKAPPQQ 438

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
              +            +       +         K    +    +   + P   K     
Sbjct: 439 PGPAKAPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPPPQQPGPVKAPPQQPGPAKPPPQQ 498

Query: 168 ASGARIA 174
              A+ A
Sbjct: 499 PGPAKPA 505



 Score = 57.8 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 8/129 (6%), Positives = 19/129 (14%), Gaps = 9/129 (6%)

Query: 52  GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKN--------DSSQHD 103
           G            +  P           +  P+K                       Q  
Sbjct: 350 GPAKAASQQPGPAKPPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPASQQPGPAKPPPQQP 409

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN 163
           G  +           P         P  +        ++         ++        + 
Sbjct: 410 GPAKAPPQQPGPAKPPPEQPGPVKAPPQQPGPAKAPPQQP-GPAKPAPQQPGPAKPPPQQ 468

Query: 164 FCSNASGAR 172
                   +
Sbjct: 469 PGPAKPPPQ 477



 Score = 57.4 bits (137), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 9/122 (7%), Positives = 22/122 (18%), Gaps = 2/122 (1%)

Query: 51  VGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVC--NQLKNDSSQHDGQIQN 108
           +            ++  P     P       +                    Q  G  + 
Sbjct: 315 LPAQPPATTKPATQQPRPKSPAQPPGPAKSPAQQPGPAKAASQQPGPAKPPPQQPGPAKP 374

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
                     P +        + +        ++   AK    +     P  ++     A
Sbjct: 375 APQQPGPAKPPPQQPGPAKPASQQPGPAKPPPQQPGPAKAPPQQPGPAKPPPEQPGPVKA 434

Query: 169 SG 170
             
Sbjct: 435 PP 436



 Score = 55.8 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 8/121 (6%), Positives = 22/121 (18%)

Query: 52  GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
                        + A      P       +   R  +         S           S
Sbjct: 297 PAQPPGPAKPSPTQPAAKLPAQPPATTKPATQQPRPKSPAQPPGPAKSPAQQPGPAKAAS 356

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
            +    KP       + P  ++        ++        ++        +      +  
Sbjct: 357 QQPGPAKPPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPASQQPGPAKPPPQQPGPAKAPP 416

Query: 172 R 172
           +
Sbjct: 417 Q 417



 Score = 54.3 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 7/122 (5%), Positives = 19/122 (15%), Gaps = 1/122 (0%)

Query: 52  GTISEMIPYSVIREIAPIPLTIP-LNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDI 110
           G            + +P              +          +  +          Q   
Sbjct: 292 GPTKAPAQPPGPAKPSPTQPAAKLPAQPPATTKPATQQPRPKSPAQPPGPAKSPAQQPGP 351

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
           +                    +         K    +    +  ++ P   K        
Sbjct: 352 AKAASQQPGPAKPPPQQPGPAKPAPQQPGPAKPPPQQPGPAKPASQQPGPAKPPPQQPGP 411

Query: 171 AR 172
           A+
Sbjct: 412 AK 413


>gi|224367794|ref|YP_002601957.1| hypothetical protein HRM2_06790 [Desulfobacterium autotrophicum
           HRM2]
 gi|223690510|gb|ACN13793.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 250

 Score = 62.0 bits (149), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/180 (10%), Positives = 44/180 (24%), Gaps = 10/180 (5%)

Query: 7   HPLRKKTPKRKSFYSQIISRLGLFLLFCTFIVGLSIYI-LISHAFVGTISEMIPYSVIRE 65
            P R +  ++    +   +     +      +G   ++    H            +   E
Sbjct: 31  RPERNRRKEKTRRTTNKTTPWIWIIFLTLLFIGAGTFVTFFFHGPGTVTPAPPKTAQAPE 90

Query: 66  IAPIPLTIPL---------NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVV 116
            API                           +            Q  G     +S +   
Sbjct: 91  TAPIKTEAKPTPDIAVARQPKPPAPVAQAEPSQLPSPAPHAAPLQRPGSRHQGLSPQLSK 150

Query: 117 NKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIV 176
             P    S  ++ T++        K   +   ++   +     ++    S     R+A++
Sbjct: 151 AIPPSEPSPPAMGTLDSSPQPPAPKPNQVTGTEISVMEDANLTINAISWSTVPEKRLAVI 210


>gi|330800279|ref|XP_003288165.1| hypothetical protein DICPUDRAFT_78981 [Dictyostelium purpureum]
 gi|325081795|gb|EGC35298.1| hypothetical protein DICPUDRAFT_78981 [Dictyostelium purpureum]
          Length = 796

 Score = 61.6 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 7/97 (7%), Positives = 14/97 (14%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T S     +     +P     P   E               +    +          
Sbjct: 189 PAPTESPTPAPTESPTPSPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTPAPT 248

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLA 146
            S      +       +S              +    
Sbjct: 249 ESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTP 285



 Score = 61.6 bits (148), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 6/101 (5%), Positives = 12/101 (11%)

Query: 62  VIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTR 121
                AP     P   E               +    +           S      +   
Sbjct: 185 ESPTPAPTESPTPAPTESPTPSPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPT 244

Query: 122 STSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK 162
               +S              +                +   
Sbjct: 245 PAPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTP 285



 Score = 56.6 bits (135), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 8/82 (9%), Positives = 13/82 (15%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T S     +     AP     P   E               +    +          
Sbjct: 205 PSPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTPAPT 264

Query: 110 ISGKTVVNKPTRSTSIDSLPTI 131
            S      +       +S    
Sbjct: 265 ESPTPAPTESPTPAPTESPTPA 286



 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 5/95 (5%), Positives = 9/95 (9%), Gaps = 1/95 (1%)

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLIL 137
           E               +    S           S      +       +S          
Sbjct: 185 ESPTPAPTESPTPAPTESPTPSPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPT 244

Query: 138 GLSKKELLAKNKVGREDTEVP-AMDKNFCSNASGA 171
               +                        S     
Sbjct: 245 PAPTESPTPAPTESPTPAPTESPTPAPTESPTPAP 279



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 5/102 (4%), Positives = 17/102 (16%), Gaps = 1/102 (0%)

Query: 70  PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLP 129
             T         +P++    +   +    +           S      +       +S  
Sbjct: 186 SPTPAPTESPTPAPTESPTPSPT-ESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPT 244

Query: 130 TIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
                       +                +       + + A
Sbjct: 245 PAPTESPTPAPTESPTPAPTESPTPAPTESPTPAPTESPTPA 286


>gi|73967669|ref|XP_859301.1| PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 3 [Canis
           familiaris]
          Length = 710

 Score = 61.2 bits (147), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 28/141 (19%), Gaps = 7/141 (4%)

Query: 45  LISHAFVGTISEMIPYSVIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKND 98
                  G  +           AP           P       +      +   N     
Sbjct: 569 ATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAP 628

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE-V 157
            S          SG +       S   ++ P                  N      +   
Sbjct: 629 PSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPVPPSGDS 688

Query: 158 PAMDKNFCSNASGARIAIVVS 178
            A       ++ GA++ IV+ 
Sbjct: 689 NAPPAPPSEDSEGAQMPIVIG 709



 Score = 52.0 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 23/125 (18%), Gaps = 5/125 (4%)

Query: 52  GTISEMIPYSVIREIAPIPL-----TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           G  +   P S      P P        P       +      +   N      S      
Sbjct: 555 GDEATPAPPSGDSNATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP 614

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
               SG +       S   ++ P                  N      +          S
Sbjct: 615 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPS 674

Query: 167 NASGA 171
             S A
Sbjct: 675 GDSNA 679


>gi|73967673|ref|XP_859370.1| PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 5 [Canis
           familiaris]
          Length = 709

 Score = 60.9 bits (146), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 28/141 (19%), Gaps = 7/141 (4%)

Query: 45  LISHAFVGTISEMIPYSVIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKND 98
                  G  +           AP           P       +      +   N     
Sbjct: 568 ATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAP 627

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE-V 157
            S          SG +       S   ++ P                  N      +   
Sbjct: 628 PSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPVPPSGDS 687

Query: 158 PAMDKNFCSNASGARIAIVVS 178
            A       ++ GA++ IV+ 
Sbjct: 688 NAPPAPPSEDSEGAQMPIVIG 708



 Score = 51.6 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 23/125 (18%), Gaps = 5/125 (4%)

Query: 52  GTISEMIPYSVIREIAPIPL-----TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           G  +   P S      P P        P       +      +   N      S      
Sbjct: 554 GDEATPAPPSGDSNATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP 613

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
               SG +       S   ++ P                  N      +          S
Sbjct: 614 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPS 673

Query: 167 NASGA 171
             S A
Sbjct: 674 GDSNA 678


>gi|167522703|ref|XP_001745689.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776038|gb|EDQ89660.1| predicted protein [Monosiga brevicollis MX1]
          Length = 2262

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 8/120 (6%), Positives = 20/120 (16%), Gaps = 1/120 (0%)

Query: 52   GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
                   P     +    P   P         +  +          +  Q          
Sbjct: 1474 PPEPPQSPKHAPPKPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKH-APPEP 1532

Query: 112  GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             ++  + P            E       +  +     K          +     + +  A
Sbjct: 1533 PQSPKHAPPGPPQSPKHAPPEPPQSPKHAPPKPPQSPKHAPPKPPQSPVLPPSEAASDAA 1592



 Score = 57.0 bits (136), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 12/116 (10%), Positives = 21/116 (18%), Gaps = 2/116 (1%)

Query: 58   IPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD--GQIQNDISGKTV 115
             P     E    P   P         +  +          +  Q       +   S K  
Sbjct: 1469 SPKYAPPEPPQSPKHAPPKPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHA 1528

Query: 116  VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
              +P +S         +          +           +   A  K   S     
Sbjct: 1529 PPEPPQSPKHAPPGPPQSPKHAPPEPPQSPKHAPPKPPQSPKHAPPKPPQSPVLPP 1584



 Score = 55.1 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/120 (9%), Positives = 21/120 (17%), Gaps = 1/120 (0%)

Query: 52   GTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
                   P     E    P   P         +  +             Q          
Sbjct: 1496 PPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKH-APPEP 1554

Query: 112  GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             ++  + P +          +      L   E  +       D+     +    S A   
Sbjct: 1555 PQSPKHAPPKPPQSPKHAPPKPPQSPVLPPSEAASDAASELSDSLPELNESRPRSGAMAT 1614



 Score = 50.1 bits (118), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/128 (9%), Positives = 20/128 (15%), Gaps = 6/128 (4%)

Query: 50   FVGTISEMIPY----SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQ 105
                   ++P              P   P         +             +  Q    
Sbjct: 1446 PEPVGPAVVPVRPPQHAPPGPPQSPKYAPPEPPQSPKHAPPKPPQSPKHAPPEPPQSPKH 1505

