BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780561|ref|YP_003064974.1| thiamine transporter substrate
binding subunit [Candidatus Liberibacter asiaticus str. psy62]
         (338 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780561|ref|YP_003064974.1| thiamine transporter substrate binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040238|gb|ACT57034.1| thiamine transporter substrate binding subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 338

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/338 (100%), Positives = 338/338 (100%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC
Sbjct: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI
Sbjct: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
           KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW
Sbjct: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD
Sbjct: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP 300
           YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP
Sbjct: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP 300

Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL 338
           DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL
Sbjct: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL 338


>gi|315121755|ref|YP_004062244.1| thiamine transporter substrate binding subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495157|gb|ADR51756.1| thiamine transporter substrate binding subunit [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 333

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 237/317 (74%), Positives = 281/317 (88%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           C    + AKP+LTVYTY SFV+D GAGPKIK +FE+ CNCEL++IGL+DGVALLN+L+ME
Sbjct: 16  CLTLNIQAKPILTVYTYGSFVSDWGAGPKIKSSFEQVCNCELRIIGLNDGVALLNRLKME 75

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G NS ADIVLG DNNLIDLA+KTGLF +S+ID S LKLP++W ++IF+PYDYGY +FIYD
Sbjct: 76  GGNSPADIVLGLDNNLIDLAKKTGLFTESHIDTSLLKLPMEWKNNIFIPYDYGYFSFIYD 135

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT 200
           KR+ITQ PK+FDELINST+PW IIYQDPRTSTLGLGLLLWIQK+YG+ SAQ+W++IA +T
Sbjct: 136 KRRITQAPKSFDELINSTQPWTIIYQDPRTSTLGLGLLLWIQKVYGEKSAQIWREIAKRT 195

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            T+TKGW ESYG FLKGESDFVLSYS+SPGF LLNYGQD+Y AALFSEGHYLQIEVAAQL
Sbjct: 196 VTITKGWGESYGLFLKGESDFVLSYSSSPGFQLLNYGQDNYAAALFSEGHYLQIEVAAQL 255

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEET 320
             SKQP+LAQEFMQFMISP+FQ+ILP TNWMYPV+D+S+P VYQ I +PQKSL+F+AE+ 
Sbjct: 256 KSSKQPKLAQEFMQFMISPTFQKILPITNWMYPVIDMSLPTVYQKILVPQKSLQFHAEDI 315

Query: 321 TRYRNQWISSWQNAVSR 337
           T++RNQWI  WQ+AVS 
Sbjct: 316 TQHRNQWIHLWQDAVSH 332


>gi|37524620|ref|NP_927964.1| thiamine transporter substrate binding subunit [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36784045|emb|CAE12914.1| Thiamine-binding periplasmic protein precursor [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 337

 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 205/310 (66%), Positives = 259/310 (83%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF  + G GP IK+AFE +C+CELKL+ L DGV+LLN+LRMEG+ +AAD
Sbjct: 28  AKPVLTVYTYDSFATEWGPGPAIKKAFEAECHCELKLVALEDGVSLLNRLRMEGKRTAAD 87

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           I+LG DNNLI  A++TGLF +S +D S+L LP+ W++ +F+PYDYGY AFIY+K+ +  P
Sbjct: 88  IILGLDNNLIQAAQQTGLFTESQVDTSKLTLPVSWNNKVFIPYDYGYFAFIYNKKTLPNP 147

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+ DELINS   WK+IYQDPRTST G GLLLW+QKIYGD++ Q W+K+A KT TVTKGW
Sbjct: 148 PKSMDELINSHNNWKVIYQDPRTSTPGQGLLLWMQKIYGDDAPQAWQKLAKKTLTVTKGW 207

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE D VLSY+TSPG++LL+   DDY AA FSEGHYLQIEVAAQL  SKQP+
Sbjct: 208 SEAYGLFLKGEGDLVLSYTTSPGYHLLSEKNDDYTAATFSEGHYLQIEVAAQLASSKQPE 267

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+FMQFM++P+FQ+ +PTTNWMYPV+DI +P+VY  + IP+KSL++ AEE  +YRNQW
Sbjct: 268 LAQKFMQFMLTPTFQQEIPTTNWMYPVIDIPLPEVYLQLSIPEKSLQYRAEEVAKYRNQW 327

Query: 328 ISSWQNAVSR 337
           I +WQ+AVSR
Sbjct: 328 IRTWQSAVSR 337


>gi|197286168|ref|YP_002152040.1| thiamine ABC transporter substrate-binding protein [Proteus
           mirabilis HI4320]
 gi|227357288|ref|ZP_03841645.1| thiamine ABC superfamily ATP binding cassette transporter,
           substrate-binding protein [Proteus mirabilis ATCC 29906]
 gi|194683655|emb|CAR44593.1| thiamine ABC transporter, substrate-binding protein [Proteus
           mirabilis HI4320]
 gi|227162551|gb|EEI47540.1| thiamine ABC superfamily ATP binding cassette transporter,
           substrate-binding protein [Proteus mirabilis ATCC 29906]
          Length = 337

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 205/322 (63%), Positives = 260/322 (80%)

Query: 16  GVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
           G+ S    +    KP LTVYTY+SF AD G GP IK+AFE++C+CELKL+ LSDGV+LLN
Sbjct: 16  GLFSAFATNAQQTKPTLTVYTYDSFTADWGPGPAIKKAFEQQCDCELKLVALSDGVSLLN 75

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYL 135
           +LRMEG  S ADI+LG DNNLI  A++TGLFA SNID S+L LP KW DD FVPYDYGY 
Sbjct: 76  RLRMEGSKSKADIILGLDNNLIHAAKQTGLFAPSNIDTSKLALPEKWTDDTFVPYDYGYF 135

Query: 136 AFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK 195
           AFIYDK +IT PPK+ DEL+NS +PWKI+YQDPRTST GLGL+LW+Q +Y +N+A+ W+K
Sbjct: 136 AFIYDKNRITHPPKSMDELLNSQQPWKILYQDPRTSTPGLGLMLWMQSLYPNNTAEQWQK 195

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
           +A KT TVTKGW+ESYG FLKGE DFVLSY++SPG+++L   +D+Y AA+F EGHYLQ+E
Sbjct: 196 LANKTLTVTKGWSESYGLFLKGEGDFVLSYTSSPGYHILADKKDNYAAAIFDEGHYLQVE 255

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF 315
           VAA+L  SKQP+LAQ+FMQFM++P+FQ  +PTTNWMYPV+D+ +P+VY  +  PQKSL+F
Sbjct: 256 VAAKLKSSKQPELAQQFMQFMLTPAFQETIPTTNWMYPVIDMPLPEVYSVMPKPQKSLQF 315

Query: 316 NAEETTRYRNQWISSWQNAVSR 337
           +A+   + R  W  +WQ+AVSR
Sbjct: 316 DADVVAKERQTWTRNWQSAVSR 337


>gi|290476664|ref|YP_003469569.1| thiamin ABC transporter periplasmic binding protein [Xenorhabdus
           bovienii SS-2004]
 gi|289176002|emb|CBJ82805.1| thiamin transport protein (ABC superfamily, peri_bind) [Xenorhabdus
           bovienii SS-2004]
          Length = 337

 Score =  455 bits (1171), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 205/328 (62%), Positives = 264/328 (80%), Gaps = 1/328 (0%)

Query: 11  IMMITGVISYCTL-DGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSD 69
           I + T +IS C        KP LTVYTY+SF ++ G GP IK+AFE +CNCELKL+ L D
Sbjct: 10  ITISTLLISACVFAQTAQTKPTLTVYTYDSFASEWGPGPAIKKAFEAECNCELKLVALED 69

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVP 129
           GV+LLN++RMEG+ ++ADIVLG DNNLI  A++TGLF  S+ID S+LKLP+ W+   F+P
Sbjct: 70  GVSLLNRVRMEGKKTSADIVLGLDNNLIQAAQQTGLFTPSHIDTSKLKLPVTWNSKTFIP 129

Query: 130 YDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS 189
           YDYGY AF+Y+K  +  PPK+ DELINS + WKIIYQDPRTST GLGLLLW+Q IYGD +
Sbjct: 130 YDYGYFAFVYNKNTLPHPPKSMDELINSNQNWKIIYQDPRTSTPGLGLLLWMQDIYGDKA 189

Query: 190 AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEG 249
            Q W K+A KT TVTKGW+E+YG FLKGE D VLSY+TSP +++L+  +D+Y AA+FSEG
Sbjct: 190 VQEWPKVAKKTLTVTKGWSEAYGLFLKGEGDMVLSYTTSPAYHILSEKKDNYAAAIFSEG 249

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIP 309
           HYLQIEVAAQLV SKQP+LAQ+FMQFMISP+FQ+ +PTTNWMYPV+DI +P+V++ + +P
Sbjct: 250 HYLQIEVAAQLVSSKQPKLAQKFMQFMISPAFQQAIPTTNWMYPVIDIPLPEVFKQLSVP 309

Query: 310 QKSLRFNAEETTRYRNQWISSWQNAVSR 337
            K L+F+A++  ++RNQWI +WQ+AVSR
Sbjct: 310 AKPLQFSADDVAKHRNQWIRTWQSAVSR 337


>gi|300724841|ref|YP_003714166.1| thiamin ABC transporter periplasmic-binding protein [Xenorhabdus
           nematophila ATCC 19061]
 gi|297631383|emb|CBJ92078.1| thiamin transport protein (ABC superfamily, peri_bind) [Xenorhabdus
           nematophila ATCC 19061]
          Length = 337

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 206/337 (61%), Positives = 268/337 (79%), Gaps = 4/337 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTL-DGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           K F+R+   I + T  IS C        KP LTVYTY+SF ++ G GP IK+AFE +C C
Sbjct: 4   KLFSRV---IAISTLSISACVFAQTAQTKPTLTVYTYDSFASEWGPGPAIKKAFEAECRC 60

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           ELKL+ L DGV+LLN+LRMEG+ ++ADIVLG DNNLI  A++TGLF  S++D S+LKLP+
Sbjct: 61  ELKLVALEDGVSLLNRLRMEGKKTSADIVLGLDNNLIQAAQQTGLFTPSHLDTSKLKLPV 120

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            W++  F+PYDYGY AFIY+K  +  PP+N DELIN  + WKIIYQDPRTST GLGLLLW
Sbjct: 121 AWNNTTFIPYDYGYFAFIYNKNTLPHPPRNMDELINGNQNWKIIYQDPRTSTPGLGLLLW 180

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           +QK+YGD +AQ W+K A KT TVTKGW+E+YG FLKGE D VLSY+TSPG+++++  +D+
Sbjct: 181 MQKLYGDKAAQEWQKAAKKTLTVTKGWSEAYGLFLKGEGDMVLSYTTSPGYHIMSEKKDN 240

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP 300
           Y AA+F EGHYLQIEVAAQL  SKQP+LAQ+FM FMISP+FQ+++PTT WMYPV+D+ +P
Sbjct: 241 YAAAVFQEGHYLQIEVAAQLASSKQPELAQKFMNFMISPAFQQVIPTTQWMYPVIDMPLP 300

Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           DV++ + IP+KSL+FNA++  ++R +WI +WQNAVSR
Sbjct: 301 DVFRQLPIPEKSLQFNADDVAKHRTKWIRTWQNAVSR 337


>gi|253988059|ref|YP_003039415.1| thiamine transporter substrate binding subunit [Photorhabdus
           asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779509|emb|CAQ82670.1| thiamine-binding periplasmic protein [Photorhabdus asymbiotica]
          Length = 337

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 197/310 (63%), Positives = 260/310 (83%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF  + G GP IK+AFE +C+CELKL+ L DGV+LLN+LRMEG+ + AD
Sbjct: 28  AKPVLTVYTYDSFATEWGPGPAIKKAFETECDCELKLVALEDGVSLLNRLRMEGKRTPAD 87

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           ++LG DNNLI+ A++TGLF +S +D S+LKLP+ W +++F+PYDYGY AFIY+K  +  P
Sbjct: 88  VILGLDNNLIEAAQQTGLFTESKVDISKLKLPVPWHNNVFIPYDYGYFAFIYNKNTLPHP 147

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+ DELINS   WK+IYQDPRTST G GLLLW+QKIYGD++ Q W+K+A KT TVTKGW
Sbjct: 148 PKSMDELINSHNNWKVIYQDPRTSTPGQGLLLWMQKIYGDDAQQAWQKLAKKTLTVTKGW 207

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE D VLSY++SPG++LL+  +D+Y AA FSEGHYLQ+EVAAQL  SKQP+
Sbjct: 208 SEAYGLFLKGEGDLVLSYTSSPGYHLLSEKKDNYAAATFSEGHYLQVEVAAQLASSKQPE 267

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+FMQFM++P+FQ+ +PTTNWMYPV+DI +P+VY  + +P+KSL+++AEE  ++RN+W
Sbjct: 268 LAQKFMQFMLTPAFQQEIPTTNWMYPVIDIKLPEVYSQLSVPEKSLQYSAEEVAKHRNKW 327

Query: 328 ISSWQNAVSR 337
           I +WQ+AVS 
Sbjct: 328 IRTWQSAVSH 337


>gi|183597811|ref|ZP_02959304.1| hypothetical protein PROSTU_01140 [Providencia stuartii ATCC 25827]
 gi|188022566|gb|EDU60606.1| hypothetical protein PROSTU_01140 [Providencia stuartii ATCC 25827]
          Length = 334

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 197/309 (63%), Positives = 251/309 (81%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF A+ G GP+IK+ FE++C+CELKL+ L DGVALLN+LRMEG+ S ADI
Sbjct: 26  KPTLTVYTYDSFAAEWGPGPQIKKNFEKQCHCELKLVSLGDGVALLNRLRMEGKKSKADI 85

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNLID A  TGLFA + I+   +KLPI+W++  F+PYDYGY AFIYD  +I  PP
Sbjct: 86  VLGLDNNLIDSAENTGLFAPAEINTDAMKLPIEWNNSTFIPYDYGYFAFIYDTDKIKNPP 145

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+ +EL+NS +PWKIIYQDPRTST GLGL+LWI+K+YGD SA  W+KIA KT TVTKGW+
Sbjct: 146 KSMNELLNSEQPWKIIYQDPRTSTPGLGLMLWIEKLYGDKSADAWQKIANKTLTVTKGWS 205

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           ESYG FLKGE DFVLSY++SPG+ +LN  +D+Y AALF EGHY+Q+EVAA+L  S QP+L
Sbjct: 206 ESYGLFLKGEGDFVLSYTSSPGYQILNDNKDNYAAALFDEGHYMQVEVAARLKNSSQPEL 265

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F+QFM++P FQ  LPTTNWMYPV+D  +P+VY  + +P+KSL+F+A+E  + R  W+
Sbjct: 266 AKQFLQFMLTPEFQNTLPTTNWMYPVIDTPLPEVYNVLPVPKKSLQFSAQEVAKERQSWV 325

Query: 329 SSWQNAVSR 337
             WQ+AVSR
Sbjct: 326 RLWQSAVSR 334


>gi|212711207|ref|ZP_03319335.1| hypothetical protein PROVALCAL_02279 [Providencia alcalifaciens DSM
           30120]
 gi|212686375|gb|EEB45903.1| hypothetical protein PROVALCAL_02279 [Providencia alcalifaciens DSM
           30120]
          Length = 341

 Score =  439 bits (1128), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 200/332 (60%), Positives = 257/332 (77%), Gaps = 2/332 (0%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           ++   I+ +T  +S+ TL     KP LTVYTY+SF A+ G GP+IK+ FE +C+CELKL+
Sbjct: 12  KLFTSIIALT-TLSFATLAS-AEKPTLTVYTYDSFAAEWGPGPQIKKNFEAQCDCELKLV 69

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDD 125
            L DGVALLN+LRMEG  S AD++LG DNNL+D A KTGLFA ++I    LKLPI+W+  
Sbjct: 70  SLGDGVALLNRLRMEGAKSKADVILGLDNNLLDSAEKTGLFAAADIKTDALKLPIEWNSK 129

Query: 126 IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY 185
            F+PYDYGY AFIYD  +I QPPK+ +EL++S   WKIIYQDPRTST GLGL+LW++KIY
Sbjct: 130 TFIPYDYGYFAFIYDTNKIKQPPKSMNELLDSKNNWKIIYQDPRTSTPGLGLMLWVEKIY 189

Query: 186 GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAAL 245
           G+ SA  WKK+A KT TVTKGW+ESYG FLKGE DFVLSY+ SPG+ +LN  +D+Y AAL
Sbjct: 190 GEKSADAWKKMAGKTLTVTKGWSESYGLFLKGEGDFVLSYTASPGYQILNDKKDNYAAAL 249

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQA 305
           F EGHY+Q+EVAA+L  S QP+LA++F+QFM++P FQ  LPTTNWMYPV+DI +P+VY  
Sbjct: 250 FDEGHYMQVEVAARLKHSPQPELAKQFLQFMLTPEFQNTLPTTNWMYPVIDIPLPEVYNV 309

Query: 306 IRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           + +P+KSL+F+A+E  + R  W   WQ AVSR
Sbjct: 310 LPLPKKSLQFSAQEVAKERQAWTRLWQTAVSR 341


>gi|268590568|ref|ZP_06124789.1| thiamin/thiamine pyrophosphate ABC transporter [Providencia
           rettgeri DSM 1131]
 gi|291313956|gb|EFE54409.1| thiamin/thiamine pyrophosphate ABC transporter [Providencia
           rettgeri DSM 1131]
          Length = 334

 Score =  435 bits (1119), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 197/334 (58%), Positives = 255/334 (76%), Gaps = 1/334 (0%)

Query: 4   FARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
           F   ++      G +S   L     KP LTVYTY+SF A+ G GP+IK+ FE +C+CELK
Sbjct: 2   FKNKIIASFFTFGALSLSQL-AWADKPTLTVYTYDSFAAEWGPGPQIKKNFEAQCDCELK 60

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD 123
           ++ L DGVALLN+LRMEG+NS AD++LG DNNL+D A KTGLFA ++I+ S LKLPI WD
Sbjct: 61  IVALGDGVALLNRLRMEGKNSKADVILGLDNNLLDSAEKTGLFAPADINTSALKLPISWD 120

Query: 124 DDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
              F+PYDYGY AFIYD  +I QPP + D L+NS   WKIIYQDPRTST GLGL+LWI+K
Sbjct: 121 SSTFIPYDYGYFAFIYDTNKIKQPPTSMDALLNSENNWKIIYQDPRTSTPGLGLMLWIEK 180

Query: 184 IYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
           +YGD S   W+KIA KT TVTKGW+E+YG FLKGE DFVLSY++SPG+ +LN  +D+Y A
Sbjct: 181 LYGDKSVDAWQKIAGKTLTVTKGWSEAYGLFLKGEGDFVLSYTSSPGYQMLNDQKDNYAA 240

Query: 244 ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVY 303
           ALF+EGHY+Q+EVAA+L  S QP+LA++F+QF+++P FQ  LPTTNWMYPV+DI +P+VY
Sbjct: 241 ALFNEGHYMQVEVAARLKNSPQPELAKQFLQFVLTPEFQNTLPTTNWMYPVIDIPLPEVY 300

Query: 304 QAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
             + +P+K+L+F+++E  + R  W   WQ AVSR
Sbjct: 301 NQLPLPEKALQFSSQEVAKERQNWTRLWQTAVSR 334


>gi|282599934|ref|ZP_05972415.2| hypothetical protein PROVRUST_06035 [Providencia rustigianii DSM
           4541]
 gi|282567215|gb|EFB72750.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Providencia rustigianii
           DSM 4541]
          Length = 341

 Score =  431 bits (1107), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 246/309 (79%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF A+ G GP+IK+ FE +C+CELKL+ L DGVALLN+LRMEG  S AD+
Sbjct: 33  KPTLTVYTYDSFAAEWGPGPQIKKNFEAQCDCELKLVSLGDGVALLNRLRMEGNKSKADV 92

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNL+D A KTGLFA ++I    LKLPI+W+ + F+PYDYGY AFIYD  +I QPP
Sbjct: 93  ILGLDNNLMDSAEKTGLFAPADIKTDALKLPIEWNSETFIPYDYGYFAFIYDTNKIKQPP 152

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+ +EL++    WKIIYQDPRTST GLGL+LWI+K+YGD SA  WKK+A KT TVTKGW+
Sbjct: 153 KSMNELLDEKNNWKIIYQDPRTSTPGLGLMLWIEKLYGDKSADAWKKMAGKTLTVTKGWS 212

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE DFVLSY+ SPG+ +LN  +D+Y AALF+EGHY+Q+EVAA+L  + QP+L
Sbjct: 213 EAYGLFLKGEGDFVLSYTASPGYQILNDKKDNYAAALFAEGHYMQVEVAARLKNAPQPEL 272

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F+QFM++P FQ  LPTTNWMYPV+D+ +P+VY  + +P KSL+F+A+E  + R  W 
Sbjct: 273 AKQFLQFMLTPEFQGTLPTTNWMYPVIDMPLPEVYNVLPLPTKSLQFSAQEVAKDRQAWT 332

Query: 329 SSWQNAVSR 337
             WQ AVSR
Sbjct: 333 RLWQTAVSR 341


>gi|308185640|ref|YP_003929771.1| Thiamine-binding periplasmic protein precursor [Pantoea vagans
           C9-1]
 gi|308056150|gb|ADO08322.1| Thiamine-binding periplasmic protein precursor [Pantoea vagans
           C9-1]
          Length = 328

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/312 (60%), Positives = 246/312 (78%)

Query: 26  LPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
           L AKPVLTVYTY+SF AD G GP +K+AFE +C+CELK + L DGV+LLN++RMEG+NS 
Sbjct: 17  LAAKPVLTVYTYDSFSADWGPGPAVKKAFEAQCDCELKFVTLEDGVSLLNRVRMEGKNSK 76

Query: 86  ADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
           AD+VLG DNNL+  A+KTGLFA+S +D S LKLP  W +  FVP+DYGY AF+YDK ++ 
Sbjct: 77  ADVVLGLDNNLVQAAQKTGLFAESQVDTSTLKLPDGWHNTTFVPFDYGYFAFVYDKTRLK 136

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
            PPK+  EL++S + W++IY+DPRTST GLGLLLW+QK+YGD + Q W+K+A KT TVTK
Sbjct: 137 NPPKSLKELVDSPEKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPQAWQKLAQKTVTVTK 196

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+E+YG FLKGE D VLSY+TSP ++++   +++Y AA F+EGHYLQ+EVAAQL  SKQ
Sbjct: 197 GWSEAYGLFLKGEGDLVLSYTTSPAYHIIEEKKENYAAASFAEGHYLQVEVAAQLTSSKQ 256

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           P LAQ+FM+FM+SP FQR +PT NWMYPV+D  +P  + A+ +P  +L+F+ EE    R+
Sbjct: 257 PALAQQFMKFMVSPDFQRTIPTGNWMYPVIDTPLPAGFTALSVPSTALQFSPEEVASQRS 316

Query: 326 QWISSWQNAVSR 337
            WIS WQ AVSR
Sbjct: 317 GWISQWQRAVSR 328


>gi|304396544|ref|ZP_07378425.1| thiamine ABC transporter, periplasmic binding protein [Pantoea sp.
           aB]
 gi|304356053|gb|EFM20419.1| thiamine ABC transporter, periplasmic binding protein [Pantoea sp.
           aB]
          Length = 328

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 189/312 (60%), Positives = 245/312 (78%)

Query: 26  LPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
           L AKPVLTVYTY+SF AD G GP +K+AFE +C+CELK + L DGV+LLN++RMEG+NS 
Sbjct: 17  LAAKPVLTVYTYDSFSADWGPGPAVKKAFEAQCDCELKFVTLEDGVSLLNRVRMEGKNSK 76

Query: 86  ADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
           AD+VLG DNNL+  A+KTGLFA+S +D S LKLP  W    FVP+DYGY AF+YDK ++ 
Sbjct: 77  ADVVLGLDNNLVQAAQKTGLFAESQVDTSTLKLPDGWHSTTFVPFDYGYFAFVYDKTRLK 136

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
            PPK+  EL++S + W++IY+DPRTST GLGLLLW+QK+YGD + Q W+K+A KT TVTK
Sbjct: 137 NPPKSLKELVDSPEKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPQAWQKLAQKTVTVTK 196

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+E+YG FLKGE D VLSY+TSP ++++   +++Y AA F+EGHYLQ+EVAAQL  SKQ
Sbjct: 197 GWSEAYGLFLKGEGDLVLSYTTSPAYHIIEEKKENYAAAPFAEGHYLQVEVAAQLASSKQ 256

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           P LAQ+FM+FM+SP FQR +PT NWMYPV+D  +P  + A+ +P  +L+F+ EE    R+
Sbjct: 257 PALAQQFMKFMVSPDFQRTIPTGNWMYPVIDTPLPAGFAALNVPSTALQFSPEEVASQRS 316

Query: 326 QWISSWQNAVSR 337
            WIS WQ AVSR
Sbjct: 317 GWISQWQRAVSR 328


>gi|333010559|gb|EGK29992.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri VA-6]
          Length = 327

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPSGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|30061633|ref|NP_835804.1| thiamine transporter substrate binding subunit [Shigella flexneri
           2a str. 2457T]
 gi|56479594|ref|NP_706021.2| thiamine transporter substrate binding subunit [Shigella flexneri
           2a str. 301]
 gi|30039875|gb|AAP15609.1| thiamin-binding periplasmic protein [Shigella flexneri 2a str.
           2457T]
 gi|56383145|gb|AAN41728.2| thiamin-binding periplasmic protein [Shigella flexneri 2a str. 301]
 gi|313646555|gb|EFS11016.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri 2a str.
           2457T]
 gi|332764909|gb|EGJ95137.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri K-671]
 gi|332768855|gb|EGJ99034.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri 2930-71]
 gi|333022397|gb|EGK41635.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri K-304]
          Length = 327

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEANCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|332762324|gb|EGJ92591.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri 2747-71]
          Length = 318

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 9   AKPVLTVYTYDSFAADWGPGPKIKKAFEANCNCELKLVALEDGVSLLNRLRMEGKNSKAD 68

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 69  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 128

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 129 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 188

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 189 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 248

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 249 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 308

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 309 ISEWQRAVSR 318


>gi|281599427|gb|ADA72411.1| putative ABC-type thiamine transport system, periplasmic component
           [Shigella flexneri 2002017]
          Length = 331

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 22  AKPVLTVYTYDSFAADWGPGPKIKKAFEANCNCELKLVALEDGVSLLNRLRMEGKNSKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 82  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 141

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 142 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 201

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 202 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 261

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 262 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 321

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 322 ISEWQRAVSR 331


>gi|193065883|ref|ZP_03046944.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli E22]
 gi|194429385|ref|ZP_03061910.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli B171]
 gi|194434423|ref|ZP_03066685.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Shigella
           dysenteriae 1012]
 gi|209917259|ref|YP_002291343.1| thiamine transporter substrate binding subunit [Escherichia coli
           SE11]
 gi|218552651|ref|YP_002385564.1| thiamine transporter substrate binding subunit [Escherichia coli
           IAI1]
 gi|256020094|ref|ZP_05433959.1| thiamine transporter substrate binding subunit [Shigella sp. D9]
 gi|260842303|ref|YP_003220081.1| thiamin transporter subunit TbpA [Escherichia coli O103:H2 str.
           12009]
 gi|260866220|ref|YP_003232622.1| thiamin transporter subunit TbpA [Escherichia coli O111:H- str.
           11128]
 gi|293476730|ref|ZP_06665138.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli
           B088]
 gi|300816103|ref|ZP_07096326.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           107-1]
 gi|300905472|ref|ZP_07123238.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           84-1]
 gi|300919620|ref|ZP_07136112.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           115-1]
 gi|301026156|ref|ZP_07189629.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           69-1]
 gi|301305040|ref|ZP_07211141.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           124-1]
 gi|307311480|ref|ZP_07591122.1| thiamine ABC transporter, periplasmic binding protein [Escherichia
           coli W]
 gi|332281246|ref|ZP_08393659.1| thiamine transporter substrate binding subunit [Shigella sp. D9]
 gi|192926470|gb|EDV81103.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli E22]
 gi|194412605|gb|EDX28902.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli B171]
 gi|194417339|gb|EDX33446.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Shigella
           dysenteriae 1012]
 gi|209910518|dbj|BAG75592.1| thiamin ABC transporter substrate binding component [Escherichia
           coli SE11]
 gi|218359419|emb|CAQ96958.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia coli IAI1]
 gi|257757450|dbj|BAI28947.1| thiamin transporter subunit TbpA [Escherichia coli O103:H2 str.
           12009]
 gi|257762576|dbj|BAI34071.1| thiamin transporter subunit TbpA [Escherichia coli O111:H- str.
           11128]
 gi|291321183|gb|EFE60625.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli
           B088]
 gi|300395650|gb|EFJ79188.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           69-1]
 gi|300402688|gb|EFJ86226.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           84-1]
 gi|300413366|gb|EFJ96676.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           115-1]
 gi|300531310|gb|EFK52372.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           107-1]
 gi|300839647|gb|EFK67407.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           124-1]
 gi|306908459|gb|EFN38957.1| thiamine ABC transporter, periplasmic binding protein [Escherichia
           coli W]
 gi|315059292|gb|ADT73619.1| thiamin transporter subunit [Escherichia coli W]
 gi|315255657|gb|EFU35625.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli MS 85-1]
 gi|320179627|gb|EFW54576.1| Thiamin ABC transporter, substrate-binding component [Shigella
           boydii ATCC 9905]
 gi|320200415|gb|EFW75001.1| Thiamin ABC transporter, substrate-binding component [Escherichia
           coli EC4100B]
 gi|323160136|gb|EFZ46097.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli E128010]
 gi|323171226|gb|EFZ56874.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli LT-68]
 gi|323176375|gb|EFZ61967.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 1180]
 gi|323181763|gb|EFZ67176.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 1357]
 gi|323380151|gb|ADX52419.1| thiamine ABC transporter, periplasmic binding protein [Escherichia
           coli KO11]
 gi|323945698|gb|EGB41746.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           H120]
 gi|324017665|gb|EGB86884.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli MS 117-3]
 gi|332095355|gb|EGJ00378.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella boydii 5216-82]
 gi|332098141|gb|EGJ03114.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella dysenteriae
           155-74]
 gi|332103598|gb|EGJ06944.1| thiamine transporter substrate binding subunit [Shigella sp. D9]
 gi|332762627|gb|EGJ92892.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri 4343-70]
 gi|333009327|gb|EGK28783.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri K-218]
 gi|333011450|gb|EGK30864.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri K-272]
          Length = 327