Query: 106  IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVP--AMDKN 163
               +         P    S    P    +           +      E  + P  A  K 
Sbjct: 1506 APPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKHAPPEPPQSPKHAPPKP 1565

Query: 164  FCSNASGA 171
              S     
Sbjct: 1566 PQSPKHAP 1573



 Score = 49.7 bits (117), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/153 (13%), Positives = 35/153 (22%), Gaps = 9/153 (5%)

Query: 50   FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                  E           P         E  QSP         +                
Sbjct: 1503 PKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKHAPPEPPQSPKHAP 1562

Query: 110  ISGKTVVN-KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
                      P +      LP  E          + L +    R  +   A  +    +A
Sbjct: 1563 PKPPQSPKHAPPKPPQSPVLPPSEAASDAASELSDSLPELNESRPRSGAMATSRPAAQSA 1622

Query: 169  SGARIAIVVSGLGISQTGTQRAINLLPANITLA 201
            +  ++ ++        +  +R  N  P  ITL+
Sbjct: 1623 NPEKVELL--------SALERVANEHPKGITLS 1647



 Score = 48.9 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/119 (9%), Positives = 20/119 (16%), Gaps = 2/119 (1%)

Query: 55   SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD--GQIQNDISG 112
                P          P   P         +  +             Q       +   S 
Sbjct: 1444 PVPEPVGPAVVPVRPPQHAPPGPPQSPKYAPPEPPQSPKHAPPKPPQSPKHAPPEPPQSP 1503

Query: 113  KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
            K    +P +S         +          +       G   +   A  +   S     
Sbjct: 1504 KHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKHAPPEPPQSPKHAP 1562



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/158 (8%), Positives = 37/158 (23%), Gaps = 9/158 (5%)

Query: 50   FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                  E           P            QSP         +                
Sbjct: 1514 PKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKHAPPEPPQSPKHAPPKPPQSPKHAP 1573

Query: 110  ISGKTVVNKPTRSTSIDSLPTIEE---------RLILGLSKKELLAKNKVGREDTEVPAM 160
                     P    + D+   + +              ++     A++    +   + A+
Sbjct: 1574 PKPPQSPVLPPSEAASDAASELSDSLPELNESRPRSGAMATSRPAAQSANPEKVELLSAL 1633

Query: 161  DKNFCSNASGARIAIVVSGLGISQTGTQRAINLLPANI 198
            ++    +  G  ++ +++ +G      + A+  L   +
Sbjct: 1634 ERVANEHPKGITLSAILNKVGEQSHHDKMALGRLLTPL 1671



 Score = 41.6 bits (96), Expect = 0.25,   Method: Composition-based stats.
 Identities = 11/126 (8%), Positives = 24/126 (19%), Gaps = 2/126 (1%)

Query: 48   HAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD--GQ 105
            HA   + +     +      P P+   +        +             +  Q      
Sbjct: 1426 HAVPESNASATLQASSSTPVPEPVGPAVVPVRPPQHAPPGPPQSPKYAPPEPPQSPKHAP 1485

Query: 106  IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
             +   S K    +P +S         +          +           +   A      
Sbjct: 1486 PKPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQ 1545

Query: 166  SNASGA 171
            S     
Sbjct: 1546 SPKHAP 1551



 Score = 36.2 bits (82), Expect = 9.4,   Method: Composition-based stats.
 Identities = 9/122 (7%), Positives = 26/122 (21%), Gaps = 6/122 (4%)

Query: 56   EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
             +   S      P+   +      + +P     +      +   S      +   S K  
Sbjct: 1436 TLQASSSTPVPEPVGPAVVPVRPPQHAPPGPPQSPKYAPPEPPQSPKHAPPKPPQSPKHA 1495

Query: 116  VNKPTRSTSIDSLPTIEERLILGLSKKE-----LLAKNKVGREDTEVPAMDKNFCSNASG 170
              +P +S    + P   +       +          +     +            +    
Sbjct: 1496 PPEPPQSP-KHAPPEPPQSPKHAPPEPPQSPKHAPPEPPQSPKHAPPGPPQSPKHAPPEP 1554

Query: 171  AR 172
             +
Sbjct: 1555 PQ 1556


>gi|260796019|ref|XP_002593002.1| hypothetical protein BRAFLDRAFT_117784 [Branchiostoma floridae]
 gi|229278226|gb|EEN49013.1| hypothetical protein BRAFLDRAFT_117784 [Branchiostoma floridae]
          Length = 1602

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 27/127 (21%), Gaps = 5/127 (3%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNI-----EDKQSPSKRDNNTVCNQLKNDSSQHD 103
           A    + +  P +   + AP   T          +   +             K   +   
Sbjct: 96  APTAPVDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPEPTAPADKPAPTAPT 155

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN 163
            +        T       ST + + P  +        K    A +         P   K 
Sbjct: 156 DKPAPTAPTDTPAPTAPASTPLPAAPVDKPAPTAPTDKPAPTAPSAPKDSPAPEPTPTKP 215

Query: 164 FCSNASG 170
                + 
Sbjct: 216 TAEPVTT 222



 Score = 59.3 bits (142), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 13/135 (9%), Positives = 24/135 (17%), Gaps = 11/135 (8%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTI----------PLNIEDKQSPSKRDNNTVCNQLKND 98
           A      +  P +   + AP   T           P        P+              
Sbjct: 69  APTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPVDKPAPTAPTDKPAPTAPTDKPAPTAPT 128

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRE-DTEV 157
                    +        +KP  +   D             +            +     
Sbjct: 129 DKPAPTAPTDKPEPTAPADKPAPTAPTDKPAPTAPTDTPAPTAPASTPLPAAPVDKPAPT 188

Query: 158 PAMDKNFCSNASGAR 172
              DK   +  S  +
Sbjct: 189 APTDKPAPTAPSAPK 203



 Score = 58.9 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 10/122 (8%), Positives = 22/122 (18%), Gaps = 2/122 (1%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLT--IPLNIEDKQSPSKRDNNTVCNQLKNDSSQ 101
                A      +  P + + + AP   T          +       +        D   
Sbjct: 37  AAYKPAPTAPTGKPAPTAPVDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPA 96

Query: 102 HDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMD 161
               +               + +    PT         +  +         +       D
Sbjct: 97  PTAPVDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPEPTAPADKPAPTAPTD 156

Query: 162 KN 163
           K 
Sbjct: 157 KP 158



 Score = 57.8 bits (138), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 25/127 (19%), Gaps = 1/127 (0%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPL-NIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
           A      +  P +   + AP   T           P+               +       
Sbjct: 114 APTAPTDKPAPTAPTDKPAPTAPTDKPEPTAPADKPAPTAPTDKPAPTAPTDTPAPTAPA 173

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
           +       V+KP  +   D                E           T  P  +      
Sbjct: 174 STPLPAAPVDKPAPTAPTDKPAPTAPSAPKDSPAPEPTPTKPTAEPVTTKPKTEPATTKP 233

Query: 168 ASGARIA 174
            +G   A
Sbjct: 234 KAGPETA 240



 Score = 55.8 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/138 (9%), Positives = 24/138 (17%), Gaps = 7/138 (5%)

Query: 41  SIYILISHAFVGTISEMIPYSVIREIAPIPLTI-PLNIEDKQSPSKRDNNTVCNQLKNDS 99
           + +            +  P +   + AP      P        P+               
Sbjct: 25  AGFCGRGVDLSEAAYKPAPTAPTGKPAPTAPVDKPAPTAPTDKPAPTAPTDKPAPTAPTD 84

Query: 100 SQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGL------SKKELLAKNKVGRE 153
                   +  +    V+KP  +   D                                 
Sbjct: 85  KPAPTAPTDKPAPTAPVDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPEPTA 144

Query: 154 DTEVPAMDKNFCSNASGA 171
             + PA        A  A
Sbjct: 145 PADKPAPTAPTDKPAPTA 162



 Score = 53.9 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 30/123 (24%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A V   +   P       AP     P    DK +P+   +        +  +      + 
Sbjct: 54  APVDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPTDKPAPTAPVDKPAPTAPTDKP 113

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
             +  T    PT  T   +     ++        +        +     P       + A
Sbjct: 114 APTAPTDKPAPTAPTDKPAPTAPTDKPEPTAPADKPAPTAPTDKPAPTAPTDTPAPTAPA 173

Query: 169 SGA 171
           S  
Sbjct: 174 STP 176



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/133 (9%), Positives = 26/133 (19%), Gaps = 9/133 (6%)

Query: 47  SHAFVGTISE--MIPYSVIREIAPI----PLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS 100
           +     T       P +   + AP                   +  D           + 
Sbjct: 137 TDKPEPTAPADKPAPTAPTDKPAPTAPTDTPAPTAPASTPLPAAPVDKPAPTAPTDKPAP 196

Query: 101 QHDGQIQNDISGKTVVNKPTRSTSIDSL---PTIEERLILGLSKKELLAKNKVGREDTEV 157
                 ++  + +    KPT           P   +      + K          +    
Sbjct: 197 TAPSAPKDSPAPEPTPTKPTAEPVTTKPKTEPATTKPKAGPETAKSTAEPAPAKPKAGPA 256

Query: 158 PAMDKNFCSNASG 170
           P   K+    A  
Sbjct: 257 PEKAKDEAGPAKP 269



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 26/125 (20%), Gaps = 2/125 (1%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLT--IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           A      +  P +   +  P              +       +T        +      +
Sbjct: 123 APTAPTDKPAPTAPTDKPEPTAPADKPAPTAPTDKPAPTAPTDTPAPTAPASTPLPAAPV 182

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
                          + S        E      + + +  K K     T+  A  +   S
Sbjct: 183 DKPAPTAPTDKPAPTAPSAPKDSPAPEPTPTKPTAEPVTTKPKTEPATTKPKAGPETAKS 242

Query: 167 NASGA 171
            A  A
Sbjct: 243 TAEPA 247



 Score = 50.5 bits (119), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 27/131 (20%), Gaps = 8/131 (6%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRD----NNTVCNQLKNDSSQHDG 104
           A     +   P       AP     P    DK +P+            +     +     
Sbjct: 126 APTDKPAPTAPTDKPEPTAPADKPAPTAPTDKPAPTAPTDTPAPTAPASTPLPAAPVDKP 185

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAK----NKVGREDTEVPAM 160
                              S    PT  +     ++ K          K G E  +  A 
Sbjct: 186 APTAPTDKPAPTAPSAPKDSPAPEPTPTKPTAEPVTTKPKTEPATTKPKAGPETAKSTAE 245

Query: 161 DKNFCSNASGA 171
                  A  A
Sbjct: 246 PAPAKPKAGPA 256



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 29/126 (23%), Gaps = 4/126 (3%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A   T +   P S     AP+    P    DK +P+           +   ++   +   
Sbjct: 162 APTDTPAPTAPASTPLPAAPVDKPAPTAPTDKPAPTAPSAPKDSPAPEPTPTKPTAEPVT 221

Query: 109 ----DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
                    T       +    + P   +       +K          +D     +    
Sbjct: 222 TKPKTEPATTKPKAGPETAKSTAEPAPAKPKAGPAPEKAKDEAGPAKPDDKLKKEVGTPT 281

Query: 165 CSNASG 170
              A  
Sbjct: 282 KEKAQK 287



 Score = 42.8 bits (99), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 28/123 (22%), Gaps = 2/123 (1%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
               + +  P +   + AP   + P +      P+           K  +     + +  
Sbjct: 178 PAAPVDKPAPTAPTDKPAPTAPSAPKD-SPAPEPTPTKPTAEPVTTKPKTEPATTKPKAG 236

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                            + P  E+        K      K     T+  A  K      S
Sbjct: 237 PETAKSTA-EPAPAKPKAGPAPEKAKDEAGPAKPDDKLKKEVGTPTKEKAQKKTETVKPS 295

Query: 170 GAR 172
             R
Sbjct: 296 SDR 298


>gi|73967675|ref|XP_859406.1| PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 6 [Canis
           familiaris]
          Length = 715

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 28/141 (19%), Gaps = 7/141 (4%)

Query: 45  LISHAFVGTISEMIPYSVIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKND 98
                  G  +           AP           P       +      +   N     
Sbjct: 574 ATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAP 633

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE-V 157
            S          SG +       S   ++ P                  N      +   
Sbjct: 634 PSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPVPPSGDS 693

Query: 158 PAMDKNFCSNASGARIAIVVS 178
            A       ++ GA++ IV+ 
Sbjct: 694 NAPPAPPSEDSEGAQMPIVIG 714



 Score = 51.6 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 23/125 (18%), Gaps = 5/125 (4%)

Query: 52  GTISEMIPYSVIREIAPIPL-----TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           G  +   P S      P P        P       +      +   N      S      
Sbjct: 560 GDEATPAPPSGDSNATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP 619

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
               SG +       S   ++ P                  N      +          S
Sbjct: 620 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPS 679

Query: 167 NASGA 171
             S A
Sbjct: 680 GDSNA 684


>gi|57092243|ref|XP_548401.1| PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 1 [Canis
           familiaris]
          Length = 709

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 28/141 (19%), Gaps = 7/141 (4%)

Query: 45  LISHAFVGTISEMIPYSVIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKND 98
                  G  +           AP           P       +      +   N     
Sbjct: 568 ATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAP 627

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE-V 157
            S          SG +       S   ++ P                  N      +   
Sbjct: 628 PSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPVPPSGDS 687

Query: 158 PAMDKNFCSNASGARIAIVVS 178
            A       ++ GA++ IV+ 
Sbjct: 688 NAPPAPPSEDSEGAQMPIVIG 708



 Score = 51.6 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 23/125 (18%), Gaps = 5/125 (4%)

Query: 52  GTISEMIPYSVIREIAPIPL-----TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           G  +   P S      P P        P       +      +   N      S      
Sbjct: 554 GDEATPAPPSGDSNATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP 613

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
               SG +       S   ++ P                  N      +          S
Sbjct: 614 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPS 673

Query: 167 NASGA 171
             S A
Sbjct: 674 GDSNA 678


>gi|73967671|ref|XP_859335.1| PREDICTED: similar to Bile-salt-activated lipase precursor (BAL)
           (Bile-salt-stimulated lipase) (BSSL) (Carboxyl ester
           lipase) (Sterol esterase) (Cholesterol esterase)
           (Pancreatic lysophospholipase) isoform 4 [Canis
           familiaris]
          Length = 710

 Score = 60.9 bits (146), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/141 (11%), Positives = 28/141 (19%), Gaps = 7/141 (4%)

Query: 45  LISHAFVGTISEMIPYSVIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKND 98
                  G  +           AP           P       +      +   N     
Sbjct: 569 ATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAP 628

Query: 99  SSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE-V 157
            S          SG +       S   ++ P                  N      +   
Sbjct: 629 PSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPVPPSGDS 688

Query: 158 PAMDKNFCSNASGARIAIVVS 178
            A       ++ GA++ IV+ 
Sbjct: 689 NAPPAPPSEDSEGAQMPIVIG 709



 Score = 51.6 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 23/125 (18%), Gaps = 5/125 (4%)

Query: 52  GTISEMIPYSVIREIAPIPL-----TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           G  +   P S      P P        P       +      +   N      S      
Sbjct: 555 GDEATPAPPSGDSNATPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAP 614

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
               SG +       S   ++ P                  N      +          S
Sbjct: 615 PAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPSGDSNAPPAPPS 674

Query: 167 NASGA 171
             S A
Sbjct: 675 GDSNA 679


>gi|299115393|emb|CBN74223.1| EsV-1-166 [Ectocarpus siliculosus]
          Length = 905

 Score = 60.1 bits (144), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 11/145 (7%), Positives = 25/145 (17%), Gaps = 19/145 (13%)

Query: 34  CTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCN 93
                G   + L     +       P  V     P+  T    +     P       V  
Sbjct: 610 TVACGGFDAFNLFKFDGIAEPIAPTPEPVAPTPEPVAPTPEP-VAPTPEPVAPTPEPVAP 668

Query: 94  QLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRE 153
             +  +                   P                +    +        V   
Sbjct: 669 TPEPVAPT-----------------PEPVAPTPEPVAPTPEPVAPTPEPVAPTPEPVAPT 711

Query: 154 DTEVPAMDKNFCSNASGAR-IAIVV 177
              V    +   +       + +++
Sbjct: 712 PEPVAPTPEPVVAPTPTNDCMVVII 736


>gi|289806944|ref|ZP_06537573.1| divergent polysaccharide deacetylase [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
          Length = 48

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 5/46 (10%), Positives = 17/46 (36%)

Query: 247 TQTVQQLLNRLRYSLRRGTGYFGVMNYRGAMLLSNKESAEVIFKEF 292
             +  ++   +R ++       G+ N+ G+ + S+        +  
Sbjct: 1   DMSSDEIERIIREAVNNVPYAVGLNNHMGSAMTSSLFGMTKSLQAL 46


>gi|331284120|ref|NP_001193562.1| proteoglycan 4 [Bos taurus]
          Length = 1195

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 26/127 (20%), Gaps = 4/127 (3%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRD----NNTVCNQLKNDSSQHDG 104
           A   T  E  P +  +E AP     P   E K+            T   +      +   
Sbjct: 495 APTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPA 554

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
                    T   K               +     +  +  A     +E       +   
Sbjct: 555 PTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAP 614

Query: 165 CSNASGA 171
                 A
Sbjct: 615 AEPKEPA 621



 Score = 54.3 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/117 (10%), Positives = 27/117 (23%), Gaps = 3/117 (2%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT 114
            +    +  +E AP     P      + P+  D          +  +       + +  T
Sbjct: 442 PKEPAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPK---EPAPAEPKEPAPTSSKEPAPTT 498

Query: 115 VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
              +P  +T+       + +       KE    +      T                
Sbjct: 499 TTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAP 555



 Score = 53.5 bits (127), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/119 (10%), Positives = 25/119 (21%), Gaps = 1/119 (0%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
           +  E  P +  +E AP     P   E  + +P+           K  +     +      
Sbjct: 457 SPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTD 516

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
            K       +  +  S                   +          P       + A  
Sbjct: 517 PKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEP 575



 Score = 53.2 bits (126), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 26/126 (20%), Gaps = 4/126 (3%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNI----EDKQSPSKRDNNTVCNQLKNDSSQHDGQ 105
              T  +    +  +E AP     P       E   +  K    T   +    ++  +  
Sbjct: 512 PAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPA 571

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
                       K    T+    P                      +E       +    
Sbjct: 572 PAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPN 631

Query: 166 SNASGA 171
           S  + A
Sbjct: 632 SPETLA 637



 Score = 52.8 bits (125), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/116 (12%), Positives = 29/116 (25%), Gaps = 3/116 (2%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
           E  P +  +E AP          D + P+  +          + +      +        
Sbjct: 493 EPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAP---AE 549

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             +P  ++  +  PT   +       KE    +      T          +    A
Sbjct: 550 PKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPA 605



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 28/123 (22%), Gaps = 2/123 (1%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
           A   T  E  P    +E AP     P      + +P+         + K  +     +  
Sbjct: 504 APTTTPKEPAPT-DPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPA 562

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
              + K       +  +  S                   K     +  E    +    + 
Sbjct: 563 PTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAP 622

Query: 168 ASG 170
           A  
Sbjct: 623 AEP 625



 Score = 51.6 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 13/107 (12%), Positives = 20/107 (18%), Gaps = 5/107 (4%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCN-----QLKNDSSQHDGQIQ 107
           +  E  P +  +E AP     P     K+                        +      
Sbjct: 532 SPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTT 591

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRED 154
                 T   K    T        E +       KE    +      
Sbjct: 592 TKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAP 638



 Score = 50.8 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 31/129 (24%), Gaps = 4/129 (3%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSP----SKRDNNTVCNQLKNDSSQH 102
           +     T  E  P +  +E AP     P     K+       +    T   +    S + 
Sbjct: 385 TKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKE 444

Query: 103 DGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK 162
                      T   +P  +T+       + +       KE    +      T       
Sbjct: 445 PAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPA 504

Query: 163 NFCSNASGA 171
              +    A
Sbjct: 505 PTTTPKEPA 513



 Score = 50.1 bits (118), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 27/122 (22%), Gaps = 3/122 (2%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP     P      + P+     T   +      +     +  
Sbjct: 470 PAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPA---PTTTPKEPAPTDPKEPAPAEPK 526

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
               T   +P  +T+       E +     S KE              P           
Sbjct: 527 EPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEP 586

Query: 170 GA 171
             
Sbjct: 587 AP 588



 Score = 48.9 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 31/126 (24%), Gaps = 2/126 (1%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A   T  E  P +  +E AP     P   E K+           N  +  +         
Sbjct: 587 APTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPSSPDIPAP 646

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK--VGREDTEVPAMDKNFCS 166
             S  +        ++    P             + L  +         + P ++K   +
Sbjct: 647 TTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVPTIKGPKVNKPEIT 706

Query: 167 NASGAR 172
                +
Sbjct: 707 TTVKDK 712



 Score = 48.9 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/124 (8%), Positives = 23/124 (18%), Gaps = 1/124 (0%)

Query: 50  FVGTISEMIPYSVIREIAPIP-LTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
              T  +    +  +E AP      P   + K+              K  +     +   
Sbjct: 445 PAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPA 504

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
             +               + P                 K     E  E         +  
Sbjct: 505 PTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPT 564