 Score =  428 bits (1101), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|82542672|ref|YP_406619.1| thiamine transporter substrate binding subunit [Shigella boydii
           Sb227]
 gi|187730746|ref|YP_001878879.1| thiamine transporter substrate binding subunit [Shigella boydii CDC
           3083-94]
 gi|81244083|gb|ABB64791.1| thiamin-binding periplasmic protein [Shigella boydii Sb227]
 gi|187427738|gb|ACD07012.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Shigella
           boydii CDC 3083-94]
 gi|320182948|gb|EFW57816.1| Thiamin ABC transporter, substrate-binding component [Shigella
           flexneri CDC 796-83]
 gi|332098898|gb|EGJ03849.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella boydii 3594-74]
          Length = 327

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISGWQRAVSR 327


>gi|157159051|ref|YP_001461238.1| thiamine transporter substrate binding subunit [Escherichia coli
           E24377A]
 gi|157081081|gb|ABV20789.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli E24377A]
          Length = 327

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDTPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|300923153|ref|ZP_07139211.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           182-1]
 gi|301330162|ref|ZP_07222824.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           78-1]
 gi|300420546|gb|EFK03857.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           182-1]
 gi|300843802|gb|EFK71562.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           78-1]
          Length = 317

 Score =  428 bits (1100), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 8   AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 67

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 68  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 127

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 128 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDTPQAWQKLAKKTVTVTKGW 187

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 188 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 247

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 248 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 307

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 308 ISEWQRAVSR 317


>gi|331681452|ref|ZP_08382089.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli H299]
 gi|331081673|gb|EGI52834.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli H299]
          Length = 327

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|193070846|ref|ZP_03051779.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli E110019]
 gi|256025383|ref|ZP_05439248.1| thiamine transporter substrate binding subunit [Escherichia sp.
           4_1_40B]
 gi|192955876|gb|EDV86346.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli E110019]
          Length = 327

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV  +++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVAKVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|323975765|gb|EGB70861.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           TW10509]
          Length = 327

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/317 (59%), Positives = 244/317 (76%), Gaps = 1/317 (0%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           CT     AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRME
Sbjct: 12  CTAPAF-AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRME 70

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G+NS AD+VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YD
Sbjct: 71  GKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPCGWNNDTFVPFDYGYFAFVYD 130

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT 200
           K ++  PP++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT
Sbjct: 131 KNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKT 190

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            TVTKGW+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+ 
Sbjct: 191 VTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAART 250

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEET 320
             SKQP+LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E 
Sbjct: 251 AASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEV 310

Query: 321 TRYRNQWISSWQNAVSR 337
              R  WIS WQ AVSR
Sbjct: 311 AAQRQAWISEWQRAVSR 327


>gi|15799752|ref|NP_285764.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 EDL933]
 gi|15829326|ref|NP_308099.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 str. Sakai]
 gi|168751424|ref|ZP_02776446.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|168755674|ref|ZP_02780681.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|168764055|ref|ZP_02789062.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|168771290|ref|ZP_02796297.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|168776910|ref|ZP_02801917.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4196]
 gi|168781951|ref|ZP_02806958.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|168789593|ref|ZP_02814600.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC869]
 gi|168801493|ref|ZP_02826500.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC508]
 gi|195939284|ref|ZP_03084666.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 str. EC4024]
 gi|208807406|ref|ZP_03249743.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208814222|ref|ZP_03255551.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208818330|ref|ZP_03258650.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209399031|ref|YP_002268676.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|217325302|ref|ZP_03441386.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254791206|ref|YP_003076043.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 str. TW14359]
 gi|261226827|ref|ZP_05941108.1| periplasmic-binding component of thiamin ABC transporter
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255231|ref|ZP_05947764.1| periplasmic-binding component of thiamin ABC transporter
           [Escherichia coli O157:H7 str. FRIK966]
 gi|12512765|gb|AAG54372.1|AE005183_9 thiamin-binding periplasmic protein [Escherichia coli O157:H7 str.
           EDL933]
 gi|13359528|dbj|BAB33495.1| thiamin-binding periplasmic protein [Escherichia coli O157:H7 str.
           Sakai]
 gi|187767749|gb|EDU31593.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4196]
 gi|188014544|gb|EDU52666.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4113]
 gi|189000446|gb|EDU69432.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4076]
 gi|189357071|gb|EDU75490.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4401]
 gi|189359894|gb|EDU78313.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4486]
 gi|189365896|gb|EDU84312.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4501]
 gi|189370805|gb|EDU89221.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC869]
 gi|189376370|gb|EDU94786.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC508]
 gi|208727207|gb|EDZ76808.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4206]
 gi|208735499|gb|EDZ84186.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4045]
 gi|208738453|gb|EDZ86135.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4042]
 gi|209160431|gb|ACI37864.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. EC4115]
 gi|209746754|gb|ACI71684.1| thiamin-binding periplasmic protein [Escherichia coli]
 gi|209746756|gb|ACI71685.1| thiamin-binding periplasmic protein [Escherichia coli]
 gi|209746758|gb|ACI71686.1| thiamin-binding periplasmic protein [Escherichia coli]
 gi|209746760|gb|ACI71687.1| thiamin-binding periplasmic protein [Escherichia coli]
 gi|209746762|gb|ACI71688.1| thiamin-binding periplasmic protein [Escherichia coli]
 gi|217321523|gb|EEC29947.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli O157:H7 str. TW14588]
 gi|254590606|gb|ACT69967.1| periplasmic-binding component of thiamin ABC transporter
           [Escherichia coli O157:H7 str. TW14359]
 gi|320190410|gb|EFW65060.1| Thiamin ABC transporter, substrate-binding component [Escherichia
           coli O157:H7 str. EC1212]
 gi|320642109|gb|EFX11460.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 str. G5101]
 gi|320647472|gb|EFX16267.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H- str. 493-89]
 gi|320652806|gb|EFX21044.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H- str. H 2687]
 gi|320663504|gb|EFX30788.1| thiamine transporter substrate binding subunit [Escherichia coli
           O55:H7 str. USDA 5905]
 gi|320668816|gb|EFX35611.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 str. LSU-61]
 gi|326345213|gb|EGD68956.1| Thiamin ABC transporter, substrate-binding component [Escherichia
           coli O157:H7 str. 1125]
 gi|326346934|gb|EGD70668.1| Thiamin ABC transporter, substrate-binding component [Escherichia
           coli O157:H7 str. 1044]
          Length = 327

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++DIFVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|238786696|ref|ZP_04630497.1| Thiamine-binding periplasmic protein [Yersinia frederiksenii ATCC
           33641]
 gi|238725064|gb|EEQ16703.1| Thiamine-binding periplasmic protein [Yersinia frederiksenii ATCC
           33641]
          Length = 376

 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/336 (55%), Positives = 254/336 (75%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F RI+  + +++             KP LTVYTY+SF AD G GP IK+AFE +C+C+
Sbjct: 47  KVFKRIIPCLFLLSAAAVAAD------KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQ 100

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLFA S +D S L LP K
Sbjct: 101 LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFAPSQVDTSHLTLPEK 160

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  EL++S +PWKIIYQDPRTST GLGL+LW+
Sbjct: 161 WQNKTFVPYDYGYFAFVYNKDKLKNPPKSLQELVDSKEPWKIIYQDPRTSTPGLGLMLWM 220

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   + +Y
Sbjct: 221 QKVYGDKAPQAWQQLAKKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSNY 280

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA Q+  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ +++P 
Sbjct: 281 AAADFSEGHYLQVEVAGQVASSKQPELAQRFMQFIVTPAFQDNIPTGNWMYPVIKMTLPA 340

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQK+L+F+A+E   +R +W  +WQ+AVSR
Sbjct: 341 GFETLTVPQKALQFDAKEVADHRAKWTQAWQSAVSR 376


>gi|110804132|ref|YP_687652.1| thiamine transporter substrate binding subunit [Shigella flexneri 5
           str. 8401]
 gi|110613680|gb|ABF02347.1| thiamin-binding periplasmic protein [Shigella flexneri 5 str. 8401]
          Length = 327

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTS  GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSAPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|291280893|ref|YP_003497711.1| Thiamine/thiamine pyrophosphate ABC transporter periplasmic
           thiamine/thiamine pyrophospate-binding protein
           [Escherichia coli O55:H7 str. CB9615]
 gi|290760766|gb|ADD54727.1| Thiamine/thiamine pyrophosphate ABC transporter, periplasmic
           thiamine/thiamine pyrophospate-binding protein
           [Escherichia coli O55:H7 str. CB9615]
          Length = 331

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 22  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++DIFVP+DYGY AF+YDK ++  P
Sbjct: 82  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNP 141

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 142 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 201

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 202 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 261

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 262 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 321

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 322 ISEWQRAVSR 331


>gi|322834443|ref|YP_004214470.1| thiamine ABC transporter periplasmic binding protein [Rahnella sp.
           Y9602]
 gi|321169644|gb|ADW75343.1| thiamine ABC transporter, periplasmic binding protein [Rahnella sp.
           Y9602]
          Length = 327

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 248/310 (80%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           +KPVLTVYTY+SF AD G GP IK+AFE +C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  SKPVLTVYTYDSFSADWGPGPAIKKAFEAQCGCELKYVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL+  A +TGLFAK+    ++L +P  W+D  FVPYDYGY AF+YDK ++  P
Sbjct: 78  IVLGLDNNLLQAAEQTGLFAKAPKTNARLTVPGGWNDSTFVPYDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+ DELINS + WK+IY+DPRTST GLGL+LW+QK+YGD + Q W+K+A KT TVTKGW
Sbjct: 138 PKSLDELINSDQKWKVIYEDPRTSTPGLGLMLWMQKVYGDKAPQAWEKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHY+Q+EVA QL  SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIVEEKKDNYAAADFTEGHYMQVEVAGQLANSKQPK 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++FM+F+ +  FQ+++PT NWMYPVV+  +PD ++ + IP KSL+++A++   +R+QW
Sbjct: 258 LAEQFMKFVTTEDFQKVIPTGNWMYPVVNTPLPDAFKQLTIPAKSLQYSAQDVATHRSQW 317

Query: 328 ISSWQNAVSR 337
           I +WQNAVS 
Sbjct: 318 IQAWQNAVSH 327


>gi|497658|gb|AAA18833.1| thiamin binding protein [Escherichia coli]
          Length = 323

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 14  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 73

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 74  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 133

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 134 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 193

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 194 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 253

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 254 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 313

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 314 ISEWQRAVSR 323


>gi|238764663|ref|ZP_04625608.1| Thiamine-binding periplasmic protein [Yersinia kristensenii ATCC
           33638]
 gi|238697155|gb|EEP89927.1| Thiamine-binding periplasmic protein [Yersinia kristensenii ATCC
           33638]
          Length = 347

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/336 (55%), Positives = 252/336 (75%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F R++  + +++             KP LTVYTY+SF AD G GP IK+AFE +C+C+
Sbjct: 18  KVFKRMISCLFLLSAAAVAAD------KPTLTVYTYDSFAADWGPGPSIKKAFEAECDCQ 71

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD+VLG DNNL+  A +TGLF  S +D S L LP K
Sbjct: 72  LKFVALEDGVSLLNRLRMEGKNSQADVVLGLDNNLVQAAEQTGLFVPSQVDTSDLTLPEK 131

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W ++ FVPYDYGY AF+YDK ++  PPK+  EL++S +PWK+IYQDPRTST GLGL+LW+
Sbjct: 132 WQNNTFVPYDYGYFAFVYDKNKLKNPPKSLQELVDSQEPWKVIYQDPRTSTPGLGLMLWM 191

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+K+A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   +D+Y
Sbjct: 192 QKVYGDQAPQAWQKLAKKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKDNY 251

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA  +  SKQP+LAQ FMQFM++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 252 AAANFSEGHYLQVEVAGVVASSKQPELAQRFMQFMVTPAFQNHIPTGNWMYPVIKMDLPA 311

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQK+L+F+A++    R +WI +WQ+AVS 
Sbjct: 312 GFETLTVPQKALQFDAKDVADNRGKWIQTWQSAVSH 347


>gi|323964833|gb|EGB60300.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           M863]
 gi|327255047|gb|EGE66650.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli STEC_7v]
          Length = 327

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/317 (59%), Positives = 244/317 (76%), Gaps = 1/317 (0%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           CT     AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRME
Sbjct: 12  CTAPAF-AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRME 70

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G+NS AD+VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YD
Sbjct: 71  GKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYD 130

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT 200
           K ++  PP++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT
Sbjct: 131 KNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKT 190

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            TVTKGW+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+ 
Sbjct: 191 VTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAART 250

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEET 320
             SKQP+LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E 
Sbjct: 251 AASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEV 310

Query: 321 TRYRNQWISSWQNAVSR 337
              R  WIS WQ AVSR
Sbjct: 311 AAQRQAWISEWQRAVSR 327


>gi|323190251|gb|EFZ75527.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli RN587/1]
          Length = 327

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  ELI S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELIESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|293408161|ref|ZP_06652001.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli
           B354]
 gi|291472412|gb|EFF14894.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli
           B354]
          Length = 327

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV +I++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANITLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|218698492|ref|YP_002406121.1| thiamine transporter substrate binding subunit [Escherichia coli
           IAI39]
 gi|218368478|emb|CAR16214.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia coli IAI39]
          Length = 327

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/317 (59%), Positives = 244/317 (76%), Gaps = 1/317 (0%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           CT     AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRME
Sbjct: 12  CTAPAF-AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRME 70

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G+NS AD+VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YD
Sbjct: 71  GKNSKADVVLGLDNNLLDAASKTGLFAKSGVAADTVNVPGGWNNDTFVPFDYGYFAFVYD 130

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT 200
           K ++  PP++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT
Sbjct: 131 KNKLKNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKT 190

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            TVTKGW+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+ 
Sbjct: 191 VTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAART 250

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEET 320
             SKQP+LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E 
Sbjct: 251 AASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEV 310

Query: 321 TRYRNQWISSWQNAVSR 337
              R  WIS WQ AVSR
Sbjct: 311 AAQRQAWISEWQRAVSR 327


>gi|284919850|emb|CBG32905.1| thiamine ABC transport system, substrate-binding protein precursor
           [Escherichia coli 042]
          Length = 327

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAINVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|157159537|ref|YP_001456855.1| thiamine transporter substrate binding subunit [Escherichia coli
           HS]
 gi|170021576|ref|YP_001726530.1| thiamine transporter substrate binding subunit [Escherichia coli
           ATCC 8739]
 gi|188494148|ref|ZP_03001418.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli 53638]
 gi|157065217|gb|ABV04472.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli HS]
 gi|169756504|gb|ACA79203.1| thiamine ABC transporter, periplasmic binding protein [Escherichia
           coli ATCC 8739]
 gi|188489347|gb|EDU64450.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli 53638]
          Length = 327

 Score =  425 bits (1093), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAINVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDTPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|16128062|ref|NP_414610.1| thiamin transporter subunit [Escherichia coli str. K-12 substr.
           MG1655]
 gi|89106952|ref|AP_000732.1| thiamin transporter subunit [Escherichia coli str. K-12 substr.
           W3110]
 gi|194439411|ref|ZP_03071488.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli 101-1]
 gi|238899470|ref|YP_002925266.1| thiamin transporter subunit [Escherichia coli BW2952]
 gi|253774902|ref|YP_003037733.1| thiamine transporter substrate binding subunit [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160191|ref|YP_003043299.1| thiamine transporter substrate binding subunit [Escherichia coli B
           str. REL606]
 gi|293417944|ref|ZP_06660566.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli
           B185]
 gi|300931810|ref|ZP_07147108.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           187-1]
 gi|300955931|ref|ZP_07168266.1| thiamine/thiamin pyrophosphate ABC transporter [Escherichia coli MS
           175-1]
 gi|301028545|ref|ZP_07191778.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           196-1]
 gi|301648364|ref|ZP_07248101.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           146-1]
 gi|307136670|ref|ZP_07496026.1| thiamine transporter substrate binding subunit [Escherichia coli
           H736]
 gi|331640519|ref|ZP_08341667.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli H736]
 gi|331650961|ref|ZP_08351989.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli M718]
 gi|2507359|sp|P31550|THIB_ECOLI RecName: Full=Thiamine-binding periplasmic protein; Flags:
           Precursor
 gi|1786255|gb|AAC73179.1| thiamin transporter subunit [Escherichia coli str. K-12 substr.
           MG1655]
 gi|85674313|dbj|BAB96637.2| thiamin transporter subunit [Escherichia coli str. K12 substr.
           W3110]
 gi|194421670|gb|EDX37680.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli 101-1]
 gi|238863641|gb|ACR65639.1| thiamin transporter subunit [Escherichia coli BW2952]
 gi|242375905|emb|CAQ30586.1| thiamin-binding protein, subunit of thiamin ABC transporter
           [Escherichia coli BL21(DE3)]
 gi|253325946|gb|ACT30548.1| thiamine ABC transporter, periplasmic binding protein [Escherichia
           coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972092|gb|ACT37763.1| thiamin transporter subunit [Escherichia coli B str. REL606]
 gi|253976301|gb|ACT41971.1| thiamin transporter subunit [Escherichia coli BL21(DE3)]
 gi|260450723|gb|ACX41145.1| thiamine ABC transporter, periplasmic binding protein [Escherichia
           coli DH1]
 gi|291430662|gb|EFF03660.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli
           B185]
 gi|299878421|gb|EFI86632.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           196-1]
 gi|300317212|gb|EFJ66996.1| thiamine/thiamin pyrophosphate ABC transporter [Escherichia coli MS
           175-1]
 gi|300460408|gb|EFK23901.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           187-1]
 gi|301073552|gb|EFK88358.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           146-1]
 gi|309700280|emb|CBI99568.1| thiamine ABC transport system, substrate-binding protein precursor
           [Escherichia coli ETEC H10407]
 gi|315134764|dbj|BAJ41923.1| thiamine transporter substrate binding subunit [Escherichia coli
           DH1]
 gi|315616155|gb|EFU96774.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 3431]
 gi|323935121|gb|EGB31488.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           E1520]
 gi|323939833|gb|EGB36034.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           E482]
 gi|323960015|gb|EGB55661.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           H489]
 gi|323970741|gb|EGB65995.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           TA007]
 gi|331040265|gb|EGI12472.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli H736]
 gi|331051415|gb|EGI23464.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli M718]
 gi|332341398|gb|AEE54732.1| thiamin transporter subunit ThiB [Escherichia coli UMNK88]
          Length = 327

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|320658195|gb|EFX25924.1| thiamine transporter substrate binding subunit [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
          Length = 327

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++DIFVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDIFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT +WMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGSWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|312970162|ref|ZP_07784344.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 1827-70]
 gi|310337660|gb|EFQ02771.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 1827-70]
          Length = 318

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 9   AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 68

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 69  VVLGLDNNLLDAASKTGLFAKSGVAADAINVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 128

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 129 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDTPQAWQKLAKKTVTVTKGW 188

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 189 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 248

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 249 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 308

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 309 ISEWQRAVSR 318


>gi|300938460|ref|ZP_07153201.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           21-1]
 gi|300456576|gb|EFK20069.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           21-1]
          Length = 327

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADTVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|325496000|gb|EGC93859.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia
           fergusonii ECD227]
          Length = 327

 Score =  425 bits (1092), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A    +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAFNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|218547521|ref|YP_002381312.1| thiamine transporter substrate binding subunit [Escherichia
           fergusonii ATCC 35469]
 gi|218355062|emb|CAQ87668.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia fergusonii ATCC 35469]
          Length = 327

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A    +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAFNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|320172845|gb|EFW48077.1| Thiamin ABC transporter, substrate-binding component [Shigella
           dysenteriae CDC 74-1112]
          Length = 327

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FV +DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVQFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISGWQRAVSR 327


>gi|238760068|ref|ZP_04621218.1| Thiamine-binding periplasmic protein [Yersinia aldovae ATCC 35236]
 gi|238701687|gb|EEP94254.1| Thiamine-binding periplasmic protein [Yersinia aldovae ATCC 35236]
          Length = 350

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/336 (55%), Positives = 251/336 (74%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F RI+  + +I+             KP LTVYTY+SF AD G GP IK+AFE +C+C+
Sbjct: 21  KVFKRIIPCLFLISAAAVAAD------KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQ 74

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLFA S +D S L LP K
Sbjct: 75  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFAPSQVDTSHLTLPEK 134

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+YDK ++  PPK+  EL++S +PW++IYQDPRTST GLGL+LW+
Sbjct: 135 WHNKTFVPYDYGYFAFVYDKNKLKNPPKSLQELVSSKEPWRVIYQDPRTSTPGLGLMLWM 194

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   +  Y
Sbjct: 195 QKVYGDKAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSHY 254

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA Q+  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 255 AAADFSEGHYLQVEVAGQVAASKQPKLAQRFMQFIVTPAFQDHIPTGNWMYPVIKMELPA 314

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +  + +PQK+L+F+A++    R +WI +WQ+AVSR
Sbjct: 315 GFDTLTVPQKALQFDAKDVADNRTKWIQAWQSAVSR 350


>gi|238782660|ref|ZP_04626690.1| Thiamine-binding periplasmic protein [Yersinia bercovieri ATCC
           43970]
 gi|238716320|gb|EEQ08302.1| Thiamine-binding periplasmic protein [Yersinia bercovieri ATCC
           43970]
          Length = 350

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/336 (55%), Positives = 252/336 (75%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F RI+  + +++             KP LTVYTY+SF AD G GP IK+AFE +C+C+
Sbjct: 21  KVFKRIIPCLFLLSAAAVAAD------KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQ 74

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLFA S +D S L LP  
Sbjct: 75  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFAPSQVDTSTLTLPEP 134

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W + IFVPYDYGY AF+YDK ++  PPK+  EL++S  PWK+IYQDPRTST GLGL+LW+
Sbjct: 135 WQNRIFVPYDYGYFAFVYDKNKLKNPPKSLQELVSSKAPWKVIYQDPRTSTPGLGLMLWM 194

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   + +Y
Sbjct: 195 QKVYGDKAPQAWQELAKKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEQKSNY 254

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA Q+  SKQP+LAQ FM+F+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 255 AAADFSEGHYLQVEVAGQVASSKQPELAQRFMKFIVTPAFQNHIPTGNWMYPVIKMDLPA 314

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQK+L+F+A+E    R +WI +WQ+AVSR
Sbjct: 315 GFETLTVPQKALQFDAKEVADNRGKWIQAWQSAVSR 350


>gi|222031902|emb|CAP74640.1| Thiamine-binding periplasmic protein [Escherichia coli LF82]
 gi|312944676|gb|ADR25503.1| thiamine transporter substrate binding subunit [Escherichia coli
           O83:H1 str. NRG 857C]
          Length = 327

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+PVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  ARPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAAEAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|170682457|ref|YP_001742189.1| thiamine transporter substrate binding subunit [Escherichia coli
           SMS-3-5]
 gi|170520175|gb|ACB18353.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli SMS-3-5]
          Length = 327

 Score =  424 bits (1090), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+ LN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSFLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|110640282|ref|YP_668010.1| thiamine transporter substrate binding subunit [Escherichia coli
           536]
 gi|161486336|ref|NP_752036.2| thiamine transporter substrate binding subunit [Escherichia coli
           CFT073]
 gi|191174230|ref|ZP_03035741.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli F11]
 gi|215485235|ref|YP_002327666.1| thiamine transporter substrate binding subunit [Escherichia coli
           O127:H6 str. E2348/69]
 gi|227885028|ref|ZP_04002833.1| thiamine-binding periplasmic protein precursor [Escherichia coli
           83972]
 gi|300981047|ref|ZP_07175324.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           45-1]
 gi|300984214|ref|ZP_07176942.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           200-1]
 gi|306815332|ref|ZP_07449481.1| thiamine transporter substrate binding subunit [Escherichia coli
           NC101]
 gi|312966195|ref|ZP_07780421.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 2362-75]
 gi|110341874|gb|ABG68111.1| thiamine-binding periplasmic protein precursor [Escherichia coli
           536]
 gi|190905515|gb|EDV65143.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli F11]
 gi|215263307|emb|CAS07622.1| thiamin transporter subunit TbpA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|227837857|gb|EEJ48323.1| thiamine-binding periplasmic protein precursor [Escherichia coli
           83972]
 gi|300306744|gb|EFJ61264.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           200-1]
 gi|300409083|gb|EFJ92621.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           45-1]
 gi|305850994|gb|EFM51449.1| thiamine transporter substrate binding subunit [Escherichia coli
           NC101]
 gi|307551915|gb|ADN44690.1| ABC-type thiamine transport system [Escherichia coli ABU 83972]
 gi|312289438|gb|EFR17332.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli 2362-75]
 gi|315294694|gb|EFU54037.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli MS 153-1]
 gi|324012330|gb|EGB81549.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           60-1]
          Length = 327

 Score =  424 bits (1090), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAAEAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y A  FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|260853280|ref|YP_003227171.1| thiamin transporter subunit TbpA [Escherichia coli O26:H11 str.
           11368]
 gi|257751929|dbj|BAI23431.1| thiamin transporter subunit TbpA [Escherichia coli O26:H11 str.
           11368]
 gi|323157870|gb|EFZ43973.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli EPECa14]
          Length = 327

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 189/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQD RTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDLRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|26106394|gb|AAN78580.1|AE016755_80 Thiamine-binding periplasmic protein precursor [Escherichia coli
           CFT073]
          Length = 331

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 22  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 82  VVLGLDNNLLDAASKTGLFAKSGVAAEAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 141

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 142 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 201

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y A  FSEGHYLQ+EVAA+   SKQP+
Sbjct: 202 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFSEGHYLQVEVAARTAASKQPE 261

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 262 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 321

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 322 ISEWQRAVSR 331


>gi|82775473|ref|YP_401820.1| thiamine transporter substrate binding subunit [Shigella
           dysenteriae Sd197]
 gi|309787263|ref|ZP_07681875.1| thiamin pyrophosphate ABC transporter, thiamin pyrophospate-binding
           protein [Shigella dysenteriae 1617]
 gi|81239621|gb|ABB60331.1| thiamin-binding periplasmic protein [Shigella dysenteriae Sd197]
 gi|308924841|gb|EFP70336.1| thiamin pyrophosphate ABC transporter, thiamin pyrophospate-binding
           protein [Shigella dysenteriae 1617]
          Length = 327

 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQ+PRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQEPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|281177289|dbj|BAI53619.1| thiamin ABC transporter substrate binding component [Escherichia
           coli SE15]
 gi|330909917|gb|EGH38427.1| thiamin ABC transporter, substrate-binding component [Escherichia
           coli AA86]
          Length = 327

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS +    + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVATEAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|157368982|ref|YP_001476971.1| thiamine transporter substrate binding subunit [Serratia
           proteamaculans 568]
 gi|157320746|gb|ABV39843.1| thiamine ABC transporter, periplasmic binding protein [Serratia
           proteamaculans 568]
          Length = 328

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 244/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE +C+CELK + L DGV+LLN+LRMEG+NSAAD
Sbjct: 19  AKPVLTVYTYDSFAADWGPGPAVKKAFEAQCDCELKFVALEDGVSLLNRLRMEGKNSAAD 78

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A++TGLFA SN+D+++L +P  W D  FVPYDYGY AF+Y+K ++  P
Sbjct: 79  VVLGLDNNLLQAAQQTGLFAPSNVDSTKLSVPGGWQDKTFVPYDYGYFAFVYNKEKLKNP 138

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S + WK+IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 139 PKSLQELVDSDQNWKVIYEDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAKKTVTVTKGW 198