Query: 169 SGAR 172
           +  +
Sbjct: 565 TTTK 568



 Score = 48.9 bits (115), Expect = 0.002,   Method: Composition-based stats.
 Identities = 9/119 (7%), Positives = 19/119 (15%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
           +  E  P +  +E AP     P     K+                         +   + 
Sbjct: 557 SPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAE 616

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
                         + P         +        +           +     S     
Sbjct: 617 PKEPAPAEPKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPP 675



 Score = 48.5 bits (114), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 28/126 (22%), Gaps = 4/126 (3%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTI-PLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
                 +    +  +E AP   T  P   E  + +P+           K  +     +  
Sbjct: 520 PAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPA 579

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLIL--GLSKKELLAKNKVGREDTEVPAMDKNFC 165
                +      T+  +  + P              +         +E T          
Sbjct: 580 PTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPS 639

Query: 166 SNASGA 171
           S    A
Sbjct: 640 SPDIPA 645



 Score = 45.4 bits (106), Expect = 0.015,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 26/121 (21%), Gaps = 3/121 (2%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDS--SQHDGQIQNDI 110
           T  E  P +  +E AP         ++    +           +      +      +  
Sbjct: 368 TPKEPAPTTTPKEPAPTTKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKE 427

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
              T   K    TS         +     S KE        +E       +         
Sbjct: 428 PTPTTTPKEPAPTSPKEPAPTSPKEPAPTSPKEPAPTT-TPKEPAPTDPKEPAPAEPKEP 486

Query: 171 A 171
           A
Sbjct: 487 A 487



 Score = 43.5 bits (101), Expect = 0.060,   Method: Composition-based stats.
 Identities = 11/134 (8%), Positives = 32/134 (23%), Gaps = 7/134 (5%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNI---EDKQSPSKRDNNTVCNQLKNDSS--- 100
           +        +    +  +E AP   T          + +P+           +   +   
Sbjct: 567 TKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPK 626

Query: 101 QHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM 160
           +        ++  +       ++   +  T  E      S  E   +  +      +   
Sbjct: 627 EPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENS 686

Query: 161 DK-NFCSNASGARI 173
            K        G ++
Sbjct: 687 PKEPAVPTIKGPKV 700



 Score = 39.7 bits (91), Expect = 0.78,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 29/127 (22%), Gaps = 1/127 (0%)

Query: 46  ISHAFVGTISEMIPYSVIREIAPIPLTIP-LNIEDKQSPSKRDNNTVCNQLKNDSSQHDG 104
           I+ +   T  +  P +  +E AP     P      + +P+           + + +  + 
Sbjct: 336 ITRSPTPTTPKDPPPTHPKEPAPTNNKEPTPTTPKEPAPTTTPKEPAPTTKEPEPTTKEP 395

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
                            + +    P          +           +E       +   
Sbjct: 396 APTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKEPAPTSPKEPAP 455

Query: 165 CSNASGA 171
            S    A
Sbjct: 456 TSPKEPA 462


>gi|189181718|ref|NP_001099432.2| proteoglycan 4 [Rattus norvegicus]
          Length = 1060

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 25/125 (20%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           S     T  +    ++ +E AP           + +P+           +   +      
Sbjct: 353 SKEPAPTTPKEPELTIPKEPAPTTKKPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPA 412

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
                      K    T+         +     + KE     K          +      
Sbjct: 413 LTTPKEPAPTPKEPEPTTPKEPAPTTRKEPAPTTPKEPAPTTKKPELTIPKEPVPTTPKE 472

Query: 167 NASGA 171
            A   
Sbjct: 473 PAPTT 477



 Score = 55.1 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/122 (9%), Positives = 27/122 (22%)

Query: 46  ISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQ 105
           I      T  +  P +        P         + +P+      +    +   +  + +
Sbjct: 368 IPKEPAPTTKKPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPALTTPKEPAPTPKEPE 427

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
                       K    T+        ++  L + K+ +    K     T          
Sbjct: 428 PTTPKEPAPTTRKEPAPTTPKEPAPTTKKPELTIPKEPVPTTPKEPAPTTPKEPAPTTTK 487

Query: 166 SN 167
             
Sbjct: 488 KP 489



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 24/114 (21%), Gaps = 1/114 (0%)

Query: 59  PYSVIREIAPIPLTIPLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVN 117
           P    ++ AP     P      + +P+           +   +            +    
Sbjct: 372 PAPTTKKPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPALTTPKEPAPTPKEPEPTTP 431

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
           K    T+         +     +KK  L   K     T            A   
Sbjct: 432 KEPAPTTRKEPAPTTPKEPAPTTKKPELTIPKEPVPTTPKEPAPTTPKEPAPTT 485



 Score = 51.2 bits (121), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 11/107 (10%), Positives = 20/107 (18%)

Query: 65  EIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTS 124
           E  P     P     + +P+      +    +   +                 K    T+
Sbjct: 340 EPVPTTTKGPEPTSKEPAPTTPKEPELTIPKEPAPTTKKPAPTTPKEPAPTTPKEPAPTT 399

Query: 125 IDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
                    +     + KE     K     T            A   
Sbjct: 400 PKEPAPTTPKEPALTTPKEPAPTPKEPEPTTPKEPAPTTRKEPAPTT 446



 Score = 50.5 bits (119), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 15/111 (13%), Positives = 31/111 (27%), Gaps = 1/111 (0%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP P         + +P+ R         +   +    ++   
Sbjct: 403 PAPTTPKEPALTTPKEPAPTPKEPEPTTPKEPAPTTRKEPAPTTPKEPAPTTKKPELTIP 462

Query: 110 ISG-KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPA 159
                T   +P  +T  +  PT  ++  L   K+      K          
Sbjct: 463 KEPVPTTPKEPAPTTPKEPAPTTTKKPELSTPKEPTSTNPKEPEPTLPKEP 513



 Score = 49.3 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/133 (10%), Positives = 33/133 (24%), Gaps = 9/133 (6%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIED---------KQSPSKRDNNTVCNQLKN 97
           +     T  +    +  +E AP     P              + +P+ ++      +   
Sbjct: 376 TKKPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPALTTPKEPAPTPKEPEPTTPKEPA 435

Query: 98  DSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV 157
            +++ +              KP  +   + +PT  +       K+      K     T  
Sbjct: 436 PTTRKEPAPTTPKEPAPTTKKPELTIPKEPVPTTPKEPAPTTPKEPAPTTTKKPELSTPK 495

Query: 158 PAMDKNFCSNASG 170
                N       
Sbjct: 496 EPTSTNPKEPEPT 508



 Score = 42.0 bits (97), Expect = 0.18,   Method: Composition-based stats.
 Identities = 13/137 (9%), Positives = 28/137 (20%), Gaps = 12/137 (8%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQ------SPSKRDNNTVCNQLKNDSSQHD 103
              T  +    +  +E AP     P     K        P              + +   
Sbjct: 426 PEPTTPKEPAPTTRKEPAPTTPKEPAPTTKKPELTIPKEPVPTTPKEPAPTTPKEPAPTT 485

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIE------ERLILGLSKKELLAKNKVGREDTEV 157
            +     + K   +   +          E             +  EL+A+         +
Sbjct: 486 TKKPELSTPKEPTSTNPKEPEPTLPKEPELTLPEEPEPSNPETSDELIAELAEAPTPKAL 545

Query: 158 PAMDKNFCSNASGARIA 174
               K          ++
Sbjct: 546 ENNPKEPTVPTETPEVS 562


>gi|326787386|dbj|BAK08439.1| putative papain-like cysteine prorease [Plasmodium inui]
          Length = 1104

 Score = 55.8 bits (133), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 7/117 (5%), Positives = 19/117 (16%), Gaps = 2/117 (1%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS--QHDGQIQNDI 110
           T  +     V R   P     P   +   +             +   +            
Sbjct: 122 TQGDSRTEGVPRTPTPSATQTPPATQTPPATQTPPATQTPPATQTPPATQTPPATQTPPA 181

Query: 111 SGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
           +      +   +T                + +             +V +        
Sbjct: 182 TQTPPATQTPPATQTPPATQTPPATQTPPATQVAAPLPPSSPNPIQVKSFLLRDHKG 238



 Score = 45.8 bits (107), Expect = 0.010,   Method: Composition-based stats.
 Identities = 4/107 (3%), Positives = 13/107 (12%), Gaps = 2/107 (1%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
                      R         P   +   +             +   +            
Sbjct: 116 AQPGSTTQGDSRTEGVPRTPTPSATQTPPATQTPPATQTPPATQTPPATQTPPATQTPPA 175

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPA 159
                      +  + P  +                   +    +P 
Sbjct: 176 TQTPPATQTPPATQTPPATQTPPATQTP--PATQTPPATQVAAPLPP 220


>gi|260825178|ref|XP_002607544.1| hypothetical protein BRAFLDRAFT_106493 [Branchiostoma floridae]
 gi|229292891|gb|EEN63554.1| hypothetical protein BRAFLDRAFT_106493 [Branchiostoma floridae]
          Length = 657

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 37/124 (29%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           + A +  +S   P +     +P   + P + ++  +P   DN +V     N S+      
Sbjct: 171 NEAQLAALSPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDN 230

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
            +        + P    +  + P+ +   +   +       +         P       S
Sbjct: 231 PSAPPSPDNPSVPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPS 290

Query: 167 NASG 170
             + 
Sbjct: 291 PDNP 294



 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/121 (9%), Positives = 30/121 (24%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                +   P +     +P   ++P + ++  +P   DN +      N S        + 
Sbjct: 192 PDNPSAPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSVPPSPDNPSA 251

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                  + P  + +  + P+ +               +                 S  +
Sbjct: 252 PPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDNPSAHPSHDNRSAPPSPDN 311

Query: 170 G 170
            
Sbjct: 312 P 312



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/121 (9%), Positives = 29/121 (23%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                    P +     +P   ++P + ++  +P   DN +      N S+       + 
Sbjct: 237 PDNPSVPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDNPSA 296

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                  + P    +    P+ +               +         P       S  +
Sbjct: 297 HPSHDNRSAPPSPDNPSVPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDN 356

Query: 170 G 170
            
Sbjct: 357 P 357



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/122 (8%), Positives = 28/122 (22%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                +   P +     +    + P + ++  +P   DN +      N S+      ++ 
Sbjct: 246 PDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDNPSAHPSHDNRSA 305

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                  + P    +  + P+ +               +         P           
Sbjct: 306 PPSPDNPSVPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDNPSAQLVETK 365

Query: 170 GA 171
             
Sbjct: 366 TP 367



 Score = 52.0 bits (123), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/115 (9%), Positives = 28/115 (24%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
              P +     +P   + P + ++   P   DN +      N S+       +       
Sbjct: 234 PPSPDNPSVPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDN 293