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE D VLSY+TSP ++L+   +D Y AA FSEGHYLQ+EVA +L   KQP+
Sbjct: 199 SEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKDSYAAANFSEGHYLQVEVAGKLKAGKQPE 258

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQFM++P+FQ  +PT NWMYPV+   +P  ++ + +PQ +L+++AEE  + R  W
Sbjct: 259 LAERFMQFMVTPAFQNSIPTGNWMYPVIKTQLPAGFEQMTVPQTALQYSAEEVAKQRGNW 318

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 319 IRAWQTAVSH 328


>gi|238791146|ref|ZP_04634785.1| Thiamine-binding periplasmic protein [Yersinia intermedia ATCC
           29909]
 gi|238729279|gb|EEQ20794.1| Thiamine-binding periplasmic protein [Yersinia intermedia ATCC
           29909]
          Length = 350

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 253/336 (75%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F RI+  + +++             KP LTVYTY+SF AD G GP IK+AFE +C+C+
Sbjct: 21  KVFKRIIPCLFLLSAAAVAAD------KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQ 74

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLFA S +D + L LP K
Sbjct: 75  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFAPSQVDTANLTLPEK 134

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  EL++S +PWK+IYQDPRTST GLGL+LW+
Sbjct: 135 WQNKTFVPYDYGYFAFVYNKDKLKNPPKSLQELVDSKEPWKVIYQDPRTSTPGLGLMLWM 194

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   + +Y
Sbjct: 195 QKVYGDKAPQAWQQLAKKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSNY 254

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA Q+  SKQPQLAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 255 AAANFSEGHYLQVEVAGQVASSKQPQLAQRFMQFIVTPAFQDHIPTGNWMYPVIKMDLPA 314

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++A+ +PQK+L+F+A++    R +WI +WQ+AVS 
Sbjct: 315 GFEALTVPQKALQFDAKDVADNRGKWIQAWQSAVSH 350


>gi|191167764|ref|ZP_03029571.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli B7A]
 gi|218693538|ref|YP_002401205.1| thiamine transporter substrate binding subunit [Escherichia coli
           55989]
 gi|300821929|ref|ZP_07102073.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           119-7]
 gi|309796055|ref|ZP_07690467.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           145-7]
 gi|331666303|ref|ZP_08367184.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA271]
 gi|331680639|ref|ZP_08381298.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli H591]
 gi|190902190|gb|EDV61932.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia coli B7A]
 gi|218350270|emb|CAU95953.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia coli 55989]
 gi|300525529|gb|EFK46598.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           119-7]
 gi|308120297|gb|EFO57559.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           145-7]
 gi|324118418|gb|EGC12312.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           E1167]
 gi|331066514|gb|EGI38391.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA271]
 gi|331072102|gb|EGI43438.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli H591]
          Length = 327

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 242/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF A+ G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAANWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|331645176|ref|ZP_08346287.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli M605]
 gi|331045933|gb|EGI18052.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli M605]
          Length = 331

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 22  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS +    + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 82  VVLGLDNNLLDAASKTGLFAKSGVATEAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 141

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 142 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 201

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 202 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 261

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 262 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 321

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 322 ISEWQRAVSR 331


>gi|218703328|ref|YP_002410847.1| thiamine transporter substrate binding subunit [Escherichia coli
           UMN026]
 gi|293403143|ref|ZP_06647240.1| tbpA [Escherichia coli FVEC1412]
 gi|298378671|ref|ZP_06988555.1| thiamine transport system substrate-binding protein [Escherichia
           coli FVEC1302]
 gi|300900904|ref|ZP_07119040.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           198-1]
 gi|331661439|ref|ZP_08362363.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA143]
 gi|218430425|emb|CAR11292.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia coli UMN026]
 gi|291430058|gb|EFF03072.1| tbpA [Escherichia coli FVEC1412]
 gi|298281005|gb|EFI22506.1| thiamine transport system substrate-binding protein [Escherichia
           coli FVEC1302]
 gi|300355616|gb|EFJ71486.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           198-1]
 gi|331061354|gb|EGI33317.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA143]
          Length = 327

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y  A FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYATANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|331671586|ref|ZP_08372384.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA280]
 gi|331071431|gb|EGI42788.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA280]
          Length = 327

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNRLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y  A FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYATANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|218687946|ref|YP_002396158.1| thiamine transporter substrate binding subunit [Escherichia coli
           ED1a]
 gi|331661112|ref|ZP_08362044.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA206]
 gi|218425510|emb|CAR06292.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia coli ED1a]
 gi|315299976|gb|EFU59214.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli MS 16-3]
 gi|324008418|gb|EGB77637.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli MS 57-2]
 gi|331052154|gb|EGI24193.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophosphate-binding protein [Escherichia coli TA206]
          Length = 327

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVPYDYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAAEAVNVPGGWNNDTFVPYDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y A  F EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFIEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|145600367|ref|YP_001164443.1| thiamine transporter substrate binding subunit [Yersinia pestis
           Pestoides F]
 gi|186894016|ref|YP_001871128.1| thiamine transporter substrate binding subunit [Yersinia
           pseudotuberculosis PB1/+]
 gi|108774210|gb|ABG16729.1| thiamine-binding periplasmic protein [Yersinia pestis Nepal516]
 gi|108781477|gb|ABG15535.1| thiamine-binding periplasmic protein [Yersinia pestis Antiqua]
 gi|145212063|gb|ABP41470.1| thiamine-binding periplasmic protein [Yersinia pestis Pestoides F]
 gi|186697042|gb|ACC87671.1| thiamine ABC transporter, periplasmic binding protein [Yersinia
           pseudotuberculosis PB1/+]
          Length = 358

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 252/336 (75%), Gaps = 5/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F  I+  +++I+   +         KP LTVYTY+SF AD G GP IKQAFE +C+C+
Sbjct: 28  KVFKHIISCLLLISATSALAA-----EKPTLTVYTYDSFAADWGPGPAIKQAFEAECDCQ 82

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLF  S +D   L LP  
Sbjct: 83  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFTPSQVDTRNLTLPEP 142

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  ELI+S +PWK+IYQDPRTST GLGL+LW+
Sbjct: 143 WQNKTFVPYDYGYFAFVYNKEKLKNPPKSLHELISSKEPWKVIYQDPRTSTPGLGLMLWM 202

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++L+    ++Y
Sbjct: 203 QKVYGDQAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNY 262

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA QL  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 263 AAADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPA 322

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQ +L+F+A++    R++WI +WQ+AVSR
Sbjct: 323 GFETLAVPQTALQFDAKDVADNRSKWIQAWQSAVSR 358


>gi|270263935|ref|ZP_06192203.1| transporter [Serratia odorifera 4Rx13]
 gi|270042128|gb|EFA15224.1| transporter [Serratia odorifera 4Rx13]
          Length = 328

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/310 (59%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF AD G GP +K+AFE  CNCELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 19  AKPTLTVYTYDSFAADWGPGPAVKKAFEADCNCELKFVALEDGVSLLNRLRMEGKNSTAD 78

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A++TGLFA S +D ++L +P  W D  FVPYDYGY AF+Y+K ++  P
Sbjct: 79  VVLGLDNNLLQAAQQTGLFAPSRVDGAKLSVPGGWQDKTFVPYDYGYFAFVYNKDKLKNP 138

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+N  + WK+IY+DPRTST GLGLLLW+QK++GDN+ + W+K+A KT TVTKGW
Sbjct: 139 PKSLQELVNGDQNWKVIYEDPRTSTPGLGLLLWMQKVFGDNAPEAWQKLAKKTVTVTKGW 198

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE D VLSY+TSP ++L+   +D Y AA FSEGHYLQ+EVA +L  SKQP+
Sbjct: 199 SEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKDSYAAANFSEGHYLQVEVAGKLKASKQPE 258

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQFM++P+FQ  +PT NWMYPV+   +P  ++ + +PQ +L+++AEE  + R  W
Sbjct: 259 LAERFMQFMVTPAFQNTIPTGNWMYPVIKTQLPAGFEQMTVPQTALQYSAEEVAKQRGSW 318

Query: 328 ISSWQNAVSR 337
           I +WQ AVSR
Sbjct: 319 IRAWQTAVSR 328


>gi|21960626|gb|AAM87199.1|AE013968_1 thiamin-binding periplasmic protein of ABC transporter [Yersinia
           pestis KIM 10]
          Length = 360

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 252/336 (75%), Gaps = 5/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F  I+  +++I+   +         KP LTVYTY+SF AD G GP IKQAFE +C+C+
Sbjct: 30  KVFKHIISCLLLISATSALAA-----EKPTLTVYTYDSFAADWGPGPAIKQAFEAECDCQ 84

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLF  S +D   L LP  
Sbjct: 85  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFTPSQVDTRNLTLPEP 144

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  ELI+S +PWK+IYQDPRTST GLGL+LW+
Sbjct: 145 WQNKTFVPYDYGYFAFVYNKEKLKNPPKSLHELISSKEPWKVIYQDPRTSTPGLGLMLWM 204

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++L+    ++Y
Sbjct: 205 QKVYGDQAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNY 264

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA QL  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 265 AAADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPA 324

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQ +L+F+A++    R++WI +WQ+AVSR
Sbjct: 325 GFETLAVPQTALQFDAKDVADNRSKWIQAWQSAVSR 360


>gi|238752404|ref|ZP_04613881.1| Thiamine-binding periplasmic protein [Yersinia rohdei ATCC 43380]
 gi|238709337|gb|EEQ01578.1| Thiamine-binding periplasmic protein [Yersinia rohdei ATCC 43380]
          Length = 347

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 188/336 (55%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F RI+  + +++             KP LTVYTY+SF AD G GP IK+AFE +C+C+
Sbjct: 18  KVFKRIIPCLFLLSAAAVAAE------KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQ 71

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD+VLG DNNL+  A +TGLFA S +D   L LP  
Sbjct: 72  LKFVALEDGVSLLNRLRMEGKNSQADVVLGLDNNLVQAAEQTGLFAPSQVDTRHLTLPEA 131

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  ELI++ +PWK+IYQDPRTST GLGLLLW+
Sbjct: 132 WQNKTFVPYDYGYFAFVYNKEKVKNPPKSLQELIDTQEPWKVIYQDPRTSTPGLGLLLWM 191

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+K+A KT TVTKGW+E+YG FLKGE DFVLSY+TSP ++L+    D Y
Sbjct: 192 QKVYGDQAPQAWQKLAKKTVTVTKGWSEAYGLFLKGEGDFVLSYTTSPAYHLIEEKNDHY 251

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA  +  SKQP+LAQ FMQFM++P+FQ  +PT NWMYPV+ +  P 
Sbjct: 252 AAADFSEGHYLQVEVAGVVASSKQPELAQRFMQFMVTPAFQNHIPTGNWMYPVIKMDFPA 311

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +  + +PQ +L+F+A++    R++WI +WQ+AVSR
Sbjct: 312 GFDTLTVPQTALQFDAKDVADNRSKWIQTWQSAVSR 347


>gi|324112523|gb|EGC06500.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia
           fergusonii B253]
          Length = 327

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/310 (60%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A    +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAFNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y  A FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAVANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|74310685|ref|YP_309104.1| thiamine transporter substrate binding subunit [Shigella sonnei
           Ss046]
 gi|73854162|gb|AAZ86869.1| thiamin-binding periplasmic protein [Shigella sonnei Ss046]
          Length = 327

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY  F+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFTFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+ P+FQ  +PT NWMYPV +++ P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVYPAFQNAIPTGNWMYPVANVTQPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|162421366|ref|YP_001607320.1| thiamine transporter substrate-binding subunit [Yersinia pestis
           Angola]
 gi|165928064|ref|ZP_02223896.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165937811|ref|ZP_02226372.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166008690|ref|ZP_02229588.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211882|ref|ZP_02237917.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167401205|ref|ZP_02306705.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167422008|ref|ZP_02313761.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167426451|ref|ZP_02318204.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|270487878|ref|ZP_06204952.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis KIM D27]
 gi|294502617|ref|YP_003566679.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Yersinia pestis Z176003]
 gi|162354181|gb|ABX88129.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis Angola]
 gi|165914223|gb|EDR32839.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165919925|gb|EDR37226.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165992029|gb|EDR44330.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166206628|gb|EDR51108.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166960145|gb|EDR56166.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049230|gb|EDR60638.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167054549|gb|EDR64357.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|262360648|gb|ACY57369.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis D106004]
 gi|262364593|gb|ACY61150.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis D182038]
 gi|270336382|gb|EFA47159.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Yersinia pestis KIM D27]
 gi|294353076|gb|ADE63417.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Yersinia pestis Z176003]
          Length = 348

 Score =  422 bits (1086), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 252/336 (75%), Gaps = 5/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F  I+  +++I+   +         KP LTVYTY+SF AD G GP IKQAFE +C+C+
Sbjct: 18  KVFKHIISCLLLISATSALAA-----EKPTLTVYTYDSFAADWGPGPAIKQAFEAECDCQ 72

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLF  S +D   L LP  
Sbjct: 73  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFTPSQVDTRNLTLPEP 132

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  ELI+S +PWK+IYQDPRTST GLGL+LW+
Sbjct: 133 WQNKTFVPYDYGYFAFVYNKEKLKNPPKSLHELISSKEPWKVIYQDPRTSTPGLGLMLWM 192

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++L+    ++Y
Sbjct: 193 QKVYGDQAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNY 252

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA QL  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 253 AAADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPA 312

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQ +L+F+A++    R++WI +WQ+AVSR
Sbjct: 313 GFETLAVPQTALQFDAKDVADNRSKWIQAWQSAVSR 348


>gi|123441004|ref|YP_001004993.1| thiamine transporter substrate binding subunit [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122087965|emb|CAL10753.1| thiamine-binding periplasmic protein [Yersinia enterocolitica
           subsp. enterocolitica 8081]
          Length = 320

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 182/309 (58%), Positives = 243/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GP IK+AFE +C+C+LK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 12  KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADV 71

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNL+  A +TGLF  S +D S+L LP KW ++ FVPYDYGY AF+YDK ++  PP
Sbjct: 72  ILGLDNNLVQAAEQTGLFVPSQVDTSKLTLPEKWQNNTFVPYDYGYFAFVYDKNKLKNPP 131

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL++S +PWK+IYQDPRTST GLGL+LW+QK+YGD + Q W+++A KT TVTKGW+
Sbjct: 132 KSLQELVDSKEPWKVIYQDPRTSTPGLGLMLWMQKVYGDKAPQAWQQLAKKTVTVTKGWS 191

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE D VLSY+TSP ++L+   + +Y AA FSEGHYLQ+EVA  +  SKQP+L
Sbjct: 192 EAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSNYAAADFSEGHYLQVEVAGVVASSKQPEL 251

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           AQ FMQFM++P+FQ  +PT NWMYPV+ + +P  +  + +PQK+L+F+A++    R +WI
Sbjct: 252 AQRFMQFMVTPAFQNHIPTGNWMYPVIKMDLPAGFDTLTVPQKALQFDAKDVADNRGKWI 311

Query: 329 SSWQNAVSR 337
            +WQ+AVSR
Sbjct: 312 QAWQSAVSR 320


>gi|170025757|ref|YP_001722262.1| thiamine transporter substrate binding subunit [Yersinia
           pseudotuberculosis YPIII]
 gi|169752291|gb|ACA69809.1| thiamine ABC transporter, periplasmic binding protein [Yersinia
           pseudotuberculosis YPIII]
          Length = 358

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 252/336 (75%), Gaps = 5/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F  I+  +++I+   +         KP LTVYTY+SF AD G GP IKQAFE +C+C+
Sbjct: 28  KVFKHIISCLLLISATSALAA-----EKPTLTVYTYDSFAADWGPGPAIKQAFEAECDCQ 82

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLF  S +D   L LP  
Sbjct: 83  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFTPSPVDTRNLTLPEP 142

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+Y+K ++  PPK+  ELI+S +PWK+IYQDPRTST GLGL+LW+
Sbjct: 143 WQNKTFVPYDYGYFAFVYNKEKLKNPPKSLHELISSKEPWKVIYQDPRTSTPGLGLMLWM 202

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+++A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++L+    ++Y
Sbjct: 203 QKVYGDQAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNY 262

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA QL  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 263 AAADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPA 322

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ + +PQ +L+F+A++    R++WI +WQ+AVSR
Sbjct: 323 GFETLTVPQTALQFDAKDVADNRSKWIQAWQSAVSR 358


>gi|45443389|ref|NP_994928.1| thiamine transporter substrate binding subunit [Yersinia pestis
           biovar Microtus str. 91001]
 gi|51595014|ref|YP_069205.1| thiamine transporter substrate binding subunit [Yersinia
           pseudotuberculosis IP 32953]
 gi|150260440|ref|ZP_01917168.1| thiamine-binding periplasmic protein [Yersinia pestis CA88-4125]
 gi|161484745|ref|NP_670948.2| thiamine transporter substrate binding subunit [Yersinia pestis KIM
           10]
 gi|162100157|ref|YP_653480.2| thiamine transporter substrate binding subunit [Yersinia pestis
           Antiqua]
 gi|162139449|ref|YP_646329.2| thiamine transporter substrate binding subunit [Yersinia pestis
           Nepal516]
 gi|167466797|ref|ZP_02331501.1| thiamin transporter substrate binding subunit [Yersinia pestis
           FV-1]
 gi|218927721|ref|YP_002345596.1| thiamine transporter substrate binding subunit [Yersinia pestis
           CO92]
 gi|229836891|ref|ZP_04457056.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis Pestoides A]
 gi|229840412|ref|ZP_04460571.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229842492|ref|ZP_04462647.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229900750|ref|ZP_04515874.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis Nepal516]
 gi|45438258|gb|AAS63805.1| thiamine-binding periplasmic protein [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588296|emb|CAH19903.1| ABC transporter, periplasmic thiamine binding protein tbpA
           [Yersinia pseudotuberculosis IP 32953]
 gi|115346332|emb|CAL19203.1| thiamine-binding periplasmic protein [Yersinia pestis CO92]
 gi|149289848|gb|EDM39925.1| thiamine-binding periplasmic protein [Yersinia pestis CA88-4125]
 gi|229682089|gb|EEO78181.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis Nepal516]
 gi|229690802|gb|EEO82856.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis biovar Orientalis str. India 195]
 gi|229696778|gb|EEO86825.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis biovar Orientalis str. PEXU2]
 gi|229705834|gb|EEO91843.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis Pestoides A]
 gi|320016893|gb|ADW00465.1| periplasmic-binding component of thiamin ABC transporter [Yersinia
           pestis biovar Medievalis str. Harbin 35]
          Length = 330

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/334 (55%), Positives = 251/334 (75%), Gaps = 5/334 (1%)

Query: 4   FARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
           F  I+  +++I+   +         KP LTVYTY+SF AD G GP IKQAFE +C+C+LK
Sbjct: 2   FKHIISCLLLISATSALAA-----EKPTLTVYTYDSFAADWGPGPAIKQAFEAECDCQLK 56

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD 123
            + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLF  S +D   L LP  W 
Sbjct: 57  FVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFTPSQVDTRNLTLPEPWQ 116

Query: 124 DDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
           +  FVPYDYGY AF+Y+K ++  PPK+  ELI+S +PWK+IYQDPRTST GLGL+LW+QK
Sbjct: 117 NKTFVPYDYGYFAFVYNKEKLKNPPKSLHELISSKEPWKVIYQDPRTSTPGLGLMLWMQK 176

Query: 184 IYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
           +YGD + Q W+++A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++L+    ++Y A
Sbjct: 177 VYGDQAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNYAA 236

Query: 244 ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVY 303
           A FSEGHYLQ+EVA QL  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P  +
Sbjct: 237 ADFSEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPAGF 296

Query: 304 QAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           + + +PQ +L+F+A++    R++WI +WQ+AVSR
Sbjct: 297 ETLAVPQTALQFDAKDVADNRSKWIQAWQSAVSR 330


>gi|56412380|ref|YP_149455.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|56126637|gb|AAV76143.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
          Length = 327

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|301048457|ref|ZP_07195484.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           185-1]
 gi|300299750|gb|EFJ56135.1| thiamin/thiamine pyrophosphate ABC transporter [Escherichia coli MS
           185-1]
          Length = 327

 Score =  421 bits (1083), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAAEAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+  A  FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNSAATNFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|320197481|gb|EFW72095.1| Thiamin ABC transporter, substrate-binding component [Escherichia
           coli WV_060327]
          Length = 327

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS +    + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVATEVVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y A  FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|197250327|ref|YP_002145092.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197214030|gb|ACH51427.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
          Length = 327

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 243/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W++D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWENDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|238911165|ref|ZP_04655002.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|326626470|gb|EGE32813.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 327

 Score =  421 bits (1081), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/309 (59%), Positives = 242/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+S+P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVSLPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|317046877|ref|YP_004114525.1| thiamine ABC transporter periplasmic-binding protein [Pantoea sp.
           At-9b]
 gi|316948494|gb|ADU67969.1| thiamine ABC transporter, periplasmic binding protein [Pantoea sp.
           At-9b]
          Length = 328

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 182/306 (59%), Positives = 240/306 (78%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTVYTY+SF AD G GP +++AFE +C CELK + L DGV+LLN++RMEG+NS ADIVLG
Sbjct: 23  LTVYTYDSFSADWGPGPAVQKAFEAQCGCELKYVALEDGVSLLNRVRMEGKNSKADIVLG 82

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNF 151
            DNNL+  A KTGLFAKS +D   L+LP  W +D F+P+DYGY AF+YDK ++  PPK+ 
Sbjct: 83  LDNNLVQAAEKTGLFAKSKVDTRALQLPDGWHNDTFIPFDYGYFAFVYDKNKLQNPPKSL 142

Query: 152 DELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY 211
            EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW+E+Y
Sbjct: 143 KELVESPEKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPEAWQKLAQKTVTVTKGWSEAY 202

Query: 212 GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQE 271
           G FLKGE D VLSY+TSP ++++   +++Y AA FSEGHY+Q+EVAAQL  SKQPQLAQ+
Sbjct: 203 GLFLKGEGDLVLSYTTSPAYHIIEEKKENYAAAPFSEGHYMQVEVAAQLASSKQPQLAQQ 262

Query: 272 FMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           FMQFM+SP+FQ+ +PT NWMYPV+   +P  YQ + IPQ +L+++  +   +R  WIS+W
Sbjct: 263 FMQFMVSPAFQQTIPTGNWMYPVIKSDLPAGYQTLHIPQTALQYSPADVAEHRAAWISAW 322

Query: 332 QNAVSR 337
           Q AVSR
Sbjct: 323 QRAVSR 328


>gi|238755747|ref|ZP_04617080.1| Thiamine-binding periplasmic protein [Yersinia ruckeri ATCC 29473]
 gi|238706039|gb|EEP98423.1| Thiamine-binding periplasmic protein [Yersinia ruckeri ATCC 29473]
          Length = 349

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 239/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GP IKQAFE +C+CELK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 41  KPTLTVYTYDSFAADWGPGPAIKQAFEAECHCELKFVALEDGVSLLNRLRMEGKNSPADV 100

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNL+  A KTGLF  S +D S+L LP  W ++ FVPYDYGY AF+Y+K +I  PP
Sbjct: 101 ILGLDNNLVQSAEKTGLFVPSQVDTSKLVLPDVWQNNTFVPYDYGYFAFVYNKDKIKNPP 160

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  ELI+S  PWKIIYQDPRTST GLGL+LW+QK+YGD +   W+++A KT TVTKGW+
Sbjct: 161 KSLHELISSETPWKIIYQDPRTSTPGLGLMLWMQKVYGDKTPTAWQQLAKKTVTVTKGWS 220

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE DFVLSY+TSP ++L+   +  Y AA FSEGHYLQ+EVA Q+  SKQP+L
Sbjct: 221 EAYGLFLKGEGDFVLSYTTSPAYHLIEEQKTQYAAADFSEGHYLQVEVAGQVASSKQPEL 280

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A +FMQF+ISP+FQ  +PT NWMYPV+ + +P  +  + +PQK+L FN ++    R++WI
Sbjct: 281 AHKFMQFIISPAFQNHIPTGNWMYPVIKMDLPAGFDTLTVPQKALEFNVKDVADNRSKWI 340

Query: 329 SSWQNAVSR 337
            +WQ+AVS 
Sbjct: 341 QAWQSAVSH 349


>gi|162138510|ref|YP_539117.2| thiamine transporter substrate binding subunit [Escherichia coli
           UTI89]
 gi|218557009|ref|YP_002389922.1| thiamine transporter substrate binding subunit [Escherichia coli
           S88]
 gi|237704216|ref|ZP_04534697.1| thiamine-binding periplasmic protein [Escherichia sp. 3_2_53FAA]
 gi|218363778|emb|CAR01439.1| thiamin transporter subunit ; periplasmic-binding component of ABC
           superfamily [Escherichia coli S88]
 gi|226902128|gb|EEH88387.1| thiamine-binding periplasmic protein [Escherichia sp. 3_2_53FAA]
 gi|294492148|gb|ADE90904.1| thiamine/thiamine pyrophosphate ABC transporter, periplasmic
           thiamine/thiamine pyrophospate-binding protein
           [Escherichia coli IHE3034]
 gi|307629644|gb|ADN73948.1| thiamine transporter substrate binding subunit [Escherichia coli
           UM146]
 gi|315285099|gb|EFU44544.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Escherichia coli MS 110-3]
 gi|323950933|gb|EGB46810.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           H252]
 gi|323955266|gb|EGB51039.1| thiamine/thiamine pyrophosphate ABC transporter [Escherichia coli
           H263]
          Length = 327

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KT LFAKS + A  + +P  W++D FVPYDYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTELFAKSGVAAEAVNVPGGWNNDTFVPYDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y A  F EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFIEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|291616247|ref|YP_003518989.1| TbpA [Pantoea ananatis LMG 20103]
 gi|291151277|gb|ADD75861.1| TbpA [Pantoea ananatis LMG 20103]
          Length = 328

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 253/328 (77%), Gaps = 3/328 (0%)

Query: 13  MITGVISYCTLDGLP---AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSD 69
           M+  V+    L   P   AKPVLTVYTY++F AD G GP +K+AFE +C CELK + L D
Sbjct: 1   MLKNVLPVLLLLSAPVFAAKPVLTVYTYDAFSADWGPGPAVKKAFEAQCGCELKFVALED 60

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVP 129
           GV+LLN++RMEG+N+ AD+VLG DNNL+  A++TGLFAKS++D  +L++P  W D  FVP
Sbjct: 61  GVSLLNRVRMEGKNTKADVVLGLDNNLLQAAQQTGLFAKSDVDTRELQVPGGWKDTTFVP 120

Query: 130 YDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS 189
           +DYGY AF+Y+K  +  PP +  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+
Sbjct: 121 FDYGYFAFVYNKNTLKNPPTSLKELVESPEKWRVIYEDPRTSTPGLGLLLWMQKVYGDNA 180

Query: 190 AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEG 249
            + W+K+A KT TVTKGW+E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EG
Sbjct: 181 PEAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAASFAEG 240

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIP 309
           +YLQ+EVAA+L  SKQP+LA++FMQFM++P+FQ  +PT NWMYPV+   +P  + ++ +P
Sbjct: 241 NYLQVEVAARLANSKQPKLAEQFMQFMVTPAFQNTIPTGNWMYPVIKTDLPAGFASLSVP 300

Query: 310 QKSLRFNAEETTRYRNQWISSWQNAVSR 337
           + +L+F+ EE   +R+QW+S WQ AVSR
Sbjct: 301 KTTLQFSPEEVASHRSQWVSQWQRAVSR 328


>gi|16759103|ref|NP_454720.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16763498|ref|NP_459113.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29140653|ref|NP_803995.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|161612446|ref|YP_001586411.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167989975|ref|ZP_02571075.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|168230380|ref|ZP_02655438.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|168243483|ref|ZP_02668415.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168262213|ref|ZP_02684186.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|168464347|ref|ZP_02698250.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194444243|ref|YP_002039339.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194449014|ref|YP_002044076.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194469607|ref|ZP_03075591.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|197261698|ref|ZP_03161772.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|198245931|ref|YP_002214059.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200388666|ref|ZP_03215278.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|213161808|ref|ZP_03347518.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213427551|ref|ZP_03360301.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213620927|ref|ZP_03373710.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213650725|ref|ZP_03380778.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213855547|ref|ZP_03383787.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|289826167|ref|ZP_06545279.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25298359|pir||AI0515 thiamin-binding periplasmic protein precursor [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)
 gi|16418606|gb|AAL19072.1| thiamine-binding periplasmic protein [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16501393|emb|CAD01265.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29136277|gb|AAO67844.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|161361810|gb|ABX65578.1| hypothetical protein SPAB_00135 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402906|gb|ACF63128.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
 gi|194407318|gb|ACF67537.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|194455971|gb|EDX44810.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|195632649|gb|EDX51103.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|197239953|gb|EDY22573.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|197940447|gb|ACH77780.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199605764|gb|EDZ04309.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205331384|gb|EDZ18148.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|205335206|gb|EDZ21970.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|205337422|gb|EDZ24186.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|205348769|gb|EDZ35400.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|261245341|emb|CBG23130.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267991779|gb|ACY86664.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301156736|emb|CBW16211.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911077|dbj|BAJ35051.1| thiamine ABC transporter substrate binding protein [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           T000240]
 gi|321222322|gb|EFX47394.1| Thiamin ABC transporter, substrate-binding component [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323128425|gb|ADX15855.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|326621802|gb|EGE28147.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|332987060|gb|AEF06043.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 327

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 242/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|117622358|ref|YP_851271.1| thiamine transporter substrate binding subunit [Escherichia coli
           APEC O1]
 gi|91070705|gb|ABE05586.1| thiamine-binding periplasmic protein precursor [Escherichia coli
           UTI89]
 gi|115511482|gb|ABI99556.1| thiamine-binding periplasmic protein [Escherichia coli APEC O1]
          Length = 331

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 22  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KT LFAKS + A  + +P  W++D FVPYDYGY AF+YDK ++  P
Sbjct: 82  VVLGLDNNLLDAASKTELFAKSGVAAEAVNVPGGWNNDTFVPYDYGYFAFVYDKNKLKNP 141

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 142 PQSLKELVESDQNWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 201

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y A  F EGHYLQ+EVAA+   SKQP+
Sbjct: 202 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAATNFIEGHYLQVEVAARTAASKQPE 261

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 262 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 321

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 322 ISEWQRAVSR 331


>gi|161504773|ref|YP_001571885.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160866120|gb|ABX22743.1| hypothetical protein SARI_02897 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 327

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAATQTTLFAKSGVANEAIKVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP+FQ  +PT NWMYPV  +++P  ++ +  P  +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPAFQNAIPTGNWMYPVTQVALPSGFEQLSKPATALEFTPQQVAAQRQTW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|62178672|ref|YP_215089.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|224581949|ref|YP_002635747.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|62126305|gb|AAX64008.1| thiamine-binding periplasmic protein [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224466476|gb|ACN44306.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|322713125|gb|EFZ04696.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
          Length = 327

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 242/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLRNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|204926820|ref|ZP_03218022.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
 gi|204323485|gb|EDZ08680.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Javiana str.
           GA_MM04042433]
          Length = 327

 Score =  419 bits (1077), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 241/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGRNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|293392885|ref|ZP_06637203.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Serratia odorifera DSM
           4582]
 gi|291424744|gb|EFE97955.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Serratia odorifera DSM
           4582]
          Length = 318

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 241/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LTVYTY+SF AD G GP IK+ FE  C+CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 9   AKETLTVYTYDSFAADWGPGPAIKKTFEADCDCELKFVALEDGVSLLNRLRMEGKNSPAD 68

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A +TGLFA S +D ++L +P  W D  FVPYDYGY AF+Y+K+++  P
Sbjct: 69  VVLGLDNNLLQAAEQTGLFAPSGVDTARLTVPGGWQDRTFVPYDYGYFAFVYNKQKLKNP 128

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S +PWK+IYQDPRTST GLGLLLW+QK+YGD + Q W+++A KT TVTKGW
Sbjct: 129 PKSLQELVSSDRPWKVIYQDPRTSTPGLGLLLWMQKVYGDRAPQAWQQLAKKTVTVTKGW 188

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE D VLSY+TSP ++L+   QD Y AA FSEGHYLQIEVAA+L   K PQ
Sbjct: 189 SEAYGLFLKGEGDLVLSYTTSPAYHLIEEKQDMYAAANFSEGHYLQIEVAARLKAGKHPQ 248

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQFM++P+FQ  +PT NWMYPV+  ++P  + ++ +PQ +L+++A+E  + R+ W
Sbjct: 249 LAERFMQFMLTPAFQNTIPTGNWMYPVIKTTLPAGFDSMPVPQTALQYSAQEVAKQRSNW 308

Query: 328 ISSWQNAVSR 337
           I +WQ AVSR
Sbjct: 309 IRTWQTAVSR 318


>gi|168820905|ref|ZP_02832905.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205342407|gb|EDZ29171.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|320084348|emb|CBY94141.1| Thiamine-binding periplasmic protein Flags: Precursor [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           2007-60-3289-1]
          Length = 327

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 242/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|195940433|ref|ZP_03085815.1| thiamine transporter substrate binding subunit [Escherichia coli
           O157:H7 str. EC4024]
          Length = 327

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 186/327 (56%), Positives = 248/327 (75%), Gaps = 2/327 (0%)

Query: 13  MITGVISYCTLDGLP--AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDG 70
           M+  V+   +L  LP  AKPVLTVYTY+SF AD G GP +K+AFE  CNCELK + L DG
Sbjct: 1   MLKNVLPLLSLFALPVFAKPVLTVYTYDSFSADWGPGPVVKKAFEADCNCELKFVALEDG 60

Query: 71  VALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPY 130
           V+LLN+LRMEG+NS AD+VLG DNNL++ A +T LFAKS + A  + +P  W +D FVP+
Sbjct: 61  VSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTRLFAKSGVAADAVNVPGGWKNDTFVPF 120

Query: 131 DYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
           DYGY AF+YDK ++  PPK+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD + 
Sbjct: 121 DYGYFAFVYDKNKLKNPPKSLKELVESDQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKTP 180

Query: 191 QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGH 250
           + W+K+A KT TVTKGW+E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGH
Sbjct: 181 EAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIAEKKDNYAAANFAEGH 240

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ 310
           YLQ+EVAA+   SKQP+LA++F++FM+SP+FQ  +PT NWMYPV D+++P  ++ +  PQ
Sbjct: 241 YLQVEVAARTAASKQPELAEKFLKFMVSPAFQNAIPTGNWMYPVTDVALPAGFEQLNKPQ 300

Query: 311 KSLRFNAEETTRYRNQWISSWQNAVSR 337
            SL F  ++    R  WIS WQ AVSR
Sbjct: 301 TSLEFTPQQVAAQRAAWISEWQRAVSR 327


>gi|157147514|ref|YP_001454833.1| thiamine transporter substrate binding subunit [Citrobacter koseri
           ATCC BAA-895]
 gi|157084719|gb|ABV14397.1| hypothetical protein CKO_03314 [Citrobacter koseri ATCC BAA-895]
          Length = 331

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 185/310 (59%), Positives = 238/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP IK+AFE  C+CELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 22  AKPVLTVYTYDSFAADWGPGPTIKKAFEADCDCELKLVALEDGVSLLNRLRMEGKNSKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A +T LFAKS I    + +P  W +D FVP+DYGY AFIYDK ++  P
Sbjct: 82  VVLGLDNNLLEAATQTRLFAKSGIAPDAVNVPGGWHNDTFVPFDYGYFAFIYDKNKLKNP 141

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGDN+ + W+K+A KT TVTKGW
Sbjct: 142 PKSLKELVESDRKWRVIYQDPRTSTPGLGLLLWMQKVYGDNAPEAWQKLAAKTVTVTKGW 201

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +ESYG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 202 SESYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAASFSEGHYLQVEVAARTAASKQPE 261

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP+FQ  +PT NWMYPV D+++P  ++ +  P  +L F   E    R  W
Sbjct: 262 LAEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFEQLTKPSTTLEFTPAEVASQRQAW 321

Query: 328 ISSWQNAVSR 337
           IS WQ AVS 
Sbjct: 322 ISEWQRAVSH 331


>gi|238797478|ref|ZP_04640976.1| Thiamine-binding periplasmic protein [Yersinia mollaretii ATCC
           43969]
 gi|238718619|gb|EEQ10437.1| Thiamine-binding periplasmic protein [Yersinia mollaretii ATCC
           43969]
          Length = 349

 Score =  418 bits (1074), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 248/336 (73%), Gaps = 6/336 (1%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K F R++  + +++             KP LTVYTY+SF A+ G GP IK+AFE +C+C+
Sbjct: 20  KVFKRMIPCLFLLSAAAVAAD------KPTLTVYTYDSFAAEWGPGPAIKKAFEAECDCQ 73

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIK 121
           LK + L DGV+LLN+LRMEG+NS AD++LG DNNL+  A +TGLFA S +D   L LP  
Sbjct: 74  LKFVALEDGVSLLNRLRMEGKNSQADVILGLDNNLVQAAEQTGLFAPSQVDTRALTLPEP 133

Query: 122 WDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           W +  FVPYDYGY AF+YDK ++  PPK+ +EL++S  PW++IYQDPRTST GLGL+LW+
Sbjct: 134 WQNKTFVPYDYGYFAFVYDKNKLKNPPKSLEELVSSKAPWRVIYQDPRTSTPGLGLMLWM 193

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
           QK+YGD + Q W+ +A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   + +Y
Sbjct: 194 QKVYGDKAPQAWQALAKKTVTVTKGWSEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSNY 253

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPD 301
            AA FSEGHYLQ+EVA QL  SKQP+LAQ FMQF+++P+FQ  +PT NWMYPV+ + +P 
Sbjct: 254 AAADFSEGHYLQVEVAGQLASSKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMDLPA 313

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +  + +PQK+L+F+A+E    R +WI +WQ+AVS 
Sbjct: 314 GFDTLNVPQKALQFDAKEVADNRGKWIQAWQSAVSH 349


>gi|170768503|ref|ZP_02902956.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia albertii TW07627]
 gi|170122607|gb|EDS91538.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein
           [Escherichia albertii TW07627]
          Length = 327

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 238/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS +    + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVATEAINVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IY+DPRTST GLGLLLW+QKIYG+++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESAQNWRVIYEDPRTSTPGLGLLLWMQKIYGNDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  +  +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVALPAGFAQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVS 
Sbjct: 318 ISEWQRAVSH 327


>gi|253689980|ref|YP_003019170.1| thiamine ABC transporter, periplasmic binding protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251756558|gb|ACT14634.1| thiamine ABC transporter, periplasmic binding protein
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 338

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 237/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP IK AFE++C CEL  + L DG +LLN+LRMEG+NS AD
Sbjct: 29  AKPALTVYTYDSFASEWGPGPVIKTAFEKECECELNFVALEDGASLLNRLRMEGKNSKAD 88

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           I+LG DNNL+  A +TGLFA  N+D S + +P  W +  FVPYDYGY AF+Y+K  +  P
Sbjct: 89  IILGLDNNLLQAAEQTGLFAPHNLDTSAVTVPGGWSNKTFVPYDYGYFAFVYNKDTLKNP 148

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S  PWK+IYQDPRTST GLGLLLW+QK+YGD + Q W+K+A KT TVTKGW
Sbjct: 149 PKSLHELVDSNAPWKVIYQDPRTSTPGLGLLLWMQKVYGDEAPQAWQKLAKKTVTVTKGW 208

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA FSEGHYLQIE+A QL  SK P+
Sbjct: 209 SEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAATFSEGHYLQIEIAGQLASSKNPE 268

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQF++SP+FQ+ +PTTNWMYP V   +P  +  + +P+K+++F+A+E    R QW
Sbjct: 269 LAKRFMQFILSPTFQQAIPTTNWMYPAVKTDLPAGFATLTVPEKAMQFSAQEVADQRTQW 328

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 329 IQAWQRAVSH 338


>gi|284008554|emb|CBA75104.1| thiamine ABC transporter, substrate-binding protein [Arsenophonus
           nasoniae]
          Length = 260

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 191/259 (73%), Positives = 227/259 (87%)

Query: 79  MEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           MEG+NS ADIVLG DNNLIDLA+KTGLF +S ID SQLKLPIKWD++IF+PYDYGY AFI
Sbjct: 1   MEGKNSPADIVLGLDNNLIDLAKKTGLFTESRIDRSQLKLPIKWDNNIFIPYDYGYFAFI 60

Query: 139 YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIAT 198
           YDK ++T  PK+ DELINS++PWKIIYQDPRTST GLGLLLWIQKIYG NSAQ W+K+A 
Sbjct: 61  YDKTRVTHVPKSLDELINSSQPWKIIYQDPRTSTPGLGLLLWIQKIYGKNSAQAWQKMAA 120

Query: 199 KTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           KT TVTKGW+ESYG FLKGESDFVLSYS+SPGF+LLN  +++Y AA+FSEGHYLQIEVAA
Sbjct: 121 KTVTVTKGWSESYGLFLKGESDFVLSYSSSPGFHLLNDKKNNYAAAIFSEGHYLQIEVAA 180

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE 318
           QL  SKQP+LAQ+F+QFM+SP+ Q+ LPTTNWMYP++DI +P VYQ + +P+KSL+FNAE
Sbjct: 181 QLATSKQPKLAQQFIQFMLSPTVQKTLPTTNWMYPIIDIPLPKVYQQLAVPKKSLQFNAE 240

Query: 319 ETTRYRNQWISSWQNAVSR 337
           + T++RN WI  WQNAVS 
Sbjct: 241 DITQHRNHWIYLWQNAVSH 259


>gi|318607160|emb|CBY28658.1| thiamin ABC transporter, substrate-binding component [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 329

 Score =  417 bits (1073), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/309 (58%), Positives = 242/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GP IK+AFE +C+C+LK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 21  KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADV 80

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNL+  A +TGLF  S ++ S+L LP KW ++ FVPYDYGY AF+YDK ++  PP
Sbjct: 81  ILGLDNNLVQAAEQTGLFVSSQVNTSKLILPEKWQNNTFVPYDYGYFAFVYDKNKLKNPP 140

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL++S + WK+IYQDPRTST GLGL+LW+QK+YGD + Q W+++A KT TVTKGW+
Sbjct: 141 KSLQELVDSKEQWKVIYQDPRTSTPGLGLMLWMQKVYGDKAPQAWQQLAKKTVTVTKGWS 200

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE D VLSY+TSP ++L+   + +Y AA FSEGHYLQ+EVA  +  SKQP+L
Sbjct: 201 EAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSNYAAADFSEGHYLQVEVAGVVASSKQPEL 260

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           AQ FMQFM++P+FQ  +PT NWMYPV+ + +P  Y  + +PQK+L+F+A++    R +WI
Sbjct: 261 AQRFMQFMVTPAFQNHIPTGNWMYPVIKMDLPAGYDTLTVPQKALQFDAKDVADNRGKWI 320

Query: 329 SSWQNAVSR 337
            +WQ+AVSR
Sbjct: 321 QAWQSAVSR 329


>gi|227114221|ref|ZP_03827877.1| thiamine transporter substrate binding subunit [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
          Length = 338

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 238/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP IK AFE++C CEL  + L DG +LLN+LRMEG+NS AD
Sbjct: 29  AKPALTVYTYDSFASEWGPGPVIKTAFEKECECELNFVALEDGASLLNRLRMEGKNSKAD 88

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           I+LG DNNL+  A +TGLFA  N+D   + +P  W +  FVPYDYGY AF+Y+K  +  P
Sbjct: 89  IILGLDNNLLQAAEQTGLFAPHNLDTRAVTVPGGWSNKTFVPYDYGYFAFVYNKNTLKNP 148

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S +PWK+IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 149 PKSLHELVDSNEPWKVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 208

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA FSEGHYLQIEVA QL  SK P+
Sbjct: 209 SEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAATFSEGHYLQIEVAGQLASSKNPE 268

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQF++SP+FQ+ +PTTNWMYP V   +P  +  + +P+K+++F+A+E    R QW
Sbjct: 269 LAKRFMQFILSPTFQQAIPTTNWMYPAVKTDLPAGFATLAVPEKAMQFSAQEVADQRTQW 328

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 329 IQAWQRAVSH 338


>gi|317493305|ref|ZP_07951727.1| thiamin/thiamine pyrophosphate ABC transporter [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316918698|gb|EFV40035.1| thiamin/thiamine pyrophosphate ABC transporter [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 332

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 246/332 (74%), Gaps = 3/332 (0%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           RI+  +M+I+   +   +     KPVLTVYTY+SF A+ G GPK+K AFE++C CELK +
Sbjct: 4   RIIPALMLISTAFA---VHSAADKPVLTVYTYDSFAAEWGPGPKVKAAFEKECGCELKFV 60

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDD 125
            L DGV++LN++RMEG+ S+AD+VLG DNNL+  A KTGLF  SN+D   L +P  W ++
Sbjct: 61  ALEDGVSVLNRIRMEGQKSSADVVLGLDNNLVQAAEKTGLFVPSNVDTQTLTVPGGWRNN 120

Query: 126 IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY 185
            FVPYDYGY AF+Y+K  +  PP +  +LI S + WK+IYQDPRTST GLGL+LW+QK+Y
Sbjct: 121 TFVPYDYGYFAFVYNKNTLKNPPTSLKQLIESPEKWKVIYQDPRTSTPGLGLMLWMQKVY 180

Query: 186 GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAAL 245
           GD + Q W+K+A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA 
Sbjct: 181 GDQAPQAWQKLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAAE 240

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQA 305
           FSEGHYLQ+EVAAQL  SKQP+LA +FMQF+ +P+FQ  +PT NWMYPV+  ++P  ++ 
Sbjct: 241 FSEGHYLQVEVAAQLAGSKQPELAHKFMQFITTPAFQNEMPTGNWMYPVIQTTLPQGFEQ 300

Query: 306 IRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           + +P K+L F   E  + R  WI SWQ AVSR
Sbjct: 301 LNVPAKALEFTPAEVAQNRATWIRSWQAAVSR 332


>gi|307132608|ref|YP_003884624.1| thiamin ABC transporter periplasmic-binding component [Dickeya
           dadantii 3937]
 gi|306530137|gb|ADN00068.1| thiamin transporter subunit; periplasmic-binding component of ABC
           superfamily [Dickeya dadantii 3937]
          Length = 338

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP +K AFE++C+CELK + L DGVALLN+LRMEG+N+ AD
Sbjct: 29  AKPTLTVYTYDSFASEWGPGPDVKTAFEKECDCELKFVALEDGVALLNRLRMEGKNTPAD 88

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A +TGLFA   ++ S L +P  W +D F+P+DYGY AF+Y+K ++  P
Sbjct: 89  VVLGLDNNLVQAAAQTGLFAPHGVNTSGLTVPGGWHNDTFLPFDYGYFAFVYNKDKLKNP 148

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S +PWK+IY+DPRTST GLGLLLW+QK+YGD + Q W+K+A KT TVTKGW
Sbjct: 149 PKSLRELVESDQPWKVIYEDPRTSTPGLGLLLWMQKVYGDKAPQAWQKLAAKTVTVTKGW 208

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++L+   +D+Y AA FSEGHYLQ+EVAAQL  SK PQ
Sbjct: 209 SEAYGLFLKGEADLVLSYTTSPAYHLIAEKKDNYAAASFSEGHYLQVEVAAQLAGSKNPQ 268

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA  F+QFM+SP+FQ+I+PTTNWMYPV+   +P  Y  + +P  +L F +++    R  W
Sbjct: 269 LAARFLQFMVSPTFQQIIPTTNWMYPVIKTDLPAGYNTLSLPATALEFTSQQVAEQRANW 328

Query: 328 ISSWQNAVSR 337
           + +WQ AVSR
Sbjct: 329 VQAWQRAVSR 338


>gi|330012058|ref|ZP_08307255.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Klebsiella sp. MS 92-3]
 gi|328533972|gb|EGF60625.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Klebsiella sp. MS 92-3]
          Length = 327

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE +C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEAECGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A ++ LFAKSN+ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAAAQSKLFAKSNVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+   + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVEGPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHMIEEKKDNYAAASFAEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPGFQNAIPTGNWMYPVTKVTLPAGFDTLVKPQTTLSFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|262044895|ref|ZP_06017937.1| thiamin/thiamin pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
 gi|259037622|gb|EEW38851.1| thiamin/thiamin pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Klebsiella pneumoniae
           subsp. rhinoscleromatis ATCC 13884]
          Length = 327

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE +C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEAECGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A ++ LFAKSN+ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAAAQSKLFAKSNVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+   + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVEGPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHMIEEKKDNYAAASFAEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPGFQNAIPTGNWMYPVTQVTLPAGFDTLVKPQTTLSFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|167550707|ref|ZP_02344464.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205324423|gb|EDZ12262.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
          Length = 327

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/309 (59%), Positives = 241/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDYYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRLAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|332160271|ref|YP_004296848.1| thiamine transporter substrate binding subunit [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664501|gb|ADZ41145.1| thiamine transporter substrate binding subunit [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
          Length = 329

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 242/309 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GP IK+AFE +C+C+LK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 21  KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADV 80

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNL+  A +TGLF  S ++ S+L LP KW ++ FVPYDYGY AF+YDK ++  PP
Sbjct: 81  ILGLDNNLVQAAEQTGLFVSSQVNTSKLILPEKWQNNTFVPYDYGYFAFVYDKNKLKNPP 140

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL++S + WK+IYQDPRTST GLGL+LW+QK+YGD + Q W+++A KT TVTKGW+
Sbjct: 141 KSLQELVDSKEQWKVIYQDPRTSTPGLGLMLWMQKVYGDKAPQAWQQLAKKTVTVTKGWS 200

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE D VLSY+TSP ++L+   + +Y AA FSEGHYLQ+EVA  +  SKQP+L
Sbjct: 201 EAYGLFLKGEGDLVLSYTTSPAYHLIEEKKSNYAAADFSEGHYLQVEVAGVVASSKQPEL 260

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           AQ FMQFM++P+FQ  +PT NWMYPV+ + +P  +  + +PQK+L+F+A++    R +WI
Sbjct: 261 AQRFMQFMVTPAFQNHIPTGNWMYPVIKMDLPAGFDTLTVPQKALQFDAKDVADNRGKWI 320

Query: 329 SSWQNAVSR 337
            +WQ+AVSR
Sbjct: 321 QAWQSAVSR 329


>gi|152968648|ref|YP_001333757.1| thiamine transporter substrate binding subunit [Klebsiella
           pneumoniae subsp. pneumoniae MGH 78578]
 gi|150953497|gb|ABR75527.1| thiamin-binding periplasmic protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 327

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE +C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEAECGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A ++ LFAKSN+ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAAAQSKLFAKSNVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+   + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVEGPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHMIEEKKDNYAAANFAEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPGFQNAIPTGNWMYPVTKVTLPAGFDTLVKPQTTLSFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|206577161|ref|YP_002240466.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Klebsiella
           pneumoniae 342]
 gi|206566219|gb|ACI07995.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Klebsiella
           pneumoniae 342]
          Length = 327

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 240/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEADCGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL++ A ++ LFAKS++ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  IVLGLDNNLLEAAAQSKLFAKSHVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAASFAEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPGFQNAIPTGNWMYPVTQVALPAGFDTLVKPQTTLAFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|168234866|ref|ZP_02659924.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194737519|ref|YP_002113125.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|194713021|gb|ACF92242.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197291860|gb|EDY31210.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 327

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 181/309 (58%), Positives = 240/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           K VLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KSVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+  KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLTAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVASQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|288937166|ref|YP_003441225.1| thiamine ABC transporter periplasmic binding protein [Klebsiella
           variicola At-22]
 gi|288891875|gb|ADC60193.1| thiamine ABC transporter, periplasmic binding protein [Klebsiella
           variicola At-22]
          Length = 327

 Score =  415 bits (1066), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEADCGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL++ A ++ LFAKS++ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  IVLGLDNNLLEAAAQSKLFAKSHVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP 
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAASFAEGHYLQVEVAARTAASKQPA 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPGFQNAIPTGNWMYPVTQVALPAGFDTLVKPQTTLAFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|167013282|pdb|2QRY|A Chain A, Periplasmic Thiamin Binding Protein
 gi|167013283|pdb|2QRY|B Chain B, Periplasmic Thiamin Binding Protein
 gi|167013284|pdb|2QRY|C Chain C, Periplasmic Thiamin Binding Protein
 gi|167013285|pdb|2QRY|D Chain D, Periplasmic Thiamin Binding Protein
          Length = 330

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 185/313 (59%), Positives = 238/313 (76%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
           G   KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LR EG+NS
Sbjct: 18  GSHXKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRXEGKNS 77

Query: 85  AADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQI 144
            AD+VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++
Sbjct: 78  KADVVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKL 137

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVT 204
             PP++  EL+ S + W++IYQDPRTST GLGLLLW QK+YGD++ Q W+K+A KT TVT
Sbjct: 138 KNPPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWXQKVYGDDAPQAWQKLAKKTVTVT 197

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSK 264
           KGW+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SK
Sbjct: 198 KGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASK 257

Query: 265 QPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYR 324
           QP+LAQ+F+QF +SP+FQ  +PT NW YPV ++++P  ++ +  P  +L F   E    R
Sbjct: 258 QPELAQKFLQFXVSPAFQNAIPTGNWXYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQR 317

Query: 325 NQWISSWQNAVSR 337
             WIS WQ AVSR
Sbjct: 318 QAWISEWQRAVSR 330


>gi|322615928|gb|EFY12845.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322620713|gb|EFY17573.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623936|gb|EFY20773.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322627384|gb|EFY24175.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322630691|gb|EFY27455.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322638089|gb|EFY34790.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322640574|gb|EFY37225.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647714|gb|EFY44199.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322648063|gb|EFY44530.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322656903|gb|EFY53189.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322657386|gb|EFY53658.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322663706|gb|EFY59906.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322666539|gb|EFY62717.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322672302|gb|EFY68414.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322676386|gb|EFY72457.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322679521|gb|EFY75566.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322686150|gb|EFY82134.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|323194994|gb|EFZ80180.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323200097|gb|EFZ85184.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323201082|gb|EFZ86151.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323209479|gb|EFZ94412.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323212269|gb|EFZ97093.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323216574|gb|EGA01300.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323222487|gb|EGA06857.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323225798|gb|EGA10018.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323228661|gb|EGA12790.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323236725|gb|EGA20801.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323239774|gb|EGA23821.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323242178|gb|EGA26207.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323249397|gb|EGA33313.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323252268|gb|EGA36119.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323256641|gb|EGA40371.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323261325|gb|EGA44912.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323265495|gb|EGA48991.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323271717|gb|EGA55135.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
          Length = 327

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 181/309 (58%), Positives = 240/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           K VLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KSVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+  KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLTAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|146310279|ref|YP_001175353.1| thiamine transporter substrate binding subunit [Enterobacter sp.
           638]
 gi|145317155|gb|ABP59302.1| thiamine ABC transporter, periplasmic binding protein [Enterobacter
           sp. 638]
          Length = 327

 Score =  414 bits (1064), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG D NL+D A +T LFAKS + +  + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDKNLLDAASQTKLFAKSGVASEAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDHYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP+FQ  +PT NWMYPV ++++P  +  +  PQ +L F  ++ + +R  W
Sbjct: 258 LAEKFLKFMVSPAFQNAIPTGNWMYPVTNVTLPAGFDQLTKPQTTLEFTPQQVSSHRAAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|227327714|ref|ZP_03831738.1| thiamine transporter substrate binding subunit [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 338

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 236/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP IK AFE++C CEL  + L DG +LLN+LRMEG+NS AD
Sbjct: 29  AKPALTVYTYDSFASEWGPGPVIKTAFEKECECELNFVALEDGASLLNRLRMEGKNSKAD 88

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           I+LG DNNL+  A +TGLFA    D   + +P  W +  FVPYDYGY AF+Y+K  +  P
Sbjct: 89  IILGLDNNLLQAAEQTGLFAPHGQDTHAVTVPGGWSNKTFVPYDYGYFAFVYNKDTLKNP 148

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S  PWK+IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 149 PKSLHELVDSNAPWKVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 208

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA FSEGHYLQIE+A QL  SK P+
Sbjct: 209 SEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAATFSEGHYLQIEIAGQLASSKNPE 268

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQF++SP+FQ+ +PTTNWMYP V   +P  + A+ +P+K+++F+A+E    R QW
Sbjct: 269 LAKRFMQFILSPTFQQAIPTTNWMYPAVKTDLPAGFAALAVPEKAMQFSAQEVADQRTQW 328

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 329 IQAWQRAVSH 338


>gi|300715289|ref|YP_003740092.1| thiamine-binding periplasmic protein [Erwinia billingiae Eb661]
 gi|299061125|emb|CAX58232.1| Thiamine-binding periplasmic protein [Erwinia billingiae Eb661]
          Length = 328

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/328 (57%), Positives = 243/328 (74%), Gaps = 3/328 (0%)

Query: 13  MITGVISYCTLDGLPA---KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSD 69
           M+  V+    L   PA   KPVLTVYTY+SF AD G GP IK+AFE  C CELK + L D
Sbjct: 1   MLKKVLPLLILGTFPAFAAKPVLTVYTYDSFSADWGPGPAIKKAFEADCGCELKYVALED 60

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVP 129
           GV+LLN+LRMEG+NS AD+VLG DNNL+D A KTGLFA   +D S++ +P  W+D  FVP
Sbjct: 61  GVSLLNRLRMEGKNSKADVVLGLDNNLLDAAEKTGLFAPGQVDTSKVTVPGGWNDKTFVP 120

Query: 130 YDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS 189
           YDYG+ AF+YDK ++  PP +  EL+NS KP KIIY+DPRTST GLGLLLW+QK++GD +
Sbjct: 121 YDYGWFAFVYDKTKLQNPPTSLKELVNSDKPLKIIYEDPRTSTPGLGLLLWMQKVFGDKA 180