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
            +      +  + P+ +   +           +         P       S  + 
Sbjct: 294 PSAHPSHDNRSAPPSPDNPSVPPSPDNPSAPPSPDNPSAPPSPDNPSAPPSPDNP 348



 Score = 50.1 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 10/126 (7%), Positives = 23/126 (18%), Gaps = 2/126 (1%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           S           P      + P               +    +        D+       
Sbjct: 196 SAPPSPDNPSAPPSPDNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSVPPSPDNPSAPPSP 255

Query: 107 QNDISGKTV--VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
            N     +    + P  + +  + P+ +               +   R     P      
Sbjct: 256 DNPSVPPSTDNPSAPPSTDNPSAPPSPDNPSAPPSPDNPSAHPSHDNRSAPPSPDNPSVP 315

Query: 165 CSNASG 170
            S  + 
Sbjct: 316 PSPDNP 321



 Score = 39.3 bits (90), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/94 (11%), Positives = 30/94 (31%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
              P +     +P   +   + +++ +P   DN +V     N S+       +       
Sbjct: 279 PPSPDNPSAPPSPDNPSAHPSHDNRSAPPSPDNPSVPPSPDNPSAPPSPDNPSAPPSPDN 338

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK 149
            + P    +  + P+ +      +  K    + +
Sbjct: 339 PSAPPSPDNPSAPPSPDNPSAQLVETKTPGTEVR 372


>gi|292397678|ref|YP_003517744.1| mucin-like protein [Lymantria xylina MNPV]
 gi|291065395|gb|ADD73713.1| mucin-like protein [Lymantria xylina MNPV]
          Length = 1054

 Score = 55.1 bits (131), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 10/117 (8%), Positives = 25/117 (21%), Gaps = 3/117 (2%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
              P   +              E    P+         +      +   +   + + + V
Sbjct: 388 HANPEFEVNTEPAAEPVPEPAAEPVPEPAAEPVPEPAAE---PVPEPAAEPVPEPAAEPV 444

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGAR 172
                      +   + E     + +       +   E    PA +      AS  +
Sbjct: 445 PELAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAEPVPEPAAESTTDKLASKRK 501


>gi|51596978|ref|YP_071169.1| hypothetical protein YPTB2659 [Yersinia pseudotuberculosis IP
           32953]
 gi|51590260|emb|CAH21897.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
          Length = 970

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/122 (9%), Positives = 21/122 (17%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A   T +     +     AP   T P         +     T   +              
Sbjct: 749 APPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETT 808

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
                T   + T      + P            +           +T  P          
Sbjct: 809 APPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETT 868

Query: 169 SG 170
           + 
Sbjct: 869 AP 870



 Score = 53.9 bits (128), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 10/116 (8%), Positives = 18/116 (15%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
                +     AP   T P         +     T   +                   T 
Sbjct: 750 PPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTA 809

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             + T      + P            +           +T  P          +  
Sbjct: 810 PPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPP 865



 Score = 53.5 bits (127), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 12/112 (10%), Positives = 21/112 (18%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           + A   T +     +     AP   T P         +     T   +            
Sbjct: 759 TTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPE 818

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVP 158
                  T   + T      + P            +           +T  P
Sbjct: 819 TTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAP 870



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/111 (9%), Positives = 18/111 (16%)

Query: 61  SVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPT 120
           +     AP   T P         +     T   +                   T   + T
Sbjct: 749 APPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETT 808

Query: 121 RSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
                 + P            +           +T  P          +  
Sbjct: 809 APPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPP 859


>gi|149773456|ref|NP_055853.1| hypothetical protein LOC643314 [Homo sapiens]
          Length = 1427

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 7/121 (5%), Positives = 19/121 (15%)

Query: 50   FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
                +      +      P P            P +  +         + +     +   
Sbjct: 1003 PAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPPEEPTSPAAAVPTPEEPTSPAAAVPTP 1062

Query: 110  ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                +            S            S    +   +            +   S A+
Sbjct: 1063 EEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPASPAA 1122

Query: 170  G 170
             
Sbjct: 1123 A 1123



 Score = 40.1 bits (92), Expect = 0.72,   Method: Composition-based stats.
 Identities = 11/143 (7%), Positives = 28/143 (19%), Gaps = 1/143 (0%)

Query: 28   GLFLLFCTFIVGLSIYILIS-HAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKR 86
               +       G+S     S       I+  I         P+     ++  ++   +  
Sbjct: 933  APAVAAAITQEGMSAVAGFSPEWAALAITVPITEEDGTPEGPVTPATTVHAPEEPDTAAV 992

Query: 87   DNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLA 146
              +T        ++    +     +      +   S +    P  E              
Sbjct: 993  RVSTPEEPASPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPPEEPTSPAAAVPTPEEP 1052

Query: 147  KNKVGREDTEVPAMDKNFCSNAS 169
             +      T              
Sbjct: 1053 TSPAAAVPTPEEPTSPAAAVPTP 1075



 Score = 37.7 bits (86), Expect = 3.5,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 25/119 (21%), Gaps = 2/119 (1%)

Query: 55   SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS-QHDGQIQNDISGK 113
             E           P     P         S      V    ++ S            S  
Sbjct: 1127 PEEPASPAAAVPTPEEPAFPAPAVPTPEESASAAVAVPTPEESASPAAAVPTPAESASFA 1186

Query: 114  TVVNKPTRSTSIDSLPTIEERLILGLSK-KELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             VV      TS  +       ++  L +     A      E   + A   N     S A
Sbjct: 1187 AVVATLEEPTSPAASVPTPAAMVATLEEFTSPAASVPTSEEPASLAAAVSNPEEPTSPA 1245


>gi|319947303|ref|ZP_08021536.1| wall-associated protein [Streptococcus australis ATCC 700641]
 gi|319746545|gb|EFV98805.1| wall-associated protein [Streptococcus australis ATCC 700641]
          Length = 471

 Score = 54.3 bits (129), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/119 (12%), Positives = 31/119 (26%)

Query: 64  REIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRST 123
           +E  P       +          D      Q     S      +     K   +      
Sbjct: 336 KEQTPPTPDPEPSKPQPDPKPSPDPEPSRPQPDPKPSPDPEPSKPQPDPKPSPDPEPSKP 395

Query: 124 SIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAIVVSGLGI 182
             D  P+ +          +    +    ++ E P   K     ++G ++  V+  +GI
Sbjct: 396 QPDPKPSPDPEPSKSQPDPKSSNSSSTSVKEEEAPKPGKKKVLPSTGEKMTPVIILVGI 454



 Score = 40.1 bits (92), Expect = 0.69,   Method: Composition-based stats.
 Identities = 11/90 (12%), Positives = 20/90 (22%)

Query: 54  ISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
             +  P        P P   P     K  P  + +            +     +   S  
Sbjct: 353 DPKPSPDPEPSRPQPDPKPSPDPEPSKPQPDPKPSPDPEPSKPQPDPKPSPDPEPSKSQP 412

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKE 143
              +  + STS+      +      L    
Sbjct: 413 DPKSSNSSSTSVKEEEAPKPGKKKVLPSTG 442


>gi|50555714|ref|XP_505265.1| YALI0F10901p [Yarrowia lipolytica]
 gi|49651135|emb|CAG78072.1| YALI0F10901p [Yarrowia lipolytica]
          Length = 814

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/129 (10%), Positives = 29/129 (22%), Gaps = 6/129 (4%)

Query: 54  ISEMIPYSVIREIAPIP----LTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
             E  P   I +  P P          ++ + +P          +      +        
Sbjct: 679 KPEPTPEKPIVKPEPTPETLSKPEEPVVKPEPTPEVPVTPGPEPETPAPRPEEPTPEAPV 738

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
             G        R         +                       T  P  +    ++A+
Sbjct: 739 TPGPEPETPAPRPEEPTPEVPVTPGPEPETPAPRPEEPTPESPV-TPGPEPETPQANSAT 797

Query: 170 GARI-AIVV 177
             ++ A+V+
Sbjct: 798 KMKVGALVL 806



 Score = 49.7 bits (117), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/119 (7%), Positives = 16/119 (13%), Gaps = 1/119 (0%)

Query: 54  ISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
             E      I +  P P    +  E       +    V               + +    
Sbjct: 668 KPEPTSEKPIVKPEPTPEKPIVKPEPTPETLSKPEEPVVKPEPTPEVPVTPGPEPETPAP 727

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKN-KVGREDTEVPAMDKNFCSNASGA 171
                   +                    E+              P           G 
Sbjct: 728 RPEEPTPEAPVTPGPEPETPAPRPEEPTPEVPVTPGPEPETPAPRPEEPTPESPVTPGP 786



 Score = 48.1 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/117 (11%), Positives = 22/117 (18%)

Query: 54  ISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
             E  P   I +  P      +  E                L                  
Sbjct: 657 KPEPTPEKPIVKPEPTSEKPIVKPEPTPEKPIVKPEPTPETLSKPEEPVVKPEPTPEVPV 716

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
           T   +P         PT E  +  G   +    + +    +  V    +        
Sbjct: 717 TPGPEPETPAPRPEEPTPEAPVTPGPEPETPAPRPEEPTPEVPVTPGPEPETPAPRP 773



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/139 (9%), Positives = 29/139 (20%), Gaps = 14/139 (10%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKR-----DNNTVCNQLKNDSSQ 101
           +   V +  +  P        P P      ++ + +P K        +         + +
Sbjct: 626 TDIPVESTPKPQPKPTTLVTKPQPSPEKPVVKPEPTPEKPIVKPEPTSEKPIVKPEPTPE 685

Query: 102 HD-----GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKN----KVGR 152
                     +     +  V KP  +  +   P  E        ++              
Sbjct: 686 KPIVKPEPTPETLSKPEEPVVKPEPTPEVPVTPGPEPETPAPRPEEPTPEAPVTPGPEPE 745

Query: 153 EDTEVPAMDKNFCSNASGA 171
                P           G 
Sbjct: 746 TPAPRPEEPTPEVPVTPGP 764



 Score = 47.0 bits (110), Expect = 0.005,   Method: Composition-based stats.
 Identities = 11/101 (10%), Positives = 22/101 (21%)

Query: 44  ILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHD 103
           I+       T+S+     V  E  P     P    +  +P   +             +  
Sbjct: 688 IVKPEPTPETLSKPEEPVVKPEPTPEVPVTPGPEPETPAPRPEEPTPEAPVTPGPEPETP 747

Query: 104 GQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKEL 144
                + + +  V       +    P             E 
Sbjct: 748 APRPEEPTPEVPVTPGPEPETPAPRPEEPTPESPVTPGPEP 788