Query: 190 AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEG 249
            + W+K+A KT TVTKGW+E+YG FLKGE D VLSY+TSP ++L+   +  Y AA FSEG
Sbjct: 181 PEAWQKLAKKTVTVTKGWSEAYGLFLKGEGDMVLSYTTSPAYHLIEEKKSQYAAANFSEG 240

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIP 309
           HYLQ+EVA QL  SKQP+LAQ+FM+FM+   FQ  +PT NWMYPVV  ++P  +  + +P
Sbjct: 241 HYLQVEVAGQLKSSKQPELAQKFMKFMLDKPFQDSIPTGNWMYPVVKSTLPAGFDTLTVP 300

Query: 310 QKSLRFNAEETTRYRNQWISSWQNAVSR 337
             SL++ ++E    R+QWIS+WQ AVSR
Sbjct: 301 SNSLQYTSQEVASQRSQWISAWQRAVSR 328


>gi|238893043|ref|YP_002917777.1| thiamine transporter substrate binding subunit [Klebsiella
           pneumoniae NTUH-K2044]
 gi|238545359|dbj|BAH61710.1| thiamine transport system substrate-binding component [Klebsiella
           pneumoniae subsp. pneumoniae NTUH-K2044]
          Length = 327

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE +C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEAECGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A ++ LFAKSN+ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAAAQSKLFAKSNVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+   + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVEGPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDQAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHMIEEKKDNYAAANFAEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           L ++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LTEKFLKFMVSPGFQNAIPTGNWMYPVTQVTLPAGFDTLVKPQTTLSFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|290512587|ref|ZP_06551953.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophosphate-binding protein [Klebsiella sp. 1_1_55]
 gi|289774928|gb|EFD82930.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophosphate-binding protein [Klebsiella sp. 1_1_55]
          Length = 327

 Score =  413 bits (1062), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 181/310 (58%), Positives = 238/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEADCGCELKFVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL++ A ++ LFAKS++ AS + +P  WD+D FVPYDYGY AF+YDK ++  P
Sbjct: 78  IVLGLDNNLLEAAAQSKLFAKSHVPASAVSVPGGWDNDTFVPYDYGYFAFVYDKNKLANP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESPQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F EGHYLQ+EVAA+   SKQP 
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAASFVEGHYLQVEVAARTAASKQPA 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP FQ  +PT NWMYPV  +++P  +  +  PQ +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPGFQNAIPTGNWMYPVTQVALPAGFDTLVKPQTTLAFTPQQVASERQTW 317

Query: 328 ISSWQNAVSR 337
           IS+WQ AVSR
Sbjct: 318 ISAWQRAVSR 327


>gi|188532882|ref|YP_001906679.1| Thiamine-binding periplasmic protein [Erwinia tasmaniensis Et1/99]
 gi|188027924|emb|CAO95781.1| Thiamine-binding periplasmic protein [Erwinia tasmaniensis Et1/99]
          Length = 328

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 182/321 (56%), Positives = 244/321 (76%)

Query: 17  VISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNK 76
           +++  +L  L AK  LTVYTY+SF AD G GP +K+AFE  CNCELK + L DGV+LLN+
Sbjct: 8   LLALFSLPCLAAKETLTVYTYDSFAADWGPGPAVKKAFEAHCNCELKFVALEDGVSLLNR 67

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA 136
           LRMEG+NS AD+VLG DNNL+D A KTGLFA SN+D +   +P  W +  F+PYDYG+ A
Sbjct: 68  LRMEGKNSKADVVLGLDNNLLDAAEKTGLFAASNVDTAASTVPGGWHNSTFIPYDYGWFA 127

Query: 137 FIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKI 196
           F+YDK ++  PPK+  EL+ S +P K+IY+DPRTST GLGLLLW+QK++GDNS Q W+++
Sbjct: 128 FVYDKTKLPNPPKSLKELVESDRPLKVIYEDPRTSTPGLGLLLWMQKVFGDNSPQAWQQL 187

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
           + KT TVTKGW+E+YG FLKGESD VLSYS+SP ++L+   +D Y AA FSEGHYLQ+EV
Sbjct: 188 SKKTVTVTKGWSEAYGLFLKGESDMVLSYSSSPAYHLIEEKKDRYAAADFSEGHYLQVEV 247

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFN 316
           A +L  SK+PQLAQ+FMQF+++  FQ+ + T NWMYP +  ++PD +  + +P+ +L+F+
Sbjct: 248 AGRLKASKRPQLAQQFMQFILTQPFQQHMATGNWMYPAIKTTLPDGFATLTVPKTTLQFS 307

Query: 317 AEETTRYRNQWISSWQNAVSR 337
            ++  R R QWI  WQ AVSR
Sbjct: 308 PQDVARQRTQWIGEWQRAVSR 328


>gi|261338939|ref|ZP_05966797.1| hypothetical protein ENTCAN_05139 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318765|gb|EFC57703.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Enterobacter cancerogenus
           ATCC 35316]
          Length = 327

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/309 (57%), Positives = 239/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  C CELK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFSADWGPGPVVKKAFEADCGCELKFVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL+D A +T LFAKS + A  +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLDAATQTKLFAKSGVAAEAVKVPGGWKNDTFVPFDYGYFAFVYDKNKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD +   W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKAPDAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP +++++  +D+Y AA F+EGHYLQ+EVAA+   SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIISEKKDNYAAADFAEGHYLQVEVAARTAASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV+D+++P  +  +  PQ +L F  ++    R  W+
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVIDVTLPAGFDTLTKPQTALEFTPQQVAAERGTWV 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|283835131|ref|ZP_06354872.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Citrobacter youngae ATCC
           29220]
 gi|291069432|gb|EFE07541.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Citrobacter youngae ATCC
           29220]
          Length = 327

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 239/310 (77%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP IK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPTIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A +T LFAKS +    + +P  W +D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLEAATQTKLFAKSGVPGDAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++++  +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIDEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP+FQ  +PT NWMYPV  +++P  ++ +  P  +L F  ++    R  W
Sbjct: 258 LAEKFLKFMVSPAFQNAIPTGNWMYPVTQVALPSGFEQLNKPTTALEFTPQQVAAQRQTW 317

Query: 328 ISSWQNAVSR 337
           I+ WQ AVSR
Sbjct: 318 INEWQRAVSR 327


>gi|296101230|ref|YP_003611376.1| thiamine transporter substrate binding subunit [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|295055689|gb|ADF60427.1| thiamine transporter substrate binding subunit [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 327

 Score =  412 bits (1058), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/309 (57%), Positives = 239/309 (77%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFSADWGPGPVVKKAFEADCNCELKFVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL+D A +T LFAKS + A  + +P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLDAASQTKLFAKSGVAADAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKTPEAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVAA+   SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIAEKKDNYAAADFAEGHYLQVEVAARTAASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV ++++P  ++ +  PQ SL F  ++    R  W+
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVTNVTLPAGFEQLTKPQTSLEFTPQQVAAQRAAWV 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|271502066|ref|YP_003335092.1| thiamine ABC transporter periplasmic-binding protein [Dickeya
           dadantii Ech586]
 gi|270345621|gb|ACZ78386.1| thiamine ABC transporter, periplasmic binding protein [Dickeya
           dadantii Ech586]
          Length = 327

 Score =  411 bits (1057), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 176/310 (56%), Positives = 236/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP+LTVYTY+SF ++ G GP +K AFE++C+CELK + L DGVALLN+LRMEG N++AD
Sbjct: 18  AKPILTVYTYDSFASEWGPGPAVKTAFEKECDCELKFVALEDGVALLNRLRMEGNNTSAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A +TGLFA   ++ S L +P  W +  F+P+DYGY AF+Y+K ++  P
Sbjct: 78  VVLGLDNNLVQAAAQTGLFAPHGVNTSTLTVPGGWHNATFLPFDYGYFAFVYNKDKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S +PWK+IY+DPRTST GLGLLLW+QK+YGD + Q W+K+A KT TVTKGW
Sbjct: 138 PKSLHELVESDQPWKVIYEDPRTSTPGLGLLLWMQKVYGDKAPQAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++L+   +D Y AA FSEGHY+Q+EVAA L  SK PQ
Sbjct: 198 SEAYGLFLKGEADLVLSYTTSPAYHLIAEKKDSYAAANFSEGHYMQVEVAASLAGSKNPQ 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA  F+QFMISP+ Q+++PTTNWMYPV+   +P+ Y  + +P  +L F  ++    R  W
Sbjct: 258 LAARFLQFMISPTVQQLIPTTNWMYPVIKTELPEGYNTLTLPASALEFTPQQVVEQRANW 317

Query: 328 ISSWQNAVSR 337
           + +WQ AVSR
Sbjct: 318 VQAWQRAVSR 327


>gi|261823043|ref|YP_003261149.1| thiamine transporter substrate binding subunit [Pectobacterium
           wasabiae WPP163]
 gi|261607056|gb|ACX89542.1| thiamine ABC transporter, periplasmic binding protein
           [Pectobacterium wasabiae WPP163]
          Length = 338

 Score =  411 bits (1056), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/310 (57%), Positives = 235/310 (75%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP IK AFE++C CEL  + L DG +LLN+LRMEG+NS AD
Sbjct: 29  AKPALTVYTYDSFASEWGPGPVIKTAFEKECECELNFVALEDGASLLNRLRMEGKNSKAD 88

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           I+LG DNNL+  A +TGLF     D S + +P  W +  FVPYDYGY AF+Y+K  +  P
Sbjct: 89  IILGLDNNLLQAAEQTGLFTPHGQDTSTVTVPGGWSNKTFVPYDYGYFAFVYNKNTLKNP 148

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S  PWK+IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 149 PKSLHELLDSNAPWKVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 208

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA FSEGHYLQIE+A QL  SK P+
Sbjct: 209 SEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAATFSEGHYLQIEIAGQLASSKNPE 268

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FM+F++SP+FQ+ +PTTNWMYP V   +P  +  + +P+K+++F+A+E    R QW
Sbjct: 269 LAKRFMKFILSPTFQQAIPTTNWMYPAVTTELPAGFATLAVPEKAMQFSAQEVADQRTQW 328

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 329 IQAWQRAVSH 338


>gi|292489383|ref|YP_003532270.1| thiamine ABC transporter periplasmic protein [Erwinia amylovora
           CFBP1430]
 gi|292898398|ref|YP_003537767.1| thiamine ABC transporter substrate-binding protein [Erwinia
           amylovora ATCC 49946]
 gi|291198246|emb|CBJ45352.1| thiamine ABC transporter, substrate-binding protein [Erwinia
           amylovora ATCC 49946]
 gi|291554817|emb|CBA22665.1| Thiamine ABC transport system, periplasmic component [Erwinia
           amylovora CFBP1430]
          Length = 328

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/321 (56%), Positives = 244/321 (76%)

Query: 17  VISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNK 76
           +++  +L  L AK  LTVYTY+SF AD G GP +K+AFE +CNCELK + L DGV+LLN+
Sbjct: 8   LLALFSLPCLAAKDTLTVYTYDSFAADWGPGPAVKKAFEARCNCELKFVALEDGVSLLNR 67

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA 136
           LRMEG+NS AD+VLG DNNL+D A KTGLFA SN+D +   +P  W +  F+PYDYG+ A
Sbjct: 68  LRMEGKNSKADVVLGLDNNLLDAAEKTGLFAPSNVDTAASTVPGGWHNRTFIPYDYGWFA 127

Query: 137 FIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKI 196
           F+YDK ++  PPK+  EL+ S +P K+IY+DPRTST GLGLLLW+QK+YGDNS Q W+++
Sbjct: 128 FVYDKSKLPNPPKSLKELVESDRPLKVIYEDPRTSTPGLGLLLWMQKVYGDNSQQAWQQL 187

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
           + KT TVTKGW+E+YG FLKGESD VLSYS+SP ++L+   +D Y AA FSEGHYLQ+EV
Sbjct: 188 SKKTVTVTKGWSEAYGLFLKGESDMVLSYSSSPAYHLIEEKKDRYAAADFSEGHYLQVEV 247

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFN 316
             QL  S+QPQLAQ+FMQF++S  FQ+ + + NWMYP +   +P+ + A+ +P+ +L++ 
Sbjct: 248 VGQLKASQQPQLAQQFMQFVLSQPFQQHMASGNWMYPAMKTPLPEGFAALTVPKTTLQYG 307

Query: 317 AEETTRYRNQWISSWQNAVSR 337
            ++  R R+QWI  WQ AVSR
Sbjct: 308 PQDVARQRSQWIGEWQRAVSR 328


>gi|238918649|ref|YP_002932163.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein, [Edwardsiella ictaluri
           93-146]
 gi|238868217|gb|ACR67928.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein, putative [Edwardsiella
           ictaluri 93-146]
          Length = 331

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/327 (54%), Positives = 240/327 (73%)

Query: 11  IMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDG 70
           +  I  +++   L     KPVLTVYTY+SF AD G GPKIKQAFE+ C+CEL+L+ L DG
Sbjct: 5   LFSILALLTVSLLAQAAGKPVLTVYTYDSFAADWGPGPKIKQAFEQSCHCELRLVPLEDG 64

Query: 71  VALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPY 130
           VA+LN+LRMEG+NS AD+VLG DNNL+  AR +GLF+ S ID    ++P  W D  FVPY
Sbjct: 65  VAILNRLRMEGKNSPADLVLGLDNNLLTAARHSGLFSPSQIDTRGQQIPGGWHDATFVPY 124

Query: 131 DYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
           DYGY AF+YD++Q+  PP +  +L+   + W++IYQDPRTST GLGLLLW+QK+YGD + 
Sbjct: 125 DYGYFAFVYDRQQVKNPPSSLKQLVEGPEKWRVIYQDPRTSTPGLGLLLWMQKVYGDQAP 184

Query: 191 QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGH 250
             W+K+A KT TVTKGW+E+YG FLKGE+D VLSY+TSP ++++    D Y  A+F EGH
Sbjct: 185 AAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTSPAYHIIEEHNDRYATAMFDEGH 244

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ 310
           YLQ+EVA  L  S+QP LA +FMQF+ +P+FQ  +PT NWMYP   + +P  + A+  PQ
Sbjct: 245 YLQVEVAGILKHSRQPALAHQFMQFITTPAFQNAIPTGNWMYPATAVPLPPAFAALPRPQ 304

Query: 311 KSLRFNAEETTRYRNQWISSWQNAVSR 337
           K+L F A++  ++R +WI +WQ+A+SR
Sbjct: 305 KTLSFTADDVAQHRAEWIRAWQSALSR 331


>gi|237729365|ref|ZP_04559846.1| thiamine transporter substrate binding subunit [Citrobacter sp.
           30_2]
 gi|226909094|gb|EEH95012.1| thiamine transporter substrate binding subunit [Citrobacter sp.
           30_2]
          Length = 327

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 237/309 (76%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP IK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPTIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    + +P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANDAVNVPGGWKNDTFVPFDYGYFAFVYDKNKLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD + + W+K+A KT TVTKGW+
Sbjct: 139 KSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMQKVYGDKAPEAWQKLAAKTVTVTKGWS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+   SKQP+L
Sbjct: 199 EAYGLFLKGESDLVLSYTTSPAYHIIADKKDNYAAADFSEGHYLQVEVAARTAASKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A++F++FM+SP+FQ  +PT NWMYPV  +++P  ++ +  P  +L F  ++    R  WI
Sbjct: 259 AEKFLKFMVSPAFQNAIPTGNWMYPVTQVALPPGFEQLNKPATALEFTPQQVAAQRQAWI 318

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 319 SEWQRAVSR 327


>gi|161501870|ref|YP_051932.2| thiamine transporter substrate binding subunit [Pectobacterium
           atrosepticum SCRI1043]
          Length = 327

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 235/310 (75%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP IK AFE++C CEL  + L DG +LLN+LRMEG+NS AD
Sbjct: 18  AKPALTVYTYDSFASEWGPGPVIKTAFEKECECELNFVALEDGASLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           ++LG DNNL+  A +TGLF     D S + +P  W +  F+PYDYGY AF+Y+K  +  P
Sbjct: 78  VILGLDNNLLQAAEQTGLFTPHGQDTSTVTVPGGWSNKTFIPYDYGYFAFVYNKDTLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S  PWK+IYQDPRTST GLGLLLW+QK+YG+++ Q W+K+A KT TVTKGW
Sbjct: 138 PKSLHELVDSNAPWKVIYQDPRTSTPGLGLLLWMQKVYGNDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA FSEGHYLQIE+A QL  SK P+
Sbjct: 198 SEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAATFSEGHYLQIEIAGQLASSKNPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQF++SP+FQ+ +PTTNWMYP V   +P  +  + +P+K+++F+A+E    R QW
Sbjct: 258 LAKRFMQFILSPTFQQAIPTTNWMYPAVKTELPAGFATLAVPEKAMQFSAQEVADQRTQW 317

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 318 IQAWQRAVSH 327


>gi|49613291|emb|CAG76742.1| thiamine-binding periplasmic protein precursor [Pectobacterium
           atrosepticum SCRI1043]
          Length = 354

 Score =  409 bits (1051), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 235/310 (75%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP IK AFE++C CEL  + L DG +LLN+LRMEG+NS AD
Sbjct: 45  AKPALTVYTYDSFASEWGPGPVIKTAFEKECECELNFVALEDGASLLNRLRMEGKNSKAD 104

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           ++LG DNNL+  A +TGLF     D S + +P  W +  F+PYDYGY AF+Y+K  +  P
Sbjct: 105 VILGLDNNLLQAAEQTGLFTPHGQDTSTVTVPGGWSNKTFIPYDYGYFAFVYNKDTLKNP 164

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S  PWK+IYQDPRTST GLGLLLW+QK+YG+++ Q W+K+A KT TVTKGW
Sbjct: 165 PKSLHELVDSNAPWKVIYQDPRTSTPGLGLLLWMQKVYGNDAPQAWQKLAKKTVTVTKGW 224

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA FSEGHYLQIE+A QL  SK P+
Sbjct: 225 SEAYGLFLKGEADLVLSYTTSPAYHIIEEKKDNYAAATFSEGHYLQIEIAGQLASSKNPE 284

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ FMQF++SP+FQ+ +PTTNWMYP V   +P  +  + +P+K+++F+A+E    R QW
Sbjct: 285 LAKRFMQFILSPTFQQAIPTTNWMYPAVKTELPAGFATLAVPEKAMQFSAQEVADQRTQW 344

Query: 328 ISSWQNAVSR 337
           I +WQ AVS 
Sbjct: 345 IQAWQRAVSH 354


>gi|254037484|ref|ZP_04871561.1| thiamin/thiamin pyrophosphate ABC transporter [Escherichia sp.
           1_1_43]
 gi|226840590|gb|EEH72592.1| thiamin/thiamin pyrophosphate ABC transporter [Escherichia sp.
           1_1_43]
          Length = 327

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 190/310 (61%), Positives = 243/310 (78%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           ++LG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VLLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGDN+ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDNAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  W
Sbjct: 258 LAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAW 317

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 318 ISEWQRAVSR 327


>gi|312173548|emb|CBX81802.1| Thiamine ABC transport system, periplasmic component [Erwinia
           amylovora ATCC BAA-2158]
          Length = 328

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 244/321 (76%)

Query: 17  VISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNK 76
           +++  +L  L AK  LTVYTY+SF AD G GP +K+AFE +CNCELK + L DGV+LLN+
Sbjct: 8   LLALFSLPCLAAKDTLTVYTYDSFAADWGPGPAVKKAFEARCNCELKFVALEDGVSLLNR 67

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA 136
           LRMEG+NS AD+VLG DNNL+D A KTGLFA SN+D +   +P  W +  F+PYDYG+ A
Sbjct: 68  LRMEGKNSKADVVLGLDNNLLDAAEKTGLFAPSNVDMAASTVPGGWHNRTFIPYDYGWFA 127

Query: 137 FIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKI 196
           F+YDK ++  PPK+  EL+ S +P K+IY+DPRTST GLGLLLW+QK+YG+NS Q W+++
Sbjct: 128 FVYDKSKLPNPPKSLKELVESDRPLKVIYEDPRTSTPGLGLLLWMQKVYGENSQQAWQQL 187

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
           + KT TVTKGW+E+YG FLKGESD VLSYS+SP ++L+   +D Y AA FSEGHYLQ+EV
Sbjct: 188 SKKTVTVTKGWSEAYGLFLKGESDMVLSYSSSPAYHLIEEKKDRYAAADFSEGHYLQVEV 247

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFN 316
             QL  S+QPQLAQ+FMQF++S  FQ+ + + NWMYP +   +P+ + A+ +P+ +L++ 
Sbjct: 248 VGQLKASQQPQLAQQFMQFVLSQPFQQHMASGNWMYPAMKTPLPEGFAALTVPKTTLQYG 307

Query: 317 AEETTRYRNQWISSWQNAVSR 337
            ++  R R+QWI  WQ AVSR
Sbjct: 308 PQDVARQRSQWIGEWQRAVSR 328


>gi|242238075|ref|YP_002986256.1| thiamine transporter substrate binding subunit [Dickeya dadantii
           Ech703]
 gi|242130132|gb|ACS84434.1| thiamine ABC transporter, periplasmic binding protein [Dickeya
           dadantii Ech703]
          Length = 327

 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 176/310 (56%), Positives = 236/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP +K AFE+ C+CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPTLTVYTYDSFASEWGPGPGVKTAFEKTCDCELKFVALEDGVSLLNRLRMEGKNSPAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL+  A +TGLF+K  I    L +P  W +D F+P+DYGY AF+Y+K ++  P
Sbjct: 78  IVLGLDNNLLQAAEQTGLFSKHGISTDALAVPGGWKNDTFLPFDYGYFAFVYNKDKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +  EL+ S +PWK+IY+DPRTST GLGLLLW+QK+YGD + Q W+++A KT TVTKGW
Sbjct: 138 PTSLRELVESNQPWKVIYEDPRTSTPGLGLLLWMQKVYGDQTPQAWQQLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++++   +D+Y AA F+EGHYLQ+EVA +L  SK PQ
Sbjct: 198 SEAYGLFLKGEADLVLSYTTSPAYHIIAEKKDNYAAADFAEGHYLQVEVAGRLAGSKNPQ 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA+ F+QFM+SP+FQ+I+PTTNWMYP V   +P  Y ++ +P+ SL F  ++    R  W
Sbjct: 258 LAERFLQFMVSPAFQQIIPTTNWMYPAVKTELPAGYNSLMVPKTSLSFTPQQVAEQRASW 317

Query: 328 ISSWQNAVSR 337
           + +WQ AVSR
Sbjct: 318 VQAWQRAVSR 327


>gi|269137968|ref|YP_003294668.1| thiamin transporter substrate binding subunit [Edwardsiella tarda
           EIB202]
 gi|267983628|gb|ACY83457.1| thiamin transporter substrate binding subunit [Edwardsiella tarda
           EIB202]
 gi|304558016|gb|ADM40680.1| Thiamin ABC transporter, substrate-binding component [Edwardsiella
           tarda FL6-60]
          Length = 331

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 234/309 (75%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GPKIKQAFE+ C+CELKL+ L DGVA+LN+LRMEG+NS AD+
Sbjct: 23  KPVLTVYTYDSFAADWGPGPKIKQAFEQSCHCELKLVPLEDGVAILNRLRMEGKNSPADV 82

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL+  AR +GLF+ S  D   L++P  W D  FVPYDYGY AF+YD++++  PP
Sbjct: 83  VLGLDNNLLTAARHSGLFSPSQTDTRGLQIPGGWHDANFVPYDYGYFAFVYDRQRVNNPP 142

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            +  +L+   + W++IYQDPRTST GLGLLLW+QK+YGD +   W+K+A KT TVTKGW+
Sbjct: 143 TSLKQLVEGPEKWRVIYQDPRTSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWS 202

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE+D VLSY+TSP ++ +    D Y AA+F EGHYLQ+EVA  L  S QP L
Sbjct: 203 EAYGLFLKGEADMVLSYTTSPAYHQIEEHSDRYAAAMFDEGHYLQVEVAGVLKHSPQPAL 262

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A +FMQF+ +P+FQ  +PT NWMYP   +++P  + A+  PQK+L F A++  ++R +WI
Sbjct: 263 AHQFMQFITTPAFQNAIPTGNWMYPTTAVALPPAFAALPKPQKTLSFTADDVAQHRAEWI 322

Query: 329 SSWQNAVSR 337
            +WQ+A+SR
Sbjct: 323 RAWQSALSR 331


>gi|251788224|ref|YP_003002945.1| thiamine transporter substrate binding subunit [Dickeya zeae
           Ech1591]
 gi|247536845|gb|ACT05466.1| thiamine ABC transporter, periplasmic binding protein [Dickeya zeae
           Ech1591]
          Length = 327

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 236/310 (76%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKP LTVYTY+SF ++ G GP ++ AFE++C+CELK + L DGVALLN+LRMEG+N+ AD
Sbjct: 18  AKPTLTVYTYDSFASEWGPGPAVQTAFEKECDCELKFVALEDGVALLNRLRMEGKNTPAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A +TGLFA   ++ S L +P  W ++ F+P+DYGY AF+Y+K ++  P
Sbjct: 78  VVLGLDNNLVQAAAQTGLFAPHAVNTSTLTVPGGWRNETFLPFDYGYFAFVYNKDKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W +IY+DPRTST GLGLLLW+QK+YG+ + Q W+K+A KT TVTKGW
Sbjct: 138 PKSLHELVESDQRWTVIYEDPRTSTPGLGLLLWMQKVYGEKAPQAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE+D VLSY+TSP ++L+   +D+Y AA FSEGHYLQ+EVAAQL  SK PQ
Sbjct: 198 SEAYGLFLKGEADLVLSYTTSPAYHLIAEKKDNYAAANFSEGHYLQVEVAAQLAGSKNPQ 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA  F+QFM+SP+FQ+I+PTTNWMYPV+   +P  Y  + +P  +L F  ++    R  W
Sbjct: 258 LAARFLQFMVSPAFQQIIPTTNWMYPVIKTELPVGYNTLSLPATALEFTPQQVAEQRANW 317

Query: 328 ISSWQNAVSR 337
           + +WQ AVSR
Sbjct: 318 VQAWQRAVSR 327


>gi|156935413|ref|YP_001439329.1| thiamine transporter substrate binding subunit [Cronobacter
           sakazakii ATCC BAA-894]
 gi|156533667|gb|ABU78493.1| hypothetical protein ESA_03271 [Cronobacter sakazakii ATCC BAA-894]
          Length = 327

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 236/307 (76%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           VLTVYTY+SF ++ G GPKIK AFE  C CELK + L DGV+LLN+LRMEG+NS AD+VL
Sbjct: 21  VLTVYTYDSFSSEWGPGPKIKTAFEADCGCELKFVALEDGVSLLNRLRMEGKNSKADVVL 80

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DNNL+  A  TGLFAKS + A ++ +P  W++D FVP+DYG+ AF+YDK ++  PPK+
Sbjct: 81  GLDNNLLQAATATGLFAKSGVPAGEVNVPGGWNNDTFVPFDYGWFAFVYDKNKLKNPPKS 140

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+   W+K+A KT TVTKGW+E+
Sbjct: 141 LKELVESDQKWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPDAWQKLAAKTVTVTKGWSEA 200

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           YG FLKGE D VLSY+TSP ++++   +++Y AA FSEGHYLQ+EVAA+   SKQP LA+
Sbjct: 201 YGLFLKGEGDLVLSYTTSPAYHIIEEKKENYAAANFSEGHYLQVEVAARTAASKQPALAE 260

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           +F++FM+SP+FQ  +P  NWMYPV  +++P+ + A+  PQ +L+F ++E    R QW S 
Sbjct: 261 KFLKFMVSPAFQNAIPAGNWMYPVTSVALPEGFNALTRPQTTLQFTSQEVAAQRAQWTSE 320

Query: 331 WQNAVSR 337
           WQ AVSR
Sbjct: 321 WQRAVSR 327


>gi|310765103|gb|ADP10053.1| Thiamine-binding periplasmic protein [Erwinia sp. Ejp617]
          Length = 328

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 181/312 (58%), Positives = 236/312 (75%)

Query: 26  LPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
           L AK  LTVYTY+SF AD G GP +K+AFE +CNCELK + L DGV+LLN+LRMEG+NS 
Sbjct: 17  LAAKETLTVYTYDSFAADWGPGPAVKKAFEAQCNCELKFVALEDGVSLLNRLRMEGKNSK 76

Query: 86  ADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
           AD+VLG DNNL+D A KTGLFA SN+D +   +P  W +  FVPYDYG+ AF+YDK ++ 
Sbjct: 77  ADVVLGLDNNLLDAAEKTGLFAASNVDTAASTVPGGWHNSTFVPYDYGWFAFVYDKTKLP 136

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
            PPK+  EL+ S +P K+IY+DPRTST GLGLLLW+QK++GDNS   W++++ KT TVTK
Sbjct: 137 NPPKSLKELVESDRPLKVIYEDPRTSTPGLGLLLWMQKVFGDNSPLAWQQLSKKTVTVTK 196

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+E+YG FLKGESD VLSYS+S  ++L+   +D Y AA FSEGHYLQ+EVA QL  SKQ
Sbjct: 197 GWSEAYGLFLKGESDMVLSYSSSTAYHLIEEKKDRYAAADFSEGHYLQVEVAGQLKASKQ 256

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           PQLAQ+FMQF++S  FQ+ + T NWMYP     +PD +  + +P+ +L+++ ++  R R 
Sbjct: 257 PQLAQQFMQFVLSQPFQQHMATGNWMYPAAKTPLPDGFATLTVPKTTLQYSPQDVARQRT 316

Query: 326 QWISSWQNAVSR 337
           +WI  WQ AVSR
Sbjct: 317 RWIGEWQRAVSR 328


>gi|259907396|ref|YP_002647752.1| Thiamine-binding periplasmic protein [Erwinia pyrifoliae Ep1/96]
 gi|224963018|emb|CAX54501.1| Thiamine-binding periplasmic protein [Erwinia pyrifoliae Ep1/96]
 gi|283477229|emb|CAY73136.1| Thiamine ABC transport system, periplasmic component [Erwinia
           pyrifoliae DSM 12163]
          Length = 328

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 236/312 (75%)

Query: 26  LPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
           L AK  LT+YTY+SF AD G GP +K+AFE +CNCE+K + L DGV+LLN+LRMEG+NS 
Sbjct: 17  LAAKETLTIYTYDSFAADWGPGPAVKKAFEAQCNCEVKFVALEDGVSLLNRLRMEGKNSK 76

Query: 86  ADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
           AD+VLG DNNL+D A KTGLFA SN+D +   +P  W +  FVPYDYG+ AF+YDK  + 
Sbjct: 77  ADVVLGLDNNLLDAAEKTGLFAASNVDTAASTVPGGWHNSTFVPYDYGWFAFVYDKTTLP 136

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
            PPK+  EL+ S +P K+IY+DPRTST GLGLLLW+QK++G NS Q W++++ KT TVTK
Sbjct: 137 NPPKSLKELVESDRPLKVIYEDPRTSTPGLGLLLWMQKVFGANSPQAWQQLSKKTVTVTK 196

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+E+YG FLKGESD VLSYS+SP ++L+   +D Y AA FSEGHYLQ+EVA QL  SKQ
Sbjct: 197 GWSEAYGLFLKGESDMVLSYSSSPAYHLIEEKKDRYAAADFSEGHYLQVEVAGQLKASKQ 256

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           PQLAQ+FMQF++S  FQ+ + T NWMYP +   +PD +  + +P+ +L+++ ++    R 
Sbjct: 257 PQLAQQFMQFVLSQPFQQHMATGNWMYPAIKTPLPDGFATLTVPKTTLQYSPQDVACQRT 316

Query: 326 QWISSWQNAVSR 337
           +WI  WQ AVSR
Sbjct: 317 RWIGEWQRAVSR 328


>gi|311280951|ref|YP_003943182.1| thiamine ABC transporter, periplasmic binding protein [Enterobacter
           cloacae SCF1]
 gi|308750146|gb|ADO49898.1| thiamine ABC transporter, periplasmic binding protein [Enterobacter
           cloacae SCF1]
          Length = 327

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 176/310 (56%), Positives = 234/310 (75%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  C CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFSADWGPGPAVKKAFEADCGCELKYVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL+  A  TGLFAKS + +S + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  IVLGLDNNLLQAATDTGLFAKSGVPSSSVTVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD +   W+K+A KT TVTKGW
Sbjct: 138 PKSLKELVESEQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKAPDAWQKLAAKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F EGHYLQ+EVAA+   SKQP+
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFEEGHYLQVEVAARTAASKQPE 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA++F++FM+SP+FQ  +PT NWMYPV  +++PD +  +  P  +L +  ++    R  W
Sbjct: 258 LAEKFLKFMVSPAFQTAIPTGNWMYPVTQVALPDGFNGLVKPATTLEYTPQQVDHERQNW 317

Query: 328 ISSWQNAVSR 337
           IS+W  A S 
Sbjct: 318 ISAWLRAASH 327


>gi|283783856|ref|YP_003363721.1| thiamine ABC transport system, substrate-binding protein precursor
           [Citrobacter rodentium ICC168]
 gi|282947310|emb|CBG86855.1| thiamine ABC transport system, substrate-binding protein precursor
           [Citrobacter rodentium ICC168]
          Length = 314

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/310 (55%), Positives = 234/310 (75%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  C+CELK + L DGV+LLN+LRMEG+NS AD
Sbjct: 5   AKPVLTVYTYDSFAADWGPGPAVKKAFEADCDCELKYVALEDGVSLLNRLRMEGKNSKAD 64

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL++ A +TGLFAK+ I    + +P  W++D F+PYDYG+ AF+YDK ++  P
Sbjct: 65  VVLGLDNNLLEAATQTGLFAKTPIHTDAVNVPFNWNNDTFIPYDYGWFAFVYDKTKLKNP 124

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +  EL+ S + W++IY+DPRTST GLGL+LW++K+YGD + + W+K+A KT TVTKGW
Sbjct: 125 PSSLKELVESPQKWRVIYEDPRTSTPGLGLMLWMKKVYGDKAPEAWQKLAAKTVTVTKGW 184

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FLKGE D VLSY+TSP ++L+   ++ Y AA FSEGHY+Q+EVAA+ V SKQP+
Sbjct: 185 SEAYGLFLKGEGDLVLSYTTSPAYHLIEEKKEQYAAANFSEGHYVQVEVAARTVASKQPE 244

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA  F++F++ P+FQ+ +PT NWMYPV    +P  ++ +  P  +L+F + E    R  W
Sbjct: 245 LASRFLRFILKPAFQKTIPTGNWMYPVTATPLPAGFEQLTKPTTTLQFTSAEVAAQRQAW 304

Query: 328 ISSWQNAVSR 337
           IS WQ AVSR
Sbjct: 305 ISEWQRAVSR 314


>gi|260596492|ref|YP_003209063.1| thiamine transporter substrate binding subunit [Cronobacter
           turicensis z3032]
 gi|260215669|emb|CBA27983.1| Thiamine-binding periplasmic protein [Cronobacter turicensis z3032]
          Length = 306

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 235/306 (76%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +TVYTY+SF ++ G GPKIK AFE  C CELK + L DGV+LLN+LRMEG+NS AD+VLG
Sbjct: 1   MTVYTYDSFSSEWGPGPKIKTAFEADCGCELKFVALEDGVSLLNRLRMEGKNSKADVVLG 60

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNF 151
            DNNL+  A  TGLFAKS + A+ + +P  W++D FVP+DYG+ AF+YDK ++  PPK+ 
Sbjct: 61  LDNNLLQAATATGLFAKSGVPANDVNVPGGWNNDTFVPFDYGWFAFVYDKTKLKNPPKSL 120

Query: 152 DELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY 211
            EL+ S + W++IY+DPRTST GLGLLLW+QK+YGD +   W+K+A KT TVTKGW+E+Y
Sbjct: 121 KELVESDQKWRVIYEDPRTSTPGLGLLLWMQKVYGDKAPDAWQKLAAKTVTVTKGWSEAY 180

Query: 212 GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQE 271
           G FLKGE D VLSY+TSP ++++   +++Y AA FSEGHYLQ+EVAA+   SKQP LA++
Sbjct: 181 GLFLKGEGDLVLSYTTSPAYHIIEEKKENYAAANFSEGHYLQVEVAARTAASKQPALAEK 240

Query: 272 FMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           F++FM+SP+FQ  +P  NWMYPV ++++P+ + A+  PQ +L+F +++    R QW S W
Sbjct: 241 FLKFMVSPAFQNAIPAGNWMYPVTNVALPEGFNALTRPQTTLQFTSQDVATQRAQWTSEW 300

Query: 332 QNAVSR 337
           Q AVSR
Sbjct: 301 QRAVSR 306


>gi|294634985|ref|ZP_06713502.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Edwardsiella tarda ATCC
           23685]
 gi|291091584|gb|EFE24145.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Edwardsiella tarda ATCC
           23685]
          Length = 331

 Score =  397 bits (1021), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 173/309 (55%), Positives = 229/309 (74%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GPKIKQAFE+ C CELKL+ L+DGVA+LN+LRMEG+ S AD+
Sbjct: 23  KPVLTVYTYDSFAADWGPGPKIKQAFEQSCQCELKLVPLADGVAILNRLRMEGKKSPADV 82

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
            LG DNNL+  A+++GLF  S +D   L +P  W D  FVPYDYGY AF+YD++++  PP
Sbjct: 83  ALGLDNNLLTSAQQSGLFVPSQVDTRALTVPGGWHDTTFVPYDYGYFAFVYDRQKVKTPP 142

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            +  +L+   + W++IYQDPRTST GLGLLLW+QK+YGD +   W+K+A KT TVTKGW+
Sbjct: 143 TSLKQLVEGPEKWRVIYQDPRTSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWS 202

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE+D VLSY+TSP ++++    D Y AA F+EG+YLQ+EVA  L  S QP L
Sbjct: 203 EAYGLFLKGEADMVLSYTTSPAYHIIEEHTDRYAAAPFAEGNYLQVEVAGMLKHSAQPAL 262

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A +FMQF+ +P+FQ  +PT NWMYPV  + +P  +  +  PQ +L F   E  ++R +WI
Sbjct: 263 AHQFMQFITTPAFQEAIPTGNWMYPVTAVPLPPAFADLPKPQTALSFTPAEVAQHRAEWI 322

Query: 329 SSWQNAVSR 337
            +WQNA+SR
Sbjct: 323 RAWQNALSR 331


>gi|320540420|ref|ZP_08040070.1| putative thiamin transporter subunit [Serratia symbiotica str.
           Tucson]
 gi|320029351|gb|EFW11380.1| putative thiamin transporter subunit [Serratia symbiotica str.
           Tucson]
          Length = 331

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/309 (54%), Positives = 235/309 (76%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GP +K+AFE  C CEL+ + L+DGV+LLN+LRM+G++SAAD+
Sbjct: 23  KPTLTVYTYDSFAADWGPGPAVKKAFEADCGCELQFVTLADGVSLLNRLRMDGKSSAADV 82

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL+  A++T LFA S++D S+L +P  W D  FVPYDYGY AF+Y+K ++  PP
Sbjct: 83  VLGLDNNLLQAAQQTDLFAPSDVDTSKLTVPGGWQDKTFVPYDYGYFAFVYNKDKLKNPP 142

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL++  + W++IY+DPRTST GLGLLLW+QK+YG+ + + W+++A KT TVTKGW+
Sbjct: 143 KSLQELVSRDQHWRVIYEDPRTSTPGLGLLLWMQKVYGEKAPEAWQQLAKKTVTVTKGWS 202

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGE+D VLSY+ SP ++L+   +D Y AA FSEGHYLQ+EVA +L  SKQP L
Sbjct: 203 EAYGLFLKGEADLVLSYTISPAYHLIKEKKDSYAAAQFSEGHYLQVEVAGKLKASKQPAL 262

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A+ FMQFM++P+FQ  +P  NWMYPV+D  +P  ++ +   Q +L++  +E  ++R  W+
Sbjct: 263 AKRFMQFMVTPAFQSSIPLGNWMYPVIDTPLPIGFEQMTTVQTTLQYRTDEVAKHRGNWV 322

Query: 329 SSWQNAVSR 337
            +WQ AVS 
Sbjct: 323 RAWQTAVSH 331


>gi|205351447|ref|YP_002225248.1| thiamine-binding periplasmic protein [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205271228|emb|CAR36016.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
          Length = 288

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 168/288 (58%), Positives = 225/288 (78%)

Query: 50  IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKS 109
           +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+VLG DNNL++ A +T LFAKS
Sbjct: 1   MKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKS 60

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
            +    +K+P  W +D FVP+DYGY AF+YDK ++  PPK+  EL+ S + W++IYQDPR
Sbjct: 61  GVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPR 120

Query: 170 TSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSP 229
           TST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+E+YG FLKGESD VLSY+TSP
Sbjct: 121 TSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSP 180

Query: 230 GFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTN 289
            ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+LA++F++FM+SP+FQ  +PT N
Sbjct: 181 AYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGN 240

Query: 290 WMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           WMYPV D+S+P  ++++  P  +L F  ++    R  WIS WQ AVSR
Sbjct: 241 WMYPVADVSLPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR 288


>gi|85058411|ref|YP_454113.1| thiamine transporter substrate binding subunit [Sodalis
           glossinidius str. 'morsitans']
 gi|84778931|dbj|BAE73708.1| thiamine ABC transporter periplasmic component [Sodalis
           glossinidius str. 'morsitans']
          Length = 324

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 174/309 (56%), Positives = 228/309 (73%), Gaps = 2/309 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP+LTVYTY+SF ++ G GP IK AFE++C CELK + L DGVALLN+LR+EG+NS ADI
Sbjct: 18  KPILTVYTYDSFSSEWGPGPAIKTAFEKECGCELKFVALEDGVALLNRLRLEGKNSRADI 77

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNLI  AR TGLFA   +    L LP  W +D+F+PY+YGY AF+YD+ ++  PP
Sbjct: 78  VLGLDNNLIQAARDTGLFAPHAVATKALTLPGSWHNDLFLPYNYGYFAFVYDQTKLKNPP 137

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           ++  EL++     KIIY+DPRTST GLGLLLW+QK+YGD +   W+K+A KT TVTKGW+
Sbjct: 138 RSLHELVDDPASLKIIYEDPRTSTPGLGLLLWVQKVYGDAAPAAWEKLAAKTVTVTKGWS 197

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++++   ++ Y AA FSEGHY Q+EVA QL  SKQ  L
Sbjct: 198 EAYGLFLKGESDMVLSYTTSPAYHIIEEKKNQYAAAAFSEGHYQQVEVAGQLAASKQQAL 257

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A  FMQF+++P+FQ+ +PT NWMYPV+D ++P  +     PQ++L F  ++    R  W+
Sbjct: 258 AHRFMQFILTPAFQQAIPTGNWMYPVIDTALPAGF--TPPPQQTLSFTPQQVAAGRAGWV 315

Query: 329 SSWQNAVSR 337
           S WQ AVSR
Sbjct: 316 SGWQQAVSR 324


>gi|197361316|ref|YP_002140951.1| thiamine-binding periplasmic protein [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|207855620|ref|YP_002242271.1| thiamine-binding periplasmic protein [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213579958|ref|ZP_03361784.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|197092791|emb|CAR58217.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|206707423|emb|CAR31696.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
          Length = 288

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 167/288 (57%), Positives = 225/288 (78%)

Query: 50  IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKS 109
           +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+VLG DNNL++ A +T LFAKS
Sbjct: 1   MKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKS 60

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
            +    +K+P  W +D FVP+DYGY AF+YDK ++  PPK+  EL+ S + W++IYQDPR
Sbjct: 61  GVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPR 120

Query: 170 TSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSP 229
           TST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+E+YG FLKGESD VLSY+TSP
Sbjct: 121 TSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSP 180

Query: 230 GFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTN 289
            ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+LA++F++FM+SP+FQ  +PT N
Sbjct: 181 AYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGN 240

Query: 290 WMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           WMYPV D+++P  ++++  P  +L F  ++    R  WIS WQ AVSR
Sbjct: 241 WMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISEWQRAVSR 288


>gi|156973109|ref|YP_001444016.1| thiamine transporter substrate binding subunit [Vibrio harveyi ATCC
           BAA-1116]
 gi|156524703|gb|ABU69789.1| hypothetical protein VIBHAR_00788 [Vibrio harveyi ATCC BAA-1116]
          Length = 330

 Score =  388 bits (996), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 170/331 (51%), Positives = 235/331 (70%), Gaps = 3/331 (0%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           +  + ++ +T + S        A+  LTVYTY+SF AD G GPK+++AFE KC C++  +
Sbjct: 2   KTTLSLIALTAITSTS---AFAAENTLTVYTYDSFAADWGPGPKVEKAFEAKCGCDVNFV 58

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDD 125
            L DGV++LN+LR+EG NS ADIVLG DNNL+  A+KTGL A+ N+D S+  LP  WDD 
Sbjct: 59  ALDDGVSILNRLRLEGSNSKADIVLGLDNNLMAEAKKTGLLAEHNVDTSRTTLPNGWDDK 118

Query: 126 IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY 185
            FVPYDYGY AF+Y+K ++  PPK+  EL+      K+IYQDPRTST G GL+LW++ IY
Sbjct: 119 TFVPYDYGYFAFVYNKEKLANPPKSMKELVEERDDLKVIYQDPRTSTPGQGLMLWMKSIY 178

Query: 186 GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAAL 245
           GD++ Q WK++ATKT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+  G   Y +A 
Sbjct: 179 GDDATQAWKQLATKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAEGDAKYASAD 238

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQA 305
           F+EGHY+Q+EVAA++  SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ 
Sbjct: 239 FAEGHYMQVEVAAKVKGSKNAELADEFMNFILSDDFQSAMPTGNWMYPVTDVELPKGFET 298

Query: 306 IRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           + +P K L F+A+E  + R  WI  WQ+A++
Sbjct: 299 LSVPSKPLSFSADEVAKMRKTWIREWQSALT 329


>gi|153834390|ref|ZP_01987057.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio harveyi HY01]
 gi|148869238|gb|EDL68260.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio harveyi HY01]
          Length = 330

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 168/325 (51%), Positives = 232/325 (71%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           + +  + +  +     A+  LTVYTY+SF AD G GPK+++AFE KC C++  + L DGV
Sbjct: 5   LSLIALAAITSTSAFAAENTLTVYTYDSFAADWGPGPKVEKAFEAKCGCDVNFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS ADIVLG DNNL+  A+KTGL A+ N+D S+  LP  WDD  FVPYD
Sbjct: 65  SILNRLRLEGNNSKADIVLGLDNNLMAEAKKTGLLAEHNVDTSKTTLPNGWDDKTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PPK+  EL+      K+IYQDPRTST G GL+LW++ IYGD++ Q
Sbjct: 125 YGYFAFVYNKEKLANPPKSMKELVEERDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDATQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++ATKT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+  G   Y +A F+EGHY
Sbjct: 185 AWKQLATKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAEGDAKYASADFTEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           +Q+EVAA++  SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P K
Sbjct: 245 MQVEVAAKVKGSKNAELADEFMDFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSK 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
            L F+A+E  + R  WI  WQ+A++
Sbjct: 305 PLSFSADEVAKMRKTWIREWQSALT 329


>gi|269960903|ref|ZP_06175273.1| Thiamine-binding periplasmic protein [Vibrio harveyi 1DA3]
 gi|269834343|gb|EEZ88432.1| Thiamine-binding periplasmic protein [Vibrio harveyi 1DA3]
          Length = 330

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 167/325 (51%), Positives = 230/325 (70%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           + +  + +  +     A+  LTVYTY+SF AD G GPK+++AFE KC C++  + L DGV
Sbjct: 5   LSLIALATITSTSAFAAENTLTVYTYDSFAADWGPGPKVEKAFEAKCGCDVNFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS ADIVLG DNNL+  A+KTGL A+ N+D S+  LP  WDD  FVPYD
Sbjct: 65  SILNRLRLEGSNSKADIVLGLDNNLMAEAKKTGLLAEHNVDTSKTTLPNGWDDKTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PPK+  EL+      K+IYQDPRTST G GL+LW++ IYGD++ Q
Sbjct: 125 YGYFAFVYNKEKLANPPKSMKELVEERDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDATQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++ATKT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      Y +A F+EGHY
Sbjct: 185 AWKQLATKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAEDDAKYASADFAEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           +Q+EVAA++  SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P K
Sbjct: 245 MQVEVAAKVKGSKNAELADEFMNFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSK 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
            L F+A E  + R  WI  WQ+A++
Sbjct: 305 PLSFSAGEVAKMRKTWIREWQSALT 329


>gi|163802647|ref|ZP_02196538.1| thiamin transporter substrate binding subunit [Vibrio sp. AND4]
 gi|159173535|gb|EDP58355.1| thiamin transporter substrate binding subunit [Vibrio sp. AND4]
          Length = 330

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 169/331 (51%), Positives = 233/331 (70%), Gaps = 3/331 (0%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           +  + ++ + G+ S        A+  LTVYTY+SF AD G GPKI++AFE KC C++  +
Sbjct: 2   KTTLSLIALAGITSTS---AFAAENTLTVYTYDSFAADWGPGPKIEKAFEAKCGCDVNFV 58

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDD 125
            L DGV++LN+LR+EG NS ADIVLG DNNL+  A+KTGL A+ N+D SQ  LP  W D 
Sbjct: 59  ALDDGVSILNRLRLEGNNSKADIVLGLDNNLMAEAKKTGLLAEHNVDTSQTTLPNGWQDK 118

Query: 126 IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY 185
            FVPYD+GY AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST GLGL+LW++ IY
Sbjct: 119 TFVPYDFGYFAFVYNKDKLANPPKSMKELVEARDDLKVIYQDPRTSTPGLGLMLWMKSIY 178

Query: 186 GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAAL 245
           GDN+ Q WK++A KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      Y +A 
Sbjct: 179 GDNATQAWKQLAEKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAEDDAKYASAA 238

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQA 305
           FSEGHY+Q+EVAA++  SK P+L  EFM F++S  FQ  +PT NWMYPV +  +P  ++ 
Sbjct: 239 FSEGHYMQVEVAAKVKGSKNPKLVDEFMNFILSDDFQAAIPTGNWMYPVTNAELPKGFET 298

Query: 306 IRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           + +P K L F+A++  + R  WI  WQ+A++
Sbjct: 299 LNVPSKPLSFSADDVAKMRKSWIREWQSALT 329


>gi|238897817|ref|YP_002923496.1| thiamin transporter subunit [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465574|gb|ACQ67348.1| thiamin transporter subunit [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 349

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 170/314 (54%), Positives = 230/314 (73%)

Query: 23  LDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGE 82
           ++  P K VL +YTY+SF+AD GAGP IK++FE+ C+C+LK +   DGV+LLN+LRM   
Sbjct: 35  IEAQPKKTVLVIYTYDSFIADWGAGPGIKKSFEKNCDCQLKWVSFKDGVSLLNRLRMGNT 94

Query: 83  NSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKR 142
           N +ADIVLG DNNL+  A KTGLF +S ID S++ LP  W+  IF+PYD+GY +F+Y+K 
Sbjct: 95  NHSADIVLGLDNNLLISAEKTGLFVESKIDTSRMHLPKNWESKIFIPYDFGYFSFVYNKN 154

Query: 143 QITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTAT 202
           ++  PPK+  EL+NS K WK+IYQDPRTST GLGLLL+IQK+YG  + ++W K+A KT T
Sbjct: 155 KLKDPPKSLYELLNSNKTWKLIYQDPRTSTPGLGLLLFIQKVYGAEAPKIWTKLAAKTVT 214

Query: 203 VTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVR 262
           VTK W E+YG FLKGESDFV SY+TSP ++++      Y A  FSEGHYLQIE  AQL  
Sbjct: 215 VTKSWGEAYGLFLKGESDFVWSYTTSPAYHIIEEKNHQYAAMNFSEGHYLQIETVAQLAA 274

Query: 263 SKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTR 322
           S+ P+LAQ FM+F+++  FQ+ + T NWMYPV+ I++P  +  +  PQK L ++++E   
Sbjct: 275 SQNPKLAQRFMEFVLTSEFQKHIATGNWMYPVIKITLPKGFDELIQPQKVLHYSSKEAAE 334

Query: 323 YRNQWISSWQNAVS 336
            RN+WI+ WQ  VS
Sbjct: 335 NRNKWINLWQTTVS 348


>gi|260770968|ref|ZP_05879897.1| thiamin ABC transporter substrate-binding component [Vibrio
           furnissii CIP 102972]
 gi|260614205|gb|EEX39395.1| thiamin ABC transporter substrate-binding component [Vibrio
           furnissii CIP 102972]
          Length = 329

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/309 (52%), Positives = 226/309 (73%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A P LTVYTY+SF AD G GP +++AFE +C C+L+ + L DGV++LN+LR+EG+ + AD
Sbjct: 20  AAPSLTVYTYDSFAADWGPGPAVEKAFEAQCGCDLQFVALDDGVSILNRLRLEGKKTKAD 79

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A++TGL A+ N D   + LP  W DD FVPYDYGY AF+Y+K+++T P
Sbjct: 80  VVLGLDNNLMVEAKQTGLLAQHNTDTHAVHLPNGWSDDTFVPYDYGYFAFVYNKQKLTNP 139

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +  EL+      +IIYQDPRTST G GLLLW++ +YGD++ Q W+K+A KT TVTKGW
Sbjct: 140 PTSLKELVEQRDDLRIIYQDPRTSTPGQGLLLWMKSVYGDDATQAWQKLANKTVTVTKGW 199

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+Y  FL GESD VLSY+TSP ++L+    D Y  A F+EGHY+Q+EVAA++  +   +
Sbjct: 200 SEAYSMFLDGESDMVLSYTTSPAYHLIAEHDDKYATANFAEGHYMQVEVAAKVQGTPNDK 259

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA EF+QFM+S  FQ ++PT NWMYPV D+++P  ++ + +P KSL F+A+E    R  W
Sbjct: 260 LADEFLQFMLSNEFQALMPTGNWMYPVTDVALPKGFETLSVPAKSLSFSADEVAAKRRGW 319

Query: 328 ISSWQNAVS 336
           I  WQNA++
Sbjct: 320 IREWQNALT 328


>gi|260900701|ref|ZP_05909096.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           AQ4037]
 gi|308110262|gb|EFO47802.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           AQ4037]
          Length = 330

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 227/323 (70%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV++
Sbjct: 7   LIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGVSI 66

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EG NS ADIVLG DNNL+  A+KTGL  + N+D +   LP  W D  FVPYDYG
Sbjct: 67  LNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLTEHNVDTANTVLPDGWSDTTFVPYDYG 126

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST G GL+LW++ IYGD+  Q W
Sbjct: 127 YFAFVYNKEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQAW 186

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           +K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY+Q
Sbjct: 187 QKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHYMQ 246

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  SK  +LA +FM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P KSL
Sbjct: 247 VEVAAKVKGSKNSELADQFMNFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSKSL 306

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F+A+E  + R  WI  WQ+A++
Sbjct: 307 SFSADEVAKMRKSWIREWQSALT 329


>gi|260775613|ref|ZP_05884510.1| thiamin ABC transporter substrate-binding component [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608794|gb|EEX34959.1| thiamin ABC transporter substrate-binding component [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 330

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 162/321 (50%), Positives = 231/321 (71%)

Query: 16  GVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
            V +  +   L A   LTVYTY+SF AD G GPK+++AFE +C C++  + L DGV++LN
Sbjct: 9   AVATLTSFSALAADNTLTVYTYDSFAADWGPGPKVEKAFEAQCGCDVNFVALDDGVSILN 68

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYL 135
           +LR+EG+NS ADIVLG DNNL+  A+KTGL A+  +D   + LP  W+D  FVPYD+GY 
Sbjct: 69  RLRLEGDNSKADIVLGLDNNLMAEAQKTGLLAEHKVDTKSVNLPNGWEDSTFVPYDFGYF 128

Query: 136 AFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK 195
           AF+Y+K ++T PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YGD+    W++
Sbjct: 129 AFVYNKEKLTNPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYGDDVTPAWQQ 188

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
           +A KT TVTKGW+E+Y  FL+GESD VLSY+TSP ++L+      Y AA F+EGHY Q+E
Sbjct: 189 LAKKTVTVTKGWSEAYSMFLEGESDMVLSYTTSPAYHLIAESDSKYAAADFTEGHYTQVE 248

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF 315
           VAA++  SK  +LA EFM F++S  FQ ++PT NWMYPV ++++P+ ++ + +P+K+L F
Sbjct: 249 VAAKVKASKNEKLADEFMTFILSDDFQSLMPTGNWMYPVTEVALPEGFETLTVPEKALSF 308

Query: 316 NAEETTRYRNQWISSWQNAVS 336
           +A E  + R  WI  WQ+A++
Sbjct: 309 SAAEVAQNRKSWIREWQSALT 329


>gi|153837929|ref|ZP_01990596.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio parahaemolyticus
           AQ3810]
 gi|149748707|gb|EDM59558.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio parahaemolyticus
           AQ3810]
          Length = 330

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 227/323 (70%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV++
Sbjct: 7   LIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGVSI 66

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EG NS ADIVLG DNNL+  A+KTGL  + N+D +   LP  W D  FVPYDYG
Sbjct: 67  LNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLTEHNVDTANTVLPNGWSDTTFVPYDYG 126

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST G  L+LW++ IYGD+  Q W
Sbjct: 127 YFAFVYNKEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQSLMLWMKSIYGDDVTQAW 186

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           +K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A FSEGHY+Q
Sbjct: 187 QKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFSEGHYMQ 246

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  SK  +LA +FM F++S  FQ  +PT NWMYPV+D+ +P  ++ + +P KSL
Sbjct: 247 VEVAAKVKGSKNSELADKFMNFILSDEFQSAMPTGNWMYPVIDVELPKGFETLSVPSKSL 306

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F+A+E  + R  WI  WQ+A++
Sbjct: 307 SFSADEVAKMRKSWIREWQSALT 329