 Score = 40.1 bits (92), Expect = 0.73,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 34/123 (27%), Gaps = 5/123 (4%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT 114
           + ++     + I  +    P +I  + +P  +   T        S +           K 
Sbjct: 606 TTVVTVIDNKTITVVLPCDPTDIPVESTPKPQPKPTTLVTKPQPSPEKPVVKPEPTPEKP 665

Query: 115 VVNKPTRSTSI--DSLPTIEERLILGLSKKELL---AKNKVGREDTEVPAMDKNFCSNAS 169
           +V     S        PT E+ ++      E L    +  V  E T    +         
Sbjct: 666 IVKPEPTSEKPIVKPEPTPEKPIVKPEPTPETLSKPEEPVVKPEPTPEVPVTPGPEPETP 725

Query: 170 GAR 172
             R
Sbjct: 726 APR 728


>gi|237838523|ref|XP_002368559.1| ankyrin repeat-containing protein, conserved [Toxoplasma gondii ME49]
 gi|211966223|gb|EEB01419.1| ankyrin repeat-containing protein, conserved [Toxoplasma gondii ME49]
          Length = 1599

 Score = 54.3 bits (129), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 8/111 (7%), Positives = 14/111 (12%)

Query: 53   TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
                           P        +       K        + K       G+ +     
Sbjct: 1489 APPPPPSGEKKAPPPPPSGEKKAPLPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPPP 1548

Query: 113  KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKN 163
             +   K                         L  K        +     K 
Sbjct: 1549 PSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPLGKKKGPPLLGKKGLPPPKK 1599



 Score = 50.5 bits (119), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 12/105 (11%), Positives = 20/105 (19%), Gaps = 6/105 (5%)

Query: 62   VIREIAPIPLT------IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
               + AP P         P     ++       +          S          SG+  
Sbjct: 1484 AQEKKAPPPPPSGEKKAPPPPPSGEKKAPLPPPSGEKKAPPPPPSGEKKAPPPPPSGEKK 1543

Query: 116  VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAM 160
               P  S    + P                 K        + P +
Sbjct: 1544 APPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPLGKKKGPPL 1588



 Score = 50.5 bits (119), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/116 (11%), Positives = 23/116 (19%), Gaps = 1/116 (0%)

Query: 56   EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
              +         P     P   ++K++P    +          S +         SG+  
Sbjct: 1463 APLTGQTAPPAPPEAKAEPAGAQEKKAPPPPPSGEKKAPPPPPSGEKKA-PLPPPSGEKK 1521

Query: 116  VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
               P  S    + P                 K       +          S    A
Sbjct: 1522 APPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKA 1577



 Score = 49.7 bits (117), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/113 (12%), Positives = 23/113 (20%), Gaps = 8/113 (7%)

Query: 53   TISEMIPYSVIREIAPIP------LTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
                  P    +   P P         P + E K  P                 +     
Sbjct: 1488 KAPPPPPSGEKKAPPPPPSGEKKAPLPPPSGEKKAPPPPPSGEKKAPPPPPSGEKK--AP 1545

Query: 107  QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPA 159
                SG+     P  S    + P             +      +G++    P 
Sbjct: 1546 PPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPLGKKKGPPLLGKKGLPPPK 1598



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 7/126 (5%), Positives = 16/126 (12%), Gaps = 1/126 (0%)

Query: 49   AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKND-SSQHDGQIQ 107
            A +   +        +                    K        + K         +  
Sbjct: 1463 APLTGQTAPPAPPEAKAEPAGAQEKKAPPPPPSGEKKAPPPPPSGEKKAPLPPPSGEKKA 1522

Query: 108  NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
                       P    S +             +     +  K                  
Sbjct: 1523 PPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPLGK 1582

Query: 168  ASGARI 173
              G  +
Sbjct: 1583 KKGPPL 1588



 Score = 40.1 bits (92), Expect = 0.58,   Method: Composition-based stats.
 Identities = 10/86 (11%), Positives = 16/86 (18%), Gaps = 3/86 (3%)

Query: 50   FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              G      P     + AP P   P + E K  P                 +        
Sbjct: 1516 PSGEKKAPPPPPSGEKKAPPP---PPSGEKKAPPPPPSGEKKAPPPPPSGEKKAPPPPPS 1572

Query: 110  ISGKTVVNKPTRSTSIDSLPTIEERL 135
               K       +   +     +    
Sbjct: 1573 GEKKAPPLGKKKGPPLLGKKGLPPPK 1598


>gi|258516322|ref|YP_003192544.1| polysaccharide deacetylase [Desulfotomaculum acetoxidans DSM 771]
 gi|257780027|gb|ACV63921.1| polysaccharide deacetylase [Desulfotomaculum acetoxidans DSM 771]
          Length = 295

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 20/44 (45%)

Query: 347 IARTTGQAIGVAVAFDESIEVISQWLQQEHVRDVSVVPLSCLAK 390
           +A+    AI +    + +I+ +   ++    R   +V +S L K
Sbjct: 194 LAKAHNGAIVLMHPTEPTIKALPNIIKDLKDRGYELVTVSQLLK 237


>gi|50543616|ref|XP_499974.1| YALI0A11198p [Yarrowia lipolytica]
 gi|49645839|emb|CAG83903.1| YALI0A11198p [Yarrowia lipolytica]
          Length = 741

 Score = 53.5 bits (127), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 9/114 (7%), Positives = 20/114 (17%), Gaps = 2/114 (1%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
           +  E  P S   + AP               S    +   +                 +G
Sbjct: 617 SKPEPKPESPEGKPAPSGPASGPAPAPSGPASGPAPSGPASGPAPSGPASGPAPSGPAAG 676

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
                  +         +        + +     +        +      N  S
Sbjct: 677 PAPSGPASGPAPSGPAASPAPSGPAAVPQAP--EQAPEQSVPAQANGAVTNGVS 728



 Score = 50.1 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 7/90 (7%), Positives = 11/90 (12%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
                  +  P       AP P             S    +   +               
Sbjct: 622 KPESPEGKPAPSGPASGPAPAPSGPASGPAPSGPASGPAPSGPASGPAPSGPAAGPAPSG 681

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILG 138
             SG                   +      
Sbjct: 682 PASGPAPSGPAASPAPSGPAAVPQAPEQAP 711



 Score = 46.2 bits (108), Expect = 0.010,   Method: Composition-based stats.
 Identities = 11/121 (9%), Positives = 18/121 (14%), Gaps = 8/121 (6%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT 114
                 S        P   P        P+   +                      SG  
Sbjct: 611 PAPSGESKPEPKPESPEGKPAPSGPASGPAPAPSGPASGPAP-SGPASGPAPSGPASG-- 667

Query: 115 VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIA 174
                   +   + P                +    G              S  + A  A
Sbjct: 668 -----PAPSGPAAGPAPSGPASGPAPSGPAASPAPSGPAAVPQAPEQAPEQSVPAQANGA 722

Query: 175 I 175
           +
Sbjct: 723 V 723



 Score = 36.6 bits (83), Expect = 6.6,   Method: Composition-based stats.
 Identities = 10/92 (10%), Positives = 16/92 (17%), Gaps = 5/92 (5%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A  G  S   P       AP             +                +         
Sbjct: 642 APSGPASGPAPSGPASGPAPSGPASGPAPSGPAA-----GPAPSGPASGPAPSGPAASPA 696

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLS 140
                 V   P ++            +  G+S
Sbjct: 697 PSGPAAVPQAPEQAPEQSVPAQANGAVTNGVS 728


>gi|158514816|sp|O94854|K0754_HUMAN RecName: Full=Uncharacterized protein KIAA0754
          Length = 1291

 Score = 53.2 bits (126), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 7/121 (5%), Positives = 19/121 (15%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
               +      +      P P            P +  +         + +     +   
Sbjct: 867 PAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPPEEPTSPAAAVPTPEEPTSPAAAVPTP 926

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
               +            S            S    +   +            +   S A+
Sbjct: 927 EEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPASPAA 986

Query: 170 G 170
            
Sbjct: 987 A 987



 Score = 39.3 bits (90), Expect = 1.2,   Method: Composition-based stats.
 Identities = 11/143 (7%), Positives = 28/143 (19%), Gaps = 1/143 (0%)

Query: 28  GLFLLFCTFIVGLSIYILIS-HAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKR 86
              +       G+S     S       I+  I         P+     ++  ++   +  
Sbjct: 797 APAVAAAITQEGMSAVAGFSPEWAALAITVPITEEDGTPEGPVTPATTVHAPEEPDTAAV 856

Query: 87  DNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLA 146
             +T        ++    +     +      +   S +    P  E              
Sbjct: 857 RVSTPEEPASPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPPEEPTSPAAAVPTPEEP 916

Query: 147 KNKVGREDTEVPAMDKNFCSNAS 169
            +      T              
Sbjct: 917 TSPAAAVPTPEEPTSPAAAVPTP 939



 Score = 37.0 bits (84), Expect = 6.2,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 25/119 (21%), Gaps = 2/119 (1%)

Query: 55   SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS-QHDGQIQNDISGK 113
             E           P     P         S      V    ++ S            S  
Sbjct: 991  PEEPASPAAAVPTPEEPAFPAPAVPTPEESASAAVAVPTPEESASPAAAVPTPAESASFA 1050

Query: 114  TVVNKPTRSTSIDSLPTIEERLILGLSK-KELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             VV      TS  +       ++  L +     A      E   + A   N     S A
Sbjct: 1051 AVVATLEEPTSPAASVPTPAAMVATLEEFTSPAASVPTSEEPASLAAAVSNPEEPTSPA 1109


>gi|180482|gb|AAA52014.1| cholesterol esterase [Homo sapiens]
          Length = 747

 Score = 53.2 bits (126), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 26/124 (20%), Gaps = 5/124 (4%)

Query: 53  TISEMIPYSVIREIAPIPLT-----IPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
           + +  +P +   E AP+P T      P+                        +   G   
Sbjct: 569 SEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPP 628

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
              +G +       +    + P                         T          + 
Sbjct: 629 VPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTG 688

Query: 168 ASGA 171
            SGA
Sbjct: 689 DSGA 692



 Score = 50.8 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 24/123 (19%), Gaps = 5/123 (4%)

Query: 54  ISEMIPYSVIREIAPIPL-----TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
            +  +P +   E  P+P      T P+                        +   G    
Sbjct: 559 EATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPV 618

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
             +G +       +    + P                         T          +  
Sbjct: 619 PPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGD 678

Query: 169 SGA 171
           SGA
Sbjct: 679 SGA 681



 Score = 43.5 bits (101), Expect = 0.052,   Method: Composition-based stats.
 Identities = 10/124 (8%), Positives = 16/124 (12%), Gaps = 4/124 (3%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
             G              AP       +      P   D+         DS         D
Sbjct: 587 PTGDSGAPPVPPTGDSGAPPVPPTGDSGAP-PVPPTGDSGAPPVPPTGDSGAPPVPPTGD 645

Query: 110 ISGKTVV--NKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
                V             +        +              G           +  + 
Sbjct: 646 SGAPPVPPTGDSGAPPVPPTGDAGPPP-VPPTGDSGAPPVPPTGDSGAPPVTPTGDSETA 704

Query: 168 ASGA 171
               
Sbjct: 705 PVPP 708



 Score = 41.2 bits (95), Expect = 0.26,   Method: Composition-based stats.
 Identities = 14/128 (10%), Positives = 22/128 (17%), Gaps = 5/128 (3%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
             G              AP       +      P   D+         DS         D
Sbjct: 598 PTGDSGAPPVPPTGDSGAPPVPPTGDSGAP-PVPPTGDSGAPPVPPTGDSGAPPVPPTGD 656

Query: 110 ISGKTVV--NKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
                V             +  +    +                 E   VP    +    
Sbjct: 657 SGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPC 716

Query: 168 ASGARIAI 175
           A   R+ +
Sbjct: 717 A--PRVTL 722



 Score = 37.7 bits (86), Expect = 3.6,   Method: Composition-based stats.
 Identities = 8/107 (7%), Positives = 17/107 (15%), Gaps = 6/107 (5%)

Query: 56  EMIPYSVIREIAPIPL------TIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
             +P +      P+P              D  +P               +          
Sbjct: 627 PPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPP 686

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTE 156
                         S  +            + +  L       + T 
Sbjct: 687 TGDSGAPPVTPTGDSETAPVPPTGDSGAPCAPRVTLRLPLCPPQMTP 733


>gi|211971002|dbj|BAG82830.1| hypothetical protein [Pasteurella pneumotropica]
          Length = 1377

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/143 (7%), Positives = 29/143 (20%), Gaps = 15/143 (10%)

Query: 38  VGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKN 97
           +G+  +       + ++         +++ P     P     +              ++ 
Sbjct: 115 LGIFGFSAFI---LSSLMLATTRKDRKKVQPTVEEKPAEEPTESVQPTEPTEKPAEPVEP 171

Query: 98  DSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEV 157
                  +            +P                +      E   K     E  + 
Sbjct: 172 AQPTEPTE---------KPAEPVEPAQPTEPTEKPPEPVEPAQPTEPTEKPAEPTEPAQP 222

Query: 158 PAMDKNFCSNASGARIAIVVSGL 180
               K           AIV+  +
Sbjct: 223 TETPKVEEEKRLP---AIVLDDI 242


>gi|20521149|dbj|BAA34474.2| KIAA0754 protein [Homo sapiens]
          Length = 1174

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 7/121 (5%), Positives = 19/121 (15%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
               +      +      P P            P +  +         + +     +   
Sbjct: 750 PAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPPEEPTSPAAAVPTPEEPTSPAAAVPTP 809

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
               +            S            S    +   +            +   S A+
Sbjct: 810 EEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPTPEEPASPAA 869

Query: 170 G 170
            
Sbjct: 870 A 870



 Score = 38.5 bits (88), Expect = 1.7,   Method: Composition-based stats.
 Identities = 11/143 (7%), Positives = 29/143 (20%), Gaps = 1/143 (0%)

Query: 28  GLFLLFCTFIVGLSIYILISHAFVG-TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKR 86
              +       G+S     S  +    I+  I         P+     ++  ++   +  
Sbjct: 680 APAVAAAITQEGMSAVAGFSPEWAALAITVPITEEDGTPEGPVTPATTVHAPEEPDTAAV 739

Query: 87  DNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLA 146
             +T        ++    +     +      +   S +    P  E              
Sbjct: 740 RVSTPEEPASPAAAVPTPEEPTSPAAAVPTPEEPTSPAAAVPPPEEPTSPAAAVPTPEEP 799

Query: 147 KNKVGREDTEVPAMDKNFCSNAS 169
            +      T              
Sbjct: 800 TSPAAAVPTPEEPTSPAAAVPTP 822



 Score = 36.2 bits (82), Expect = 9.2,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 25/119 (21%), Gaps = 2/119 (1%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS-QHDGQIQNDISGK 113
            E           P     P         S      V    ++ S            S  
Sbjct: 874 PEEPASPAAAVPTPEEPAFPAPAVPTPEESASAAVAVPTPEESASPAAAVPTPAESASFA 933

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSK-KELLAKNKVGREDTEVPAMDKNFCSNASGA 171
            VV      TS  +       ++  L +     A      E   + A   N     S A
Sbjct: 934 AVVATLEEPTSPAASVPTPAAMVATLEEFTSPAASVPTSEEPASLAAAVSNPEEPTSPA 992


>gi|323450255|gb|EGB06137.1| hypothetical protein AURANDRAFT_65843 [Aureococcus anophagefferens]
          Length = 3712

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 15/165 (9%), Positives = 31/165 (18%), Gaps = 13/165 (7%)

Query: 52   GTISEMIPYSVIREIAPIPL---TIPLNIEDKQSPSKRDNNTVCNQL---KNDSSQHDGQ 105
            G          +   AP                +P+    +            +      
Sbjct: 3065 GVAPAPTAGEFVDAPAPTAGFVDAPAPTASPVAAPTAATVDAPAPTAATVDAPAPTAATV 3124

Query: 106  IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
                 +  TV      + ++D+       +         +          + PA      
Sbjct: 3125 DAPAPTAATVDAPAPTAATVDAPAPTAATVDAPAPTAATVDAPSPTAATVDAPAPTA-AT 3183

Query: 166  SNASGARIAIVVSGLGISQTGTQRAINLLPANITLAFASNGNSLD 210
             +A     A V             A    PA       +   +  
Sbjct: 3184 VDAPAPTAATV------DAPAPTAATVDAPAPTAATVDAPAPTAA 3222


>gi|13472161|ref|NP_103728.1| serine/threonine kinase [Mesorhizobium loti MAFF303099]
 gi|14022906|dbj|BAB49514.1| serine/threonine kinase [Mesorhizobium loti MAFF303099]
          Length = 857

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 41/159 (25%), Gaps = 1/159 (0%)

Query: 18  SFYSQIISRLGLFLLFCTFIVGLSIYILISHAFVGTISEMIPYSVIREIAPIPLTIPLNI 77
              S  +  +   L+    ++G  +Y     A      ++ P +      P+        
Sbjct: 357 PRKSSRMPAVAGGLVTLAVLLGGGLYFSGILAPPPAEEKLKPLTPKPVPKPVVEAPKPVA 416

Query: 78  EDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTVVNKP-TRSTSIDSLPTIEERLI 136
           E  Q         V  Q +     +   I+          +      + +  P +     
Sbjct: 417 ETPQPDESNPPPPVQPQPEPSKPDNAATIETVNPPALPDAQVKPPVPAENQAPGVPPATE 476

Query: 137 LGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGARIAI 175
                ++      VG+  +     +    S A    + I
Sbjct: 477 ARQPAEQAPVAPPVGKPASPTVQPETTANSQAQAPPVEI 515


>gi|296478893|gb|DAA21008.1| proteoglycan 4 [Bos taurus]
          Length = 1445

 Score = 52.8 bits (125), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/123 (8%), Positives = 22/123 (17%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
               T  +    +  +E  P           + +P+           +   +  +     
Sbjct: 371 KPAPTTPKETAPTXPKEPEPTTKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTT 430

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
                    K    T+         +     + KE           T            A
Sbjct: 431 PKEPAPTTPKEPAPTTPKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPA 490

Query: 169 SGA 171
              
Sbjct: 491 PTT 493



 Score = 52.4 bits (124), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 26/127 (20%), Gaps = 4/127 (3%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRD----NNTVCNQLKNDSSQHDG 104
           A   T  E  P +  +E AP     P   E K+            T   +      +   
Sbjct: 745 APTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPA 804

Query: 105 QIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNF 164
                    T   K               +     +  +  A     +E       +   
Sbjct: 805 PTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAP 864

Query: 165 CSNASGA 171
                 A
Sbjct: 865 AEPKEPA 871



 Score = 51.6 bits (122), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/127 (8%), Positives = 26/127 (20%), Gaps = 1/127 (0%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQ-HDGQ 105
           +     T  +    +  +E AP           + +P+           +   +   + +
Sbjct: 392 TKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKEPAPTTPKEPAPTTPKEPE 451

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
                       K    T+        +       K+      K     T          
Sbjct: 452 PTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTTPKEPAPTTPK 511

Query: 166 SNASGAR 172
             A   +
Sbjct: 512 EPAPTTK 518



 Score = 50.8 bits (120), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/117 (10%), Positives = 27/117 (23%), Gaps = 3/117 (2%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKT 114
            +    +  +E AP     P      + P+  D          +  +       + +  T
Sbjct: 692 PKEPAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPK---EPAPAEPKEPAPTSSKEPAPTT 748

Query: 115 VVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
              +P  +T+       + +       KE    +      T                
Sbjct: 749 TTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAP 805



 Score = 50.8 bits (120), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 22/125 (17%), Gaps = 3/125 (2%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSS---QHDGQI 106
              T  +    +  +E  P     P     K+        T     +   +   Q     
Sbjct: 434 PAPTTPKEPAPTTPKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTT 493

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCS 166
               +  T       +    +  T E        +                P   K    
Sbjct: 494 PKQPAPTTPKEPAPTTPKEPAPTTKEPAPTTKEPEPTTKEPAPTTTPKEPAPTTPKEPAP 553

Query: 167 NASGA 171
                
Sbjct: 554 TTKEP 558



 Score = 50.5 bits (119), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 13/119 (10%), Positives = 25/119 (21%), Gaps = 1/119 (0%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQNDIS 111
           +  E  P +  +E AP     P   E  + +P+           K  +     +      
Sbjct: 707 SPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTTPKEPAPTD 766

Query: 112 GKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
            K       +  +  S                   +          P       + A  
Sbjct: 767 PKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEP 825



 Score = 50.1 bits (118), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 24/123 (19%), Gaps = 2/123 (1%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDS--SQHDGQIQ 107
              T  +    +  ++ AP     P     K++             +      +      
Sbjct: 442 PAPTTPKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTT 501

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
                 T   +P  +T   +  T E              K        E     K     
Sbjct: 502 PKEPAPTTPKEPAPTTKEPAPTTKEPEPTTKEPAPTTTPKEPAPTTPKEPAPTTKEPEPT 561

Query: 168 ASG 170
              
Sbjct: 562 TLK 564



 Score = 49.7 bits (117), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 26/126 (20%), Gaps = 4/126 (3%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNI----EDKQSPSKRDNNTVCNQLKNDSSQHDGQ 105
              T  +    +  +E AP     P       E   +  K    T   +    ++  +  
Sbjct: 762 PAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPA 821