>gi|269964683|ref|ZP_06178921.1| Thiamine-binding periplasmic protein [Vibrio alginolyticus 40B]
 gi|269830582|gb|EEZ84803.1| Thiamine-binding periplasmic protein [Vibrio alginolyticus 40B]
          Length = 330

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 227/323 (70%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV++
Sbjct: 7   LIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGVSI 66

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EG NS ADIVLG DNNL+  A+KTGL A+ N+D +   LP  W D  FVPYDYG
Sbjct: 67  LNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLAEHNVDTANTVLPNGWSDTTFVPYDYG 126

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+K ++  PPK+  EL+      K+IYQDPRTST G GL+LW++ IYGD+  Q W
Sbjct: 127 YFAFVYNKEKLVNPPKSMKELVEMRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQAW 186

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           +K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY+Q
Sbjct: 187 QKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHYMQ 246

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  +K  +LA +FM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P KSL
Sbjct: 247 VEVAAKVKGAKNSELADQFMSFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSKSL 306

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F+A+E  + R  WI  WQ+A++
Sbjct: 307 SFSADEVAKMRKSWIREWQSALT 329


>gi|315179014|gb|ADT85928.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio furnissii NCTC 11218]
          Length = 329

 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 225/309 (72%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A P LTVYTY+SF AD G GP +++AFE +C C+L+ + L DGV++LN+LR+EG+ + AD
Sbjct: 20  AAPTLTVYTYDSFAADWGPGPAVEKAFEAQCGCDLQFVALDDGVSILNRLRLEGKKTKAD 79

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+  A++TGL A+ N D   + LP  W DD FVPYDYGY AF+Y+K+++T P
Sbjct: 80  VVLGLDNNLMVEAKQTGLLAQHNTDTHAVHLPNGWSDDTFVPYDYGYFAFVYNKQKLTNP 139

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +   L+      +IIYQDPRTST G GLLLW++ +YGD++ Q W+K+A KT TVTKGW
Sbjct: 140 PTSLKALVEQRDDLRIIYQDPRTSTPGQGLLLWMKSVYGDDATQAWQKLANKTVTVTKGW 199

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+Y  FL GESD VLSY+TSP ++L+    D Y  A F+EGHY+Q+EVAA++  +   +
Sbjct: 200 SEAYSMFLDGESDMVLSYTTSPAYHLIAEHDDKYATANFAEGHYMQVEVAAKVQGTPNDK 259

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA EF+QFM+S  FQ ++PT NWMYPV D+++P  ++ + +P KSL F+A+E    R  W
Sbjct: 260 LADEFLQFMLSNEFQALMPTGNWMYPVTDVALPKGFETLSVPAKSLSFSAKEVAAKRRGW 319

Query: 328 ISSWQNAVS 336
           I  WQNA++
Sbjct: 320 IREWQNALT 328


>gi|28897090|ref|NP_796695.1| thiamine transporter substrate binding subunit [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|260363961|ref|ZP_05776700.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           K5030]
 gi|260896372|ref|ZP_05904868.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           Peru-466]
 gi|28805299|dbj|BAC58579.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio parahaemolyticus RIMD 2210633]
 gi|308085179|gb|EFO34874.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308112593|gb|EFO50133.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           K5030]
          Length = 330

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 228/325 (70%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           + +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV
Sbjct: 5   LNLIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS ADIVLG DNNL+  A+KTGL  + N+D +   LP  W D  FVPYD
Sbjct: 65  SILNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLTEHNVDTANTVLPNGWSDTTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST G GL+LW++ IYGD+  Q
Sbjct: 125 YGYFAFVYNKEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            W+K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY
Sbjct: 185 AWQKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           +Q+EVAA++  SK  +LA +F+ F++S  FQ  +PT NWMYPV D+ +P  ++ + +P K
Sbjct: 245 MQVEVAAKVKGSKNSELADKFINFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSK 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ+A++
Sbjct: 305 SLSFSADEVAKMRKSWIREWQSALT 329


>gi|91228832|ref|ZP_01262738.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio alginolyticus 12G01]
 gi|91187603|gb|EAS73929.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio alginolyticus 12G01]
          Length = 330

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 227/323 (70%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV++
Sbjct: 7   LIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGVSI 66

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EG NS ADIVLG DNNL+  A+KT L A+ N+D +   LP  W D  FVPYDYG
Sbjct: 67  LNRLRLEGGNSKADIVLGLDNNLMAEAKKTDLLAEHNVDTANTVLPNGWSDTTFVPYDYG 126

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST G GL+LW++ IYGD+  Q W
Sbjct: 127 YFAFVYNKEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQAW 186

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           +K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY+Q
Sbjct: 187 QKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHYMQ 246

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  +K  +LA +FM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P KSL
Sbjct: 247 VEVAAKVKGAKNSELADQFMSFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSKSL 306

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F+A+E  + R  WI  WQ+A++
Sbjct: 307 SFSADEVAKMRKSWIREWQSALT 329


>gi|328471890|gb|EGF42767.1| thiamine transporter substrate binding subunit [Vibrio
           parahaemolyticus 10329]
          Length = 330

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/325 (49%), Positives = 228/325 (70%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           + +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV
Sbjct: 5   LNLIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS ADIVLG DNNL+  A+KTGL  + N+D +   LP  W D  FVPYD
Sbjct: 65  SILNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLTEHNVDTANTVLPNGWSDTTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST G GL+LW++ IYGD+  Q
Sbjct: 125 YGYFAFVYNKEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            W+K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY
Sbjct: 185 AWQKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           +Q+EVAA++  SK  +LA +F+ F++S  FQ  +PT NWMYPV D+ +P  ++ + +P K
Sbjct: 245 MQVEVAAKVKGSKNSELADKFINFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPSK 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ+A++
Sbjct: 305 SLSFSADEVAKMRKSWIREWQSALT 329


>gi|260878005|ref|ZP_05890360.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           AN-5034]
 gi|308090034|gb|EFO39729.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein [Vibrio parahaemolyticus
           AN-5034]
          Length = 330

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 226/323 (69%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV++
Sbjct: 7   LIALAAITSTSAFAAENTLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGVSI 66

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EG NS ADIVLG DNNL+  A+KTGL  + N+D +   LP  W D  FVPYDYG
Sbjct: 67  LNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLTEHNVDTANTVLPNGWSDTTFVPYDYG 126

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+K ++  PPK+  EL+ +    K+IYQDPRTST G GL+LW++ IYGD+  Q W
Sbjct: 127 YFAFVYNKEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQAW 186

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           +K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY+Q
Sbjct: 187 QKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHYMQ 246

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  SK  +LA +FM F++S   Q  +PT NWMYPV D+ +P  ++ + +P KSL
Sbjct: 247 VEVAAKVKGSKNSELADQFMNFILSDEIQSAMPTGNWMYPVTDVELPKGFETLSVPSKSL 306

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F+A+E  + R  WI  WQ+A++
Sbjct: 307 SFSADEVAKMRKSWIREWQSALT 329


>gi|323494201|ref|ZP_08099315.1| thiamine transporter substrate binding subunit [Vibrio brasiliensis
           LMG 20546]
 gi|323311542|gb|EGA64692.1| thiamine transporter substrate binding subunit [Vibrio brasiliensis
           LMG 20546]
          Length = 335

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 230/330 (69%), Gaps = 3/330 (0%)

Query: 7   IVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIG 66
           I +  + I G+ S+     L A   LTVYTY+SF AD G GP +++AFE +C C++  + 
Sbjct: 8   ISISTLAIAGLASFS---ALAADNTLTVYTYDSFAADWGPGPTVEKAFEAQCGCDVNFVA 64

Query: 67  LSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDI 126
           L DGV++LN+LR+EG NS ADIVLG DNNL+  A+KTGL ++ N+D S + LP  W+D  
Sbjct: 65  LDDGVSILNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLSQHNVDTSAVTLPNGWNDAT 124

Query: 127 FVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG 186
           FVPYD+GY AF+Y+K ++  PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YG
Sbjct: 125 FVPYDFGYFAFVYNKEKLANPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYG 184

Query: 187 DNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF 246
           D + Q W+ +A KT TVTKGW+E+Y  FL+GESD VLSY+TSP ++L+      Y AA F
Sbjct: 185 DETTQAWQNLAKKTVTVTKGWSEAYSMFLEGESDLVLSYTTSPAYHLIAENDAKYAAADF 244

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI 306
           +EGHY Q+EVAA++  SK  +LA EFM F++S  FQ  +PT NWMYPV ++ +P  +  +
Sbjct: 245 AEGHYTQVEVAAKVKGSKNEKLADEFMNFILSEGFQSAMPTGNWMYPVTNVELPKGFDTL 304

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
            +P K+L F+A+E    R  WI  WQ+A++
Sbjct: 305 TVPSKALGFSADEVAENRKSWIREWQSALT 334


>gi|312881958|ref|ZP_07741715.1| thiamine transporter substrate binding subunit [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309370394|gb|EFP97889.1| thiamine transporter substrate binding subunit [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 335

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/323 (48%), Positives = 227/323 (70%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           I  ++  C +    +   LTVYTY+SF ++ G GPKIK AFE  C+C L  + L DGV++
Sbjct: 12  IVTLVGSCAMSAFASDNSLTVYTYDSFASEWGPGPKIKTAFEAHCDCTLNFVALDDGVSI 71

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EGEN+ ADIVLG DNNL+  A+KTGL A  N+D + +KLP  W D  F+PYD+G
Sbjct: 72  LNRLRLEGENTKADIVLGLDNNLMAEAKKTGLLALHNVDTNHIKLPNGWSDTTFIPYDFG 131

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+K  +  PP++  EL+      K+IYQDPRTST G GL+LW++ +YGD   Q W
Sbjct: 132 YFAFVYNKEALKNPPQSLKELVEQRNDLKVIYQDPRTSTPGQGLMLWMKSVYGDKVEQAW 191

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           K++A KT TVTKGW+E+Y  FL+GE+D VLSY+TSP ++++   +  Y AA F EGHY Q
Sbjct: 192 KQLAKKTVTVTKGWSEAYSMFLEGEADLVLSYTTSPAYHMIVENETKYAAADFKEGHYTQ 251

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  ++  +LA +F+ F++S  FQ ++PT NWMYPV+D+ MP  + ++ +P KSL
Sbjct: 252 VEVAAKVKNTRHGKLADQFLTFVVSNDFQSVIPTGNWMYPVIDVKMPGDFASLALPSKSL 311

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F ++E  ++R  W+  WQNA++
Sbjct: 312 MFGSDEVAKHRKAWVREWQNALT 334


>gi|320157544|ref|YP_004189923.1| thiamin ABC transporter substrate-binding component [Vibrio
           vulnificus MO6-24/O]
 gi|319932856|gb|ADV87720.1| thiamin ABC transporter substrate-binding component [Vibrio
           vulnificus MO6-24/O]
          Length = 335

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 234/329 (71%), Gaps = 1/329 (0%)

Query: 8   VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
           ++ +  IT ++   +   L A   LT+YTY+SF +D G GP +++AFE +C C++  + L
Sbjct: 7   LIALASITSMMGISS-SALAADKTLTIYTYDSFASDWGPGPTVEKAFEAQCGCDVNFVAL 65

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
            DGV++LN+LR+EG N+ ADIVLG DNNL+  A+ TGL A   ++   L LP  W DD F
Sbjct: 66  DDGVSILNRLRLEGSNTKADIVLGLDNNLMAEAKTTGLLAPHQVNTQALSLPNGWADDTF 125

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +PYDYGY AF+Y+K ++T PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YGD
Sbjct: 126 IPYDYGYFAFVYNKGKLTNPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYGD 185

Query: 188 NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
           + A  W+++A KT TVTKGW+E+Y  FLKGESD VLSY+TSP ++L+      Y AA FS
Sbjct: 186 DVAGAWQQLAKKTVTVTKGWSEAYSMFLKGESDMVLSYTTSPAYHLIAENDAQYAAAGFS 245

Query: 248 EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR 307
           EGHY+Q+EVAA++  S+   LA +FM F++S  FQ  +PT NWMYPV ++++P+ Y+++ 
Sbjct: 246 EGHYMQVEVAAKVKSSQNSALADQFMSFILSDEFQSAMPTGNWMYPVTNVTLPEGYRSLT 305

Query: 308 IPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           +P+K+L F+AEE  + R  WI  WQ+A++
Sbjct: 306 VPEKALSFSAEEVAKQRKAWIREWQSALT 334


>gi|153215197|ref|ZP_01949878.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae 1587]
 gi|124114842|gb|EAY33662.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae 1587]
          Length = 330

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 227/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A P LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAAPTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|149190577|ref|ZP_01868846.1| thiamin transporter substrate binding subunit [Vibrio shilonii AK1]
 gi|148835575|gb|EDL52543.1| thiamin transporter substrate binding subunit [Vibrio shilonii AK1]
          Length = 332

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 163/310 (52%), Positives = 226/310 (72%)

Query: 26  LPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
           L A   LTVYTY+SF +D G GP I++AFE KC C+L  + L DGV++LN+LR+EG +S 
Sbjct: 21  LAAANTLTVYTYDSFASDWGPGPAIEKAFEAKCGCDLNFVALDDGVSILNRLRLEGSSSQ 80

Query: 86  ADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
           AD+VLG DNNL+  A+ +GL AK N D S L+LP  W DD+FVP+DYGY AF+Y+K ++ 
Sbjct: 81  ADVVLGLDNNLMSEAKASGLLAKHNADLSALELPNGWSDDVFVPFDYGYFAFVYNKEKVK 140

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
            PPK+  EL+      K+IYQDPRTST G GLLLW++ +YGD+S++ W+K+A KT TVTK
Sbjct: 141 NPPKSLKELVEQRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDDSSEAWQKLAKKTVTVTK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+E+Y  FL+GESD VLSY+TSP ++++      + AA FSEGHY Q+EVAA++  S +
Sbjct: 201 GWSEAYSMFLEGESDLVLSYTTSPAYHIIAEQDKRFAAADFSEGHYTQVEVAAKVASSDK 260

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
            +LA EFMQF++S  FQ  +PT NWMYPVV+  +P+ ++++ IP ++L F+ +E    R 
Sbjct: 261 QKLADEFMQFIVSEDFQSKIPTGNWMYPVVESKLPEGFESLTIPSEALTFSPDEVANNRK 320

Query: 326 QWISSWQNAV 335
            WI  WQ+A+
Sbjct: 321 AWIREWQSAL 330


>gi|326423753|ref|NP_759687.3| thiamin/thiamin pyrophosphate ABC transporter thiamin/thiamin
           pyrophospate-binding protein [Vibrio vulnificus CMCP6]
 gi|319999115|gb|AAO09214.2| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio vulnificus CMCP6]
          Length = 342

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 233/329 (70%), Gaps = 1/329 (0%)

Query: 8   VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
           ++ +  IT ++   +   L A   LT+YTY+SF +D G GP +++AFE +C C++  + L
Sbjct: 14  LIALASITSMMGISS-SALAADKTLTIYTYDSFASDWGPGPTVEKAFEAQCGCDVNFVAL 72

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
            DGV++LN+LR+EG N+ ADIVLG DNNL+  A+ TGL A   ++   L LP  W DD F
Sbjct: 73  DDGVSILNRLRLEGSNTKADIVLGLDNNLMAEAKATGLLAPHQVNTQALSLPNGWADDTF 132

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +PYDYGY AF+Y+K ++  PPK+  EL+ S    K+IYQDPRTST G GL+LWI+ +YGD
Sbjct: 133 IPYDYGYFAFVYNKGKLANPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWIKSVYGD 192

Query: 188 NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
           + A  W+++A KT TVTKGW+E+Y  FLKGESD VLSY+TSP ++L+      Y AA FS
Sbjct: 193 DVAGAWQQLAKKTVTVTKGWSEAYSMFLKGESDMVLSYTTSPAYHLIAENDAQYAAAGFS 252

Query: 248 EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR 307
           EGHY+Q+EVAA++  S+   LA +FM F++S  FQ  +PT NWMYPV ++++P+ Y+++ 
Sbjct: 253 EGHYMQVEVAAKVKSSQNSALADQFMSFILSDEFQSAMPTGNWMYPVTNVTLPEGYRSLT 312

Query: 308 IPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           +P+K+L F+AEE  + R  WI  WQ+A++
Sbjct: 313 VPEKALSFSAEEVAKQRKAWIREWQSALT 341


>gi|254230040|ref|ZP_04923439.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio sp. Ex25]
 gi|262392460|ref|YP_003284314.1| thiamin ABC transporter substrate-binding component [Vibrio sp.
           Ex25]
 gi|151937428|gb|EDN56287.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio sp. Ex25]
 gi|262336054|gb|ACY49849.1| thiamin ABC transporter substrate-binding component [Vibrio sp.
           Ex25]
          Length = 330

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/323 (49%), Positives = 226/323 (69%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           +  + +  +     A+  LT+YTY+SF AD G GPKI+QAFE KC C++  + L DGV++
Sbjct: 7   LIALAAITSTSAFAAENPLTIYTYDSFAADWGPGPKIEQAFEAKCGCDVNFVALDDGVSI 66

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYG 133
           LN+LR+EG NS ADIVLG DNNL+  A+KTGL  + N+D +   LP  W D  FVPYDYG
Sbjct: 67  LNRLRLEGGNSKADIVLGLDNNLMAEAKKTGLLTEHNVDTANTVLPNGWSDTTFVPYDYG 126

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
           Y AF+Y+  ++  PPK+  EL+ +    K+IYQDPRTST G GL+LW++ IYGD+  Q W
Sbjct: 127 YFAFVYNTEKLANPPKSMKELVETRDDLKVIYQDPRTSTPGQGLMLWMKSIYGDDVTQAW 186

Query: 194 KKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
           +K+A+KT TVTKGW+E+Y  FL GESD VLSY+TSP ++L+      +  A F+EGHY+Q
Sbjct: 187 QKLASKTVTVTKGWSEAYSMFLNGESDLVLSYTTSPAYHLIAENDSKFATANFAEGHYMQ 246

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVAA++  +K  +LA +FM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P KSL
Sbjct: 247 VEVAAKVKGAKNSELADQFMNFILSDEFQSAMPTGNWMYPVTDVELPKGFETLSVPNKSL 306

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F+A+E  + R  WI  WQ+A++
Sbjct: 307 SFSADEVAKMRKSWIREWQSALT 329


>gi|261254013|ref|ZP_05946586.1| thiamin ABC transporter substrate-binding component [Vibrio
           orientalis CIP 102891]
 gi|260937404|gb|EEX93393.1| thiamin ABC transporter substrate-binding component [Vibrio
           orientalis CIP 102891]
          Length = 335

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 160/321 (49%), Positives = 226/321 (70%)

Query: 16  GVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
             ++  +     A   LTVYTY+SF AD G GP +++AFE KC C++  + L DGV++LN
Sbjct: 14  AAVTLASFSASAADNTLTVYTYDSFAADWGPGPTVEKAFEAKCGCDVNFVALDDGVSILN 73

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYL 135
           +LR+EG NS ADIVLG DNNL+  A++TGL A+ N+D   + LP  W+D  FVPYD+GY 
Sbjct: 74  RLRLEGGNSKADIVLGLDNNLMAEAKETGLLAQHNVDTDSVTLPNGWNDKTFVPYDFGYF 133

Query: 136 AFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK 195
           AF+Y+K  +T PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YGD+  + W+ 
Sbjct: 134 AFVYNKETLTNPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYGDDVTEAWQN 193

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
           +A KT TVTKGW+E+Y  FL+GESD VLSY+TSP ++L+    + Y AA F+EGHY Q+E
Sbjct: 194 LAKKTVTVTKGWSEAYSMFLEGESDLVLSYTTSPAYHLIAESDEKYAAADFAEGHYTQVE 253

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF 315
           VAA++  SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ + +P ++L F
Sbjct: 254 VAAKVKGSKNEKLADEFMSFILSDEFQSTMPTGNWMYPVTDVELPKGFETLTVPSQALSF 313

Query: 316 NAEETTRYRNQWISSWQNAVS 336
           +A+E  + R  WI  WQ+A++
Sbjct: 314 SADEVAQNRKSWIREWQSALT 334


>gi|197334070|ref|YP_002155026.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio fischeri MJ11]
 gi|197315560|gb|ACH65007.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio fischeri MJ11]
          Length = 338

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/306 (52%), Positives = 225/306 (73%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTVYTY+SF AD G GPK++ AFE KC C L+L+ L DGV++LN+LR+EG+N+ ADIVL
Sbjct: 32  TLTVYTYDSFAADWGPGPKVEAAFEAKCGCNLELVALDDGVSILNRLRLEGKNAKADIVL 91

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DNNL+  A+KTGL A+  ID S + LP  W+D  F+PYD+GY AF+Y+K ++T PPK+
Sbjct: 92  GLDNNLMAEAKKTGLLAQHQIDTSSVNLPNGWNDTTFIPYDFGYFAFVYNKEKVTNPPKS 151

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+      K+IYQDPRTST G GLLLW++ +YGD++AQ WK+++ KT TVTKGW+E+
Sbjct: 152 LKELVEQRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDDAAQAWKQLSKKTVTVTKGWSEA 211

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           Y  FL+GESD VLSY+TSP ++++      + AA FSEGHY Q+EVAA++  +K  +LA 
Sbjct: 212 YSMFLEGESDLVLSYTTSPAYHIIAENDQRFAAANFSEGHYTQVEVAAKVKSTKHNKLAD 271

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           EF+ F++S  FQ  +PT NWMYPV  I +P  ++ + +P K+L F++E+  + R  WI  
Sbjct: 272 EFLAFILSDEFQSAMPTGNWMYPVTQIELPKGFEILTVPNKALSFSSEDIAQKRKSWIRE 331

Query: 331 WQNAVS 336
           WQ+A++
Sbjct: 332 WQHALT 337


>gi|254225931|ref|ZP_04919533.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae V51]
 gi|125621557|gb|EAZ49889.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae V51]
          Length = 330

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 228/325 (70%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A P LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAAPTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALEDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DN+LI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGTNSKADVVLGLDNSLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++T PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLTNPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|262401828|ref|ZP_06078393.1| thiamin ABC transporter substrate-binding component [Vibrio sp.
           RC586]
 gi|262351800|gb|EEZ00931.1| thiamin ABC transporter substrate-binding component [Vibrio sp.
           RC586]
          Length = 330

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 227/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A P LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCFASAASAAPTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALEDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDALKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|229513463|ref|ZP_04402927.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae TMA 21]
 gi|229349340|gb|EEO14296.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae TMA 21]
          Length = 330

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 227/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A P LTVYTY+SF A+ G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAAPTLTVYTYDSFAAEWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  SK  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSSKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|153830094|ref|ZP_01982761.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae 623-39]
 gi|148874406|gb|EDL72541.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae 623-39]
          Length = 330

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 227/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A P LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAAPTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  ++A +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGEMADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|59710874|ref|YP_203650.1| thiamine transporter substrate binding subunit [Vibrio fischeri
           ES114]
 gi|59478975|gb|AAW84762.1| thiamine/thiamine pyrophosphate ABC transporter, thiamine/thiamine
           pyrophospate-binding protein ThiB/TbpA/SfuA [Vibrio
           fischeri ES114]
          Length = 338

 Score =  371 bits (952), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 160/306 (52%), Positives = 224/306 (73%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTVYTY+SF AD G GPK++ AFE KC C L+L+ L DGV++LN+LR+EG+N+ ADIVL
Sbjct: 32  TLTVYTYDSFAADWGPGPKVEAAFEAKCGCNLELVALDDGVSILNRLRLEGKNAKADIVL 91

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DNNL+  A+KTGL A+  ID S + LP  W D  F+PYD+GY AF+Y+K ++T PPK+
Sbjct: 92  GLDNNLMAEAKKTGLLAQHQIDTSSVHLPNGWSDTTFIPYDFGYFAFVYNKEKVTNPPKS 151

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+      K+IYQDPRTST G GLLLW++ +YGD++AQ WK+++ KT TVTKGW+E+
Sbjct: 152 LKELVEQRNDLKVIYQDPRTSTPGQGLLLWMKSVYGDDAAQAWKQLSKKTVTVTKGWSEA 211

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           Y  FL+GESD VLSY+TSP ++++      + AA FSEGHY Q+EVAA++  +K  +LA 
Sbjct: 212 YSMFLEGESDLVLSYTTSPAYHIIAEKDQRFAAANFSEGHYTQVEVAAKVKSTKHNKLAD 271

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           EF+ F++S  FQ  +PT NWMYPV  + +P  ++ + +P K+L F++E+  + R  WI  
Sbjct: 272 EFLAFILSDEFQSAMPTGNWMYPVTKVELPKGFETLTVPNKALSFSSEDIAQKRKSWIRE 331

Query: 331 WQNAVS 336
           WQ+A++
Sbjct: 332 WQHALT 337


>gi|15642534|ref|NP_232167.1| thiamine transporter substrate binding subunit [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121587884|ref|ZP_01677640.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae 2740-80]
 gi|121727417|ref|ZP_01680545.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae V52]
 gi|147675627|ref|YP_001218035.1| thiamine transporter substrate binding subunit [Vibrio cholerae
           O395]
 gi|153801085|ref|ZP_01955671.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae MZO-3]
 gi|153818030|ref|ZP_01970697.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae NCTC 8457]
 gi|153822956|ref|ZP_01975623.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae B33]
 gi|153825793|ref|ZP_01978460.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae MZO-2]
 gi|227082657|ref|YP_002811208.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae M66-2]
 gi|229507405|ref|ZP_04396910.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae BX 330286]
 gi|229509670|ref|ZP_04399151.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae B33]
 gi|229516795|ref|ZP_04406241.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae RC9]
 gi|229527528|ref|ZP_04416920.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae 12129(1)]
 gi|229606912|ref|YP_002877560.1| thiamine transporter substrate binding subunit [Vibrio cholerae
           MJ-1236]
 gi|254291455|ref|ZP_04962247.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae AM-19226]
 gi|254851082|ref|ZP_05240432.1| thiamine ABC transporter [Vibrio cholerae MO10]
 gi|255744485|ref|ZP_05418437.1| thiamin ABC transporter substrate-binding component [Vibrio cholera
           CIRS 101]
 gi|262154691|ref|ZP_06028817.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae INDRE 91/1]
 gi|262167566|ref|ZP_06035271.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae RC27]
 gi|298500633|ref|ZP_07010437.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophosphate-binding protein [Vibrio cholerae MAK 757]
 gi|9657123|gb|AAF95680.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121547854|gb|EAX57939.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae 2740-80]
 gi|121630189|gb|EAX62589.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae V52]
 gi|124123318|gb|EAY42061.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae MZO-3]
 gi|126511465|gb|EAZ74059.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae NCTC 8457]
 gi|126519526|gb|EAZ76749.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae B33]
 gi|146317510|gb|ABQ22049.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae O395]
 gi|149740516|gb|EDM54631.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae MZO-2]
 gi|150422645|gb|EDN14600.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae AM-19226]
 gi|227010545|gb|ACP06757.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae M66-2]
 gi|227014428|gb|ACP10638.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio cholerae O395]
 gi|229335160|gb|EEO00645.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae 12129(1)]
 gi|229345858|gb|EEO10830.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae RC9]
 gi|229353144|gb|EEO18083.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae B33]
 gi|229354910|gb|EEO19831.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae BX 330286]
 gi|229369567|gb|ACQ59990.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae MJ-1236]
 gi|254846787|gb|EET25201.1| thiamine ABC transporter [Vibrio cholerae MO10]
 gi|255738010|gb|EET93403.1| thiamin ABC transporter substrate-binding component [Vibrio cholera
           CIRS 101]
 gi|262024019|gb|EEY42715.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae RC27]
 gi|262030531|gb|EEY49169.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae INDRE 91/1]
 gi|297540802|gb|EFH76859.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophosphate-binding protein [Vibrio cholerae MAK 757]
 gi|327485024|gb|AEA79431.1| Thiamin ABC transporter, substrate-binding component [Vibrio
           cholerae LMA3894-4]
          Length = 330

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 227/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A P LTVYTY+SF A+ G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAAPTLTVYTYDSFAAEWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|260772147|ref|ZP_05881064.1| thiamin ABC transporter substrate-binding component [Vibrio
           metschnikovii CIP 69.14]
 gi|260613014|gb|EEX38216.1| thiamin ABC transporter substrate-binding component [Vibrio
           metschnikovii CIP 69.14]
          Length = 337

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 165/333 (49%), Positives = 234/333 (70%), Gaps = 8/333 (2%)

Query: 10  GIMMITGVISYCTLDGLPA------KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
            I+ +TG+  +C+   L A      KP LTVYTY+SF+AD G GP I++AFE +CNC+L 
Sbjct: 6   SIIALTGL--FCSSLALAAPPTTTDKPTLTVYTYSSFIADWGPGPVIQKAFEAECNCQLN 63

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD 123
           L+GL DGV++LN+LR+EG ++ AD++LG DNNL+  A +TGL A  ++D S L LP  W 
Sbjct: 64  LVGLDDGVSILNRLRLEGRHTKADVLLGLDNNLMAEAEQTGLLAPHSVDLSALTLPNGWS 123