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFC 165
                       K    T+    P                      +E       +    
Sbjct: 822 PAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPN 881

Query: 166 SNASGA 171
           S  + A
Sbjct: 882 SPETLA 887



 Score = 49.7 bits (117), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 14/116 (12%), Positives = 29/116 (25%), Gaps = 3/116 (2%)

Query: 56  EMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGKTV 115
           E  P +  +E AP          D + P+  +          + +      +        
Sbjct: 743 EPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAP---AE 799

Query: 116 VNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
             +P  ++  +  PT   +       KE    +      T          +    A
Sbjct: 800 PKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPA 855



 Score = 49.3 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 8/123 (6%), Positives = 23/123 (18%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP           + +P+           + + +         
Sbjct: 403 PAPTTPKEPAPTTPKETAPTTKEPAPTTPKEPAPTTPKEPAPTTPKEPEPTTPKQPAPTT 462

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                       + +         +     + K+           T            A 
Sbjct: 463 PKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTTPKEPAPTTPKEPAPTTKEPAP 522

Query: 170 GAR 172
             +
Sbjct: 523 TTK 525



 Score = 49.3 bits (116), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/117 (9%), Positives = 26/117 (22%), Gaps = 1/117 (0%)

Query: 55  SEMIPYSVIREIAPIPLTIPLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISGK 113
            +    +  +E AP     P      + +P+         + K  +     +     + K
Sbjct: 759 PKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTK 818

Query: 114 TVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASG 170
                  +  +  S                   K     +  E    +    + A  
Sbjct: 819 EPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEP 875



 Score = 48.9 bits (115), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 29/123 (23%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP           + +P+           +   +         
Sbjct: 450 PEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTTPKEPAPTT 509

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                   K    T+ +  PT +E       K+      K     T+ P          +
Sbjct: 510 PKEPAPTTKEPAPTTKEPEPTTKEPAPTTTPKEPAPTTPKEPAPTTKEPEPTTLKQPAPT 569

Query: 170 GAR 172
             +
Sbjct: 570 TPK 572



 Score = 48.1 bits (113), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/107 (12%), Positives = 20/107 (18%), Gaps = 5/107 (4%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCN-----QLKNDSSQHDGQIQ 107
           +  E  P +  +E AP     P     K+                        +      
Sbjct: 782 SPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTT 841

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGRED 154
                 T   K    T        E +       KE    +      
Sbjct: 842 TKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAP 888



 Score = 47.8 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/129 (7%), Positives = 24/129 (18%), Gaps = 4/129 (3%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDK-QSPSKRDNNTVCNQLKNDSSQHDGQ 105
           +     T  +    +  +E AP     P     K  +P+           +   +  +  
Sbjct: 423 TKEPAPTTPKEPAPTTPKEPAPTTPKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPA 482

Query: 106 IQNDISGKTVVNKPTRSTSIDSLPTIEERLILGL---SKKELLAKNKVGREDTEVPAMDK 162
                       K    T+         +                    +E        +
Sbjct: 483 PTTPKQPAPTTPKQPAPTTPKEPAPTTPKEPAPTTKEPAPTTKEPEPTTKEPAPTTTPKE 542

Query: 163 NFCSNASGA 171
              +     
Sbjct: 543 PAPTTPKEP 551



 Score = 47.8 bits (112), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/123 (8%), Positives = 28/123 (22%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP           + +P+           +   +         
Sbjct: 458 PAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTTPKEPAPTTPKEPAPTT 517

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
                   +P  +T   +  T  +       K+      +      + PA         +
Sbjct: 518 KEPAPTTKEPEPTTKEPAPTTTPKEPAPTTPKEPAPTTKEPEPTTLKQPAPTTPKEPAPT 577

Query: 170 GAR 172
             +
Sbjct: 578 TPK 580



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 31/129 (24%), Gaps = 4/129 (3%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSP----SKRDNNTVCNQLKNDSSQH 102
           +     T  E  P +  +E AP     P     K+       +    T   +    S + 
Sbjct: 635 TKEPEPTTKEPAPTTTTKEPAPTIPKEPAPTTPKEPAPTTHKEPTPTTTPKEPAPTSPKE 694

Query: 103 DGQIQNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDK 162
                      T   +P  +T+       + +       KE    +      T       
Sbjct: 695 PAPTSPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPA 754

Query: 163 NFCSNASGA 171
              +    A
Sbjct: 755 PTTTPKEPA 763



 Score = 47.4 bits (111), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/114 (11%), Positives = 21/114 (18%), Gaps = 1/114 (0%)

Query: 59  PYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQ-HDGQIQNDISGKTVVN 117
           P    +E  P     P     K+        T     +   +   +              
Sbjct: 388 PEPTTKEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKEPAPTTPKEPAPTTP 447

Query: 118 KPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
           K    T+         +     + KE     K     T            A   
Sbjct: 448 KEPEPTTPKQPAPTTPKEPAPTTPKETAPTTKEPAPTTPKQPAPTTPKQPAPTT 501



 Score = 47.0 bits (110), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 27/122 (22%), Gaps = 3/122 (2%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP     P      + P+     T   +      +     +  
Sbjct: 720 PAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPA---PTTTPKEPAPTDPKEPAPAEPK 776

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNAS 169
               T   +P  +T+       E +     S KE              P           
Sbjct: 777 EPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEP 836

Query: 170 GA 171
             
Sbjct: 837 AP 838



 Score = 46.6 bits (109), Expect = 0.006,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 28/123 (22%), Gaps = 1/123 (0%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQ-SPSKRDNNTVCNQLKNDSSQHDGQIQN 108
              T  E    +  +E A      P     K+ +P+         +    ++        
Sbjct: 348 PAPTTKEPALTTTTKEPASTTPKKPAPTTPKETAPTXPKEPEPTTKEPEPTTPKQPAPTT 407

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNA 168
                    K T  T+ +  PT  +       K+      K     T            A
Sbjct: 408 PKEPAPTTPKETAPTTKEPAPTTPKEPAPTTPKEPAPTTPKEPEPTTPKQPAPTTPKEPA 467

Query: 169 SGA 171
              
Sbjct: 468 PTT 470



 Score = 46.2 bits (108), Expect = 0.009,   Method: Composition-based stats.
 Identities = 10/120 (8%), Positives = 20/120 (16%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
           +  E  P S            P   + K+              K  +     +     + 
Sbjct: 699 SPKEPAPTSPKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPTSSKEPAPTTTTKEPAPTTT 758

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGAR 172
                         + P                 K     E  E         +  +  +
Sbjct: 759 PKEPAPTDPKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTK 818



 Score = 46.2 bits (108), Expect = 0.010,   Method: Composition-based stats.
 Identities = 9/119 (7%), Positives = 19/119 (15%)

Query: 53  TISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQNDISG 112
           +  E  P +  +E AP     P     K+                         +   + 
Sbjct: 807 SPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAE 866

Query: 113 KTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSNASGA 171
                         + P         +        +           +     S     
Sbjct: 867 PKEPAPAEPKEPTPNSPETLAPSSPDIPAPTTSEASTSTTTVEPSTTLKSPAESTPQPP 925



 Score = 45.8 bits (107), Expect = 0.010,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 31/126 (24%), Gaps = 2/126 (1%)

Query: 49  AFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQN 108
           A   T  E  P +  +E AP     P   E K+           N  +  +         
Sbjct: 837 APTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPSSPDIPAP 896

Query: 109 DISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK--VGREDTEVPAMDKNFCS 166
             S  +        ++    P             + L  +         + P ++K   +
Sbjct: 897 TTSEASTSTTTVEPSTTLKSPAESTPQPPIEPTPKALENSPKEPAVPTIKGPKVNKPEIT 956

Query: 167 NASGAR 172
                +
Sbjct: 957 TTVKDK 962



 Score = 45.8 bits (107), Expect = 0.012,   Method: Composition-based stats.
 Identities = 11/93 (11%), Positives = 27/93 (29%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQIQND 109
              T  +    +  +E AP     P     + +P+ ++      +    ++  +      
Sbjct: 489 PAPTTPKQPAPTTPKEPAPTTPKEPAPTTKEPAPTTKEPEPTTKEPAPTTTPKEPAPTTP 548

Query: 110 ISGKTVVNKPTRSTSIDSLPTIEERLILGLSKK 142
                   +P  +T     PT  +       K+
Sbjct: 549 KEPAPTTKEPEPTTLKQPAPTTPKEPAPTTPKE 581



 Score = 45.4 bits (106), Expect = 0.016,   Method: Composition-based stats.
 Identities = 11/122 (9%), Positives = 27/122 (22%), Gaps = 2/122 (1%)

Query: 50  FVGTISEMIPYSVIREIAPIPLTI-PLNIED-KQSPSKRDNNTVCNQLKNDSSQHDGQIQ 107
                 +    +  +E AP   T  P   E  + +P+           K  +     +  
Sbjct: 770 PAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPAPTSPKEPAPTTTTKEPAPAEPKEPA 829

Query: 108 NDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNKVGREDTEVPAMDKNFCSN 167
                +      T+  +  + P                 +          P   +    +
Sbjct: 830 PTSPKEPAPTTTTKEPAPTTTPKEPAPTDPKEPAPAEPKEPAPAEPKEPTPNSPETLAPS 889

Query: 168 AS 169
           + 
Sbjct: 890 SP 891



 Score = 45.1 bits (105), Expect = 0.022,   Method: Composition-based stats.
 Identities = 11/103 (10%), Positives = 26/103 (25%)

Query: 47  SHAFVGTISEMIPYSVIREIAPIPLTIPLNIEDKQSPSKRDNNTVCNQLKNDSSQHDGQI 106
           +     T  +    +  ++ AP     P     K+            +    +++     
Sbjct: 478 TKEPAPTTPKQPAPTTPKQPAPTTPKEPAPTTPKEPAPTTKEPAPTTKEPEPTTKEPAPT 537

Query: 107 QNDISGKTVVNKPTRSTSIDSLPTIEERLILGLSKKELLAKNK 149
                      K    T+ +  PT  ++      K+      K
Sbjct: 538 TTPKEPAPTTPKEPAPTTKEPEPTTLKQPAPTTPKEPAPTTPK 580



 Score = 43.5 bits (101), Expect = 0.059,   Method: Composition-based stats.
 Identities = 14/122 (11%), Positives = 23/122 (18%), Gaps = 1/122 (0%)

Query: 51  VGTISEMIPYSVIREIAPIPLTIPLNIEDKQS-PSKRDNNTVCNQLKNDSSQHDGQIQND 109
           V  IS     ++ R   P     P     + +  +           K   +         
Sbjct: 325 VPAISTPKAETITRSPTPTTPKEPAPTTKEPALTTTTKEPASTTPKKPAPTTPKETAPTX 384

Query: 110 ISGKTVVNKPTRSTSIDSLPTI