Query: 124 DDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
           D  F+PYDYGY AF+Y+++ +T PP++  EL+       +IYQDPRTST G GLLLW++ 
Sbjct: 124 DKTFIPYDYGYFAFVYNQQTLTHPPQSLRELVEQRDDLTVIYQDPRTSTPGQGLLLWMKS 183

Query: 184 IYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
           +YGD  A  W+++A KT TVTKGW+E+Y  FLKGE+D VLSY+TSP ++ +      Y  
Sbjct: 184 VYGDQVATAWQQLAKKTVTVTKGWSEAYSMFLKGEADMVLSYTTSPAYHKMAENDHRYTT 243

Query: 244 ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVY 303
           A F+EGHY+Q+EVAA++  S    LA +FMQF++S +FQ  +PTTNWMYPV ++++PD +
Sbjct: 244 ANFAEGHYMQVEVAAKVKSSPNQALAAQFMQFIVSDAFQSAIPTTNWMYPVTNVALPDAF 303

Query: 304 QAIRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
             ++ P +SL F+A E    R  WI  WQ+A++
Sbjct: 304 SELQQPSQSLTFSANEVAAQRRHWIREWQHALT 336


>gi|258544879|ref|ZP_05705113.1| thiamin/thiamin pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Cardiobacterium hominis
           ATCC 15826]
 gi|258519902|gb|EEV88761.1| thiamin/thiamin pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Cardiobacterium hominis
           ATCC 15826]
          Length = 327

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 163/309 (52%), Positives = 225/309 (72%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF    GAGP +K AFE+ C+CE+K + L  GV +LN+LR EGE + AD+
Sbjct: 19  KPVLTVYTYSSFNTQWGAGPGLKAAFEKVCDCEVKYVALDHGVMILNRLRQEGEQNGADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           ++G DN+L+  A  TGLFA S +D S+LKLP  W D +FVPYDYG+ +F+YDK ++  PP
Sbjct: 79  IIGIDNSLMQTALDTGLFAPSGVDTSKLKLPDGWTDPVFVPYDYGWFSFVYDKTRLKNPP 138

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           ++  EL+ S +PW +IY DPR ST G G +LW+QK++GD++   W+K+A KT TVTKG +
Sbjct: 139 RSLHELVESQEPWTVIYSDPRVSTPGQGFMLWMQKVFGDDAPAAWEKLAKKTVTVTKGSS 198

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+Y  F KGESD  L YSTSP + L+   +D Y AALF EGHYLQ+EVAA+   SKQP+L
Sbjct: 199 EAYSLFSKGESDMALYYSTSPAYQLMKENKDIYAAALFDEGHYLQVEVAARTRTSKQPEL 258

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           AQ+F++F+I+P+FQ  + TTNW+YP  D+++P+ +  +  P K+L+F  +E  + R QWI
Sbjct: 259 AQKFLEFLITPAFQENIATTNWIYPAGDVTLPEAFAKLPRPAKTLQFTPDEVQKNRPQWI 318

Query: 329 SSWQNAVSR 337
             WQ AVS+
Sbjct: 319 EQWQKAVSQ 327


>gi|161486667|ref|NP_933230.2| thiamine transporter substrate binding subunit [Vibrio vulnificus
           YJ016]
          Length = 335

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 234/329 (71%), Gaps = 1/329 (0%)

Query: 8   VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
           ++ +  IT ++   +   L A   LT+YTY+SF +D G GP +++AFE +C C++  + L
Sbjct: 7   LIALASITSMMGISS-SALAADKTLTIYTYDSFASDWGPGPTVEKAFEAQCGCDVNFVAL 65

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
            DGV++LN+LR+EG N+ ADIVLG DNNL+  A+ TGL A+  ++ + + LP  W DD F
Sbjct: 66  DDGVSILNRLRLEGSNTKADIVLGLDNNLMAEAKATGLLAQHQVETTAITLPNGWADDTF 125

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +PYDYGY AF+Y+K ++  PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YGD
Sbjct: 126 IPYDYGYFAFVYNKGKLANPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYGD 185

Query: 188 NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
           +    W+++A KT TVTKGW+E+Y  FLKGESD VLSY+TSP ++L+      Y AA FS
Sbjct: 186 DVTGAWQQLAKKTVTVTKGWSEAYSMFLKGESDMVLSYTTSPAYHLIAENDAQYAAAGFS 245

Query: 248 EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR 307
           EGHY+Q+EVAA++  S+   LA +FM F++S  FQ  +PT NWMYPV ++++P+ Y+++ 
Sbjct: 246 EGHYMQVEVAAKVKSSQNSALADQFMSFILSDEFQSAMPTGNWMYPVTNVTLPEGYRSLT 305

Query: 308 IPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           +P+K+L F+AEE  + R  WI  WQ+A++
Sbjct: 306 VPEKALSFSAEEVAKQRKAWIREWQSALT 334


>gi|37197361|dbj|BAC93201.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Vibrio vulnificus YJ016]
          Length = 342

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 234/329 (71%), Gaps = 1/329 (0%)

Query: 8   VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
           ++ +  IT ++   +   L A   LT+YTY+SF +D G GP +++AFE +C C++  + L
Sbjct: 14  LIALASITSMMGISS-SALAADKTLTIYTYDSFASDWGPGPTVEKAFEAQCGCDVNFVAL 72

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
            DGV++LN+LR+EG N+ ADIVLG DNNL+  A+ TGL A+  ++ + + LP  W DD F
Sbjct: 73  DDGVSILNRLRLEGSNTKADIVLGLDNNLMAEAKATGLLAQHQVETTAITLPNGWADDTF 132

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +PYDYGY AF+Y+K ++  PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YGD
Sbjct: 133 IPYDYGYFAFVYNKGKLANPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYGD 192

Query: 188 NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
           +    W+++A KT TVTKGW+E+Y  FLKGESD VLSY+TSP ++L+      Y AA FS
Sbjct: 193 DVTGAWQQLAKKTVTVTKGWSEAYSMFLKGESDMVLSYTTSPAYHLIAENDAQYAAAGFS 252

Query: 248 EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR 307
           EGHY+Q+EVAA++  S+   LA +FM F++S  FQ  +PT NWMYPV ++++P+ Y+++ 
Sbjct: 253 EGHYMQVEVAAKVKSSQNSALADQFMSFILSDEFQSAMPTGNWMYPVTNVTLPEGYRSLT 312

Query: 308 IPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           +P+K+L F+AEE  + R  WI  WQ+A++
Sbjct: 313 VPEKALSFSAEEVAKQRKAWIREWQSALT 341


>gi|258622769|ref|ZP_05717787.1| Thiamine-binding periplasmic protein [Vibrio mimicus VM573]
 gi|262170521|ref|ZP_06038199.1| thiamin ABC transporter substrate-binding component [Vibrio mimicus
           MB-451]
 gi|258584957|gb|EEW09688.1| Thiamine-binding periplasmic protein [Vibrio mimicus VM573]
 gi|261891597|gb|EEY37583.1| thiamin ABC transporter substrate-binding component [Vibrio mimicus
           MB-451]
          Length = 330

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 161/325 (49%), Positives = 226/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCFASAASAAQTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGTNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  SK  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSSKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|323496078|ref|ZP_08101138.1| thiamine transporter substrate binding subunit [Vibrio sinaloensis
           DSM 21326]
 gi|323318822|gb|EGA71773.1| thiamine transporter substrate binding subunit [Vibrio sinaloensis
           DSM 21326]
          Length = 335

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/321 (49%), Positives = 227/321 (70%)

Query: 16  GVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
            + +  +   + A   LTVYTY+SF AD G GP +++AFE KC C++  + L DGV++LN
Sbjct: 14  ALATLSSFSAIAADNTLTVYTYDSFAADWGPGPVVEKAFEAKCGCDINFVALDDGVSILN 73

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYL 135
           +LR+EG NS AD+VLG DNNL+  A+KTGL A+ ++D S + LP  W D  FVPYD+GY 
Sbjct: 74  RLRLEGGNSKADVVLGLDNNLMAEAKKTGLLAEHSVDTSSVTLPNGWSDKTFVPYDFGYF 133

Query: 136 AFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK 195
           AF+Y+K ++  PPK+  EL+ S    K+IYQDPRTST G GL+LW++ +YGD+ +Q WK+
Sbjct: 134 AFVYNKDKLANPPKSLKELVESRDDLKVIYQDPRTSTPGQGLMLWMKSVYGDDVSQAWKQ 193

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
           +A KT TVTKGW+E+Y  FL+GESD VLSY+TSP ++L+      Y AA F+EGHY Q+E
Sbjct: 194 LAKKTVTVTKGWSEAYSMFLEGESDLVLSYTTSPAYHLIAENDAKYAAADFTEGHYTQVE 253

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF 315
           VAA++  S   +LA EFM F++S  FQ  +PT NWMYPV ++ +P  ++ + +P ++L F
Sbjct: 254 VAAKVKGSSNDKLADEFMSFILSDEFQSAMPTGNWMYPVTNVELPKGFETLSVPSQALSF 313

Query: 316 NAEETTRYRNQWISSWQNAVS 336
           +A+E  + R  WI  WQ+A++
Sbjct: 314 SADEVAQSRKAWIREWQSALT 334


>gi|262166566|ref|ZP_06034303.1| thiamin ABC transporter substrate-binding component [Vibrio mimicus
           VM223]
 gi|262026282|gb|EEY44950.1| thiamin ABC transporter substrate-binding component [Vibrio mimicus
           VM223]
          Length = 330

 Score =  367 bits (942), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 226/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   +TVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCFASAASAAQTITVYTYDSFAADWGPAPAIEKAFETQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGTNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  SK  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSSKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|218710687|ref|YP_002418308.1| thiamine transporter substrate-binding subunit [Vibrio splendidus
           LGP32]
 gi|218323706|emb|CAV20051.1| Thiamine-binding periplasmic protein precursor [Vibrio splendidus
           LGP32]
          Length = 330

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 226/331 (68%), Gaps = 3/331 (0%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           ++ +  + +T  IS+       A   LTVYTY+SF AD G  P +++AFE KC C++  +
Sbjct: 2   KLTLTTIAVTTAISFS---AFAADNTLTVYTYDSFAADWGPRPAVEKAFEEKCGCDVNFV 58

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDD 125
            L DGV++LN+LR+EG NS ADI+LG DNNL+  A+ TGL A+ ++D S + LP  W+D 
Sbjct: 59  ALEDGVSILNRLRLEGGNSKADIILGLDNNLMAEAKSTGLLAEHSVDTSSVTLPNGWNDS 118

Query: 126 IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY 185
            FVPYD+GY AFIY+K ++  PPK+  EL+      K+IYQDPRTST G G++LW++ +Y
Sbjct: 119 TFVPYDFGYFAFIYNKEKLANPPKSLKELVEQRDDLKVIYQDPRTSTPGQGMMLWMKSVY 178

Query: 186 GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAAL 245
           GD +   WKK+A KT TVTKGW+E+Y  FL+GESD VLSY+TSP ++++      Y AA 
Sbjct: 179 GDEATAAWKKLAQKTVTVTKGWSEAYSMFLEGESDLVLSYTTSPAYHIIAESDSKYAAAS 238

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQA 305
           F EGHY Q+EVAA++  SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ 
Sbjct: 239 FEEGHYTQVEVAAKVKGSKNEKLADEFMAFILSDEFQSAMPTGNWMYPVTDVELPKGFEQ 298

Query: 306 IRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           + +PQK+L F  E+    R  WI  WQ+A++
Sbjct: 299 LTVPQKALSFTPEKIAEKRKPWIREWQSALT 329


>gi|84387797|ref|ZP_00990812.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio splendidus 12B01]
 gi|84377312|gb|EAP94180.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio splendidus 12B01]
          Length = 330

 Score =  366 bits (940), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 163/315 (51%), Positives = 216/315 (68%)

Query: 22  TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEG 81
           +     A   LTVYTY+SF AD G  P +++AFE KC C++  + L DGV++LN+LR+EG
Sbjct: 15  SFSAFAADNTLTVYTYDSFAADWGPRPAVEKAFEEKCGCDVNFVALEDGVSILNRLRLEG 74

Query: 82  ENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK 141
            NS ADIVLG DNNL+  A+ TGL AK ++D S + LP  W D  FVPYD+GY AFIY+K
Sbjct: 75  GNSKADIVLGLDNNLMAEAKATGLLAKHSVDTSSVTLPNGWSDSTFVPYDFGYFAFIYNK 134

Query: 142 RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTA 201
            ++  PPK+  EL+      K+IYQDPRTST G G++LW++ +YGD +   WKK+A KT 
Sbjct: 135 EKLANPPKSLKELVEQRDDLKVIYQDPRTSTPGQGMMLWMKSVYGDEATAAWKKLAQKTV 194

Query: 202 TVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV 261
           TVTKGW+E+Y  FLKGESD VLSY+TSP ++++      Y AA F EGHY Q+EVAA++ 
Sbjct: 195 TVTKGWSEAYSMFLKGESDLVLSYTTSPAYHIIAESDSKYAAASFEEGHYTQVEVAAKVK 254

Query: 262 RSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETT 321
            SK  +LA EFM F++S  FQ  +PT NWMYPV DI +P  +  + +PQK+L F  EE  
Sbjct: 255 GSKNEKLADEFMAFILSDEFQSAMPTGNWMYPVTDIELPKGFDQLTVPQKALSFTPEEIA 314

Query: 322 RYRNQWISSWQNAVS 336
             R  WI  WQ+A++
Sbjct: 315 AKRKPWIREWQSALT 329


>gi|119944165|ref|YP_941845.1| thiamine transporter substrate binding subunit [Psychromonas
           ingrahamii 37]
 gi|119862769|gb|ABM02246.1| thiamine ABC transporter, periplasmic binding protein [Psychromonas
           ingrahamii 37]
          Length = 332

 Score =  365 bits (938), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 165/335 (49%), Positives = 234/335 (69%), Gaps = 5/335 (1%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           M++  + ++ +M  + +IS   L        L VYTY+SF +D G GPKIKQAFE+ C C
Sbjct: 1   MERIVKKIIPLMAFSVIISMPVL-----ADKLVVYTYDSFASDWGPGPKIKQAFEKNCAC 55

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
            L+ + L DGV++LN+LR+EG+N+ ADI+LG DNNL+  A+KTGL AK  +D S + L  
Sbjct: 56  SLEFVALDDGVSILNRLRLEGKNTKADILLGLDNNLMTEAKKTGLLAKHKVDTSNVILAN 115

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            W D+ FVP+DYGY +F+Y+K  +  PP +  ELI   +   +IYQDPRTST GLGL+LW
Sbjct: 116 GWSDNTFVPFDYGYFSFVYNKETLLNPPASLKELIEQRQDINVIYQDPRTSTPGLGLMLW 175

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           I+ +YGD +   WKK+A KT TVTKGW+E+Y  FLKGE+D VLSYSTSP ++++  G++ 
Sbjct: 176 IKWVYGDQADDAWKKLAKKTVTVTKGWSEAYSMFLKGEADMVLSYSTSPAYHIIAEGKNQ 235

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP 300
           Y AA FSEGHY Q+EVAA++  SK  +LA +FM F++S  FQ ++PT NWMYPV D+++P
Sbjct: 236 YAAANFSEGHYTQVEVAAKVKSSKNEKLADKFMAFIVSDEFQSLMPTGNWMYPVTDVALP 295

Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           + ++ + IP  S  F+A++    R  WI  WQ+++
Sbjct: 296 EGFKNLTIPSTSFSFSADKVDNNRKVWIREWQSSL 330


>gi|148977784|ref|ZP_01814340.1| thiamin transporter substrate binding subunit [Vibrionales
           bacterium SWAT-3]
 gi|145962998|gb|EDK28268.1| thiamin transporter substrate binding subunit [Vibrionales
           bacterium SWAT-3]
          Length = 330

 Score =  365 bits (936), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 221/315 (70%)

Query: 22  TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEG 81
           +     A   LTVYTY+SF AD G  P +++AFE KC C++  + L DGV++LN+LR+EG
Sbjct: 15  SFSAFAADDTLTVYTYDSFAADWGPRPAVEKAFEEKCGCDVNFVALEDGVSILNRLRLEG 74

Query: 82  ENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK 141
            +S ADIVLG DNNL+  A+ TGL A+ N+D S + LP  WDD+ FVPYD+GY AF+Y+ 
Sbjct: 75  GSSKADIVLGLDNNLMAEAKATGLLAEHNVDTSSVTLPNGWDDNTFVPYDFGYFAFVYNT 134

Query: 142 RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTA 201
            ++  PPK+  EL+   +  K+IYQDPRTST G G++LW++ +YGD +   WKK+A KT 
Sbjct: 135 EKLANPPKSLKELVEQREDLKVIYQDPRTSTPGQGMMLWMKSVYGDEATAAWKKLAQKTV 194

Query: 202 TVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV 261
           TVTKGW+E+Y  FL+GESD VLSY+TSP ++++      Y AA F EGHY Q+EVAA++ 
Sbjct: 195 TVTKGWSEAYSMFLEGESDLVLSYTTSPAYHIIAENDSKYAAANFEEGHYTQVEVAAKVK 254

Query: 262 RSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETT 321
            SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ + +PQ++L F++EE  
Sbjct: 255 GSKNEKLADEFMAFILSDEFQSAMPTGNWMYPVTDVELPKGFEQLTVPQQALSFSSEEIA 314

Query: 322 RYRNQWISSWQNAVS 336
             R  WI  WQ+A++
Sbjct: 315 EKRKPWIREWQSALT 329


>gi|226327110|ref|ZP_03802628.1| hypothetical protein PROPEN_00975 [Proteus penneri ATCC 35198]
 gi|225204328|gb|EEG86682.1| hypothetical protein PROPEN_00975 [Proteus penneri ATCC 35198]
          Length = 259

 Score =  365 bits (936), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 163/259 (62%), Positives = 209/259 (80%)

Query: 79  MEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           MEG+ S ADI+LG DNNLI  A++TGLFA SNID S+L LP KW DD FVPYDYGY AFI
Sbjct: 1   MEGDKSKADIILGLDNNLIHAAKETGLFAPSNIDTSKLALPEKWTDDTFVPYDYGYFAFI 60

Query: 139 YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIAT 198
           YDK ++  PPK+  EL+NS + WKI+YQDPRTST GLGL+LW+Q +Y +N+A  WKK++ 
Sbjct: 61  YDKNRVQNPPKSMAELLNSKEKWKILYQDPRTSTPGLGLMLWMQSLYPENTATEWKKLSE 120

Query: 199 KTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           KT TVTKGW+ESYG FLKGE DFVLSY++SPG+++L   +D+Y AA+F EGHYLQ+EVAA
Sbjct: 121 KTLTVTKGWSESYGLFLKGEGDFVLSYTSSPGYHILADKKDNYAAAIFDEGHYLQVEVAA 180

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE 318
           +L  SKQP+LAQ+FMQFM++P+FQ  +PTTNWMYPV+D+ +PDVY  +  P+KSL+F+A+
Sbjct: 181 KLKSSKQPELAQQFMQFMLTPAFQETIPTTNWMYPVIDMPLPDVYSVMPKPEKSLQFDAD 240

Query: 319 ETTRYRNQWISSWQNAVSR 337
              + R  W  +WQ+AVSR
Sbjct: 241 IVAKERQTWTRNWQSAVSR 259


>gi|258625795|ref|ZP_05720674.1| Thiamine-binding periplasmic protein [Vibrio mimicus VM603]
 gi|258582033|gb|EEW06903.1| Thiamine-binding periplasmic protein [Vibrio mimicus VM603]
          Length = 330

 Score =  365 bits (936), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 225/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCFASAASAAQTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGTNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPMSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  SK  +LA +F+ F++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSSKNGELADKFLLFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|86147590|ref|ZP_01065900.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio sp. MED222]
 gi|85834629|gb|EAQ52777.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Vibrio sp. MED222]
          Length = 330

 Score =  365 bits (936), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 218/315 (69%)

Query: 22  TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEG 81
           +     A   LTVYTY+SF AD G  P +++AFE KC C++  + L DGV++LN+LR+EG
Sbjct: 15  SFSAFAADNTLTVYTYDSFAADWGPRPAVEKAFEEKCGCDVNFVALEDGVSILNRLRLEG 74

Query: 82  ENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK 141
            NS ADI+LG DNNL+  A+ TGL A+ ++D S + LP  W+D  FVPYD+GY AFIY+K
Sbjct: 75  GNSKADIILGLDNNLMAEAKSTGLLAEHSVDTSSVTLPNGWNDSTFVPYDFGYFAFIYNK 134

Query: 142 RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTA 201
            ++  PPK+  EL+      K+IYQDPRTST G G++LW++ +YGD +   WKK+A KT 
Sbjct: 135 EKLANPPKSLKELVEQRDDLKVIYQDPRTSTPGQGMMLWMKSVYGDEATAAWKKLAQKTV 194

Query: 202 TVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV 261
           TVTKGW+E+Y  FL+GESD VLSY+TSP ++++      Y AA F EGHY Q+EVAA++ 
Sbjct: 195 TVTKGWSEAYSMFLEGESDLVLSYTTSPAYHIIAESDSKYAAASFEEGHYTQVEVAAKVK 254

Query: 262 RSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETT 321
            SK  +LA EFM F++S  FQ  +PT NWMYPV D+ +P  ++ + +PQK+L F  EE  
Sbjct: 255 GSKNEKLADEFMAFILSDEFQSAMPTGNWMYPVTDVELPKGFEQLTVPQKALSFTPEEIA 314

Query: 322 RYRNQWISSWQNAVS 336
             R  WI  WQ+A++
Sbjct: 315 EKRKPWIREWQSALT 329


>gi|297581384|ref|ZP_06943307.1| thiamine ABC transporter [Vibrio cholerae RC385]
 gi|297534222|gb|EFH73060.1| thiamine ABC transporter [Vibrio cholerae RC385]
          Length = 330

 Score =  364 bits (935), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 226/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAASTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALEDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|262191592|ref|ZP_06049772.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae CT 5369-93]
 gi|262032520|gb|EEY51078.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae CT 5369-93]
          Length = 330

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 226/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAASTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGTNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|229524522|ref|ZP_04413927.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae bv. albensis VL426]
 gi|229338103|gb|EEO03120.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae bv. albensis VL426]
          Length = 330

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 226/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAASTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALDDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|254507381|ref|ZP_05119516.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio parahaemolyticus
           16]
 gi|219549637|gb|EED26627.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Vibrio parahaemolyticus
           16]
          Length = 335

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 159/309 (51%), Positives = 225/309 (72%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+  LTVYTY+SF AD G GPK+++AFE +C C++  + L DGV++LN+LR+EGENS AD
Sbjct: 26  AEKALTVYTYDSFAADWGPGPKVEKAFEAQCGCDVNFVALDDGVSILNRLRLEGENSKAD 85

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DNNL+  A+KTGL A+ ++D + + LP  W+D  FVPYDYGY AF+Y+K ++  P
Sbjct: 86  IVLGLDNNLMAEAKKTGLLAEHSVDTTSVTLPNGWNDSTFVPYDYGYFAFVYNKEKLANP 145

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL++S    K+IYQDPRTST G GL+LW++ +YGD + Q W+ +A KT TVTKGW
Sbjct: 146 PKSLKELVDSRDDLKVIYQDPRTSTPGQGLMLWMKSVYGDEATQAWQNLAKKTVTVTKGW 205

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+Y  FL+GESD VLSY+TSP ++L+  G   + AA F+EGHY Q+EVAA++  S    
Sbjct: 206 SEAYSMFLEGESDLVLSYTTSPAYHLIAEGDAKFAAADFAEGHYTQVEVAAKVKGSNNQA 265

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA +FM F++S  FQ ++PT NWMYPV  + +P  ++ + +P K+L F+A++    R  W
Sbjct: 266 LADQFMAFILSDEFQSVMPTGNWMYPVTSVELPQGFETLTVPNKALSFSADKVAENRKTW 325

Query: 328 ISSWQNAVS 336
           I  WQ+A++
Sbjct: 326 IREWQSALT 334


>gi|229521604|ref|ZP_04411022.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae TM 11079-80]
 gi|229341198|gb|EEO06202.1| thiamin ABC transporter substrate-binding component [Vibrio
           cholerae TM 11079-80]
          Length = 330

 Score =  363 bits (931), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 159/325 (48%), Positives = 226/325 (69%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAASTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALEDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  ++D S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGTNSKADVVLGLDNNLIEEAKQTGLLATHSVDTSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      ++IYQDPRTST G GLLLW++ +YGD + Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLQVIYQDPRTSTPGQGLLLWMKSVYGDQAPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++A+KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLASKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLAVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|90408631|ref|ZP_01216785.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Psychromonas sp. CNPT3]
 gi|90310275|gb|EAS38406.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Psychromonas sp. CNPT3]
          Length = 333

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 161/305 (52%), Positives = 223/305 (73%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTVYTYNSF +D G GPKI++AFE  CNC+L  + L DG+++LN+LR+EG NS ADI+LG
Sbjct: 28  LTVYTYNSFTSDWGPGPKIEKAFEESCNCDLDFVSLDDGISVLNRLRLEGNNSRADIILG 87

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNF 151
            D++L+  A KTGL AK N+D + +K   KW D  FVPYD GY AF+Y+K ++  PPK+ 
Sbjct: 88  LDDSLMADAEKTGLLAKHNMDLTNIKTANKWTDLTFVPYDQGYFAFVYNKDKLKNPPKSL 147

Query: 152 DELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY 211
            EL+      KIIYQDPRTST GLGLLLW++ +YGD+ ++ WK++  KT TVTKGWTESY
Sbjct: 148 KELVERKDDLKIIYQDPRTSTPGLGLLLWMKSVYGDSVSRAWKQLDKKTVTVTKGWTESY 207

Query: 212 GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQE 271
             FLKGE+D VLSY+TSP ++++  G++ YVAA FSEGHY+Q EVAA +  S+  +LA++
Sbjct: 208 SMFLKGEADMVLSYTTSPAYHIIVEGKNQYVAADFSEGHYMQTEVAAIVKSSQHKKLAEK 267

Query: 272 FMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           FM FM+S  FQ  + T NWMYPV D+++P+ ++ + +P K+L   +E+ + +R  W   W
Sbjct: 268 FMHFMLSDEFQGEIATGNWMYPVTDVALPEQFRQLTVPSKALSIKSEDVSTHRRAWTREW 327

Query: 332 QNAVS 336
            NA++
Sbjct: 328 LNALT 332


>gi|209693953|ref|YP_002261881.1| thiamine transporter substrate binding subunit [Aliivibrio
           salmonicida LFI1238]
 gi|208007904|emb|CAQ78034.1| thiamine-binding periplasmic protein precursor [Aliivibrio
           salmonicida LFI1238]
          Length = 338

 Score =  363 bits (931), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 159/305 (52%), Positives = 219/305 (71%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTVYTY+SF AD G GP IK AFE++C C L L+ L DGV++LN+LR+EG NS ADIVL
Sbjct: 32  TLTVYTYDSFAADWGPGPTIKAAFEKQCGCNLDLVALDDGVSILNRLRLEGSNSKADIVL 91

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DNNL+  A+ TGL A+ N++   + +P  W+D  FVPYDYGY AF+Y+K ++  PPK+
Sbjct: 92  GLDNNLMAEAKVTGLLAEHNVNTDSVTIPNGWNDKTFVPYDYGYFAFVYNKEKVKNPPKS 151

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+       +IYQDPRTST G GLLLW++ +YGD+ AQ WK++A KT TVTKGW+E+
Sbjct: 152 LKELVEQRDDLTVIYQDPRTSTPGQGLLLWMKSVYGDDVAQAWKQLAKKTVTVTKGWSEA 211

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           Y  FL+GESD VLSY+TSP ++ L    D + AA FSEGHY+Q+EVAA++  ++   L  
Sbjct: 212 YSMFLEGESDLVLSYTTSPAYHSLAEKDDRFAAANFSEGHYMQVEVAAKVKNTQHNALTD 271

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           EF+ F++S  FQ  +PT NWMYPV +I++P  ++ +++P K+L F++ E  + R  WI  
Sbjct: 272 EFLAFILSKEFQSAMPTGNWMYPVTNITLPKGFEDLKVPTKALSFSSAEIAKQRKLWIRE 331

Query: 331 WQNAV 335
           WQ+A+
Sbjct: 332 WQHAL 336


>gi|261211099|ref|ZP_05925388.1| thiamin ABC transporter substrate-binding component [Vibrio sp.
           RC341]
 gi|260839600|gb|EEX66211.1| thiamin ABC transporter substrate-binding component [Vibrio sp.
           RC341]
          Length = 330

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 158/325 (48%), Positives = 224/325 (68%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           +    + + C      A   LTVYTY+SF AD G  P I++AFE +C C+L+ + L DGV
Sbjct: 5   LTAVALATLCVASAASAASTLTVYTYDSFAADWGPAPAIEKAFEAQCGCDLQFVALEDGV 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ++LN+LR+EG NS AD+VLG DNNLI+ A++TGL A  +++ S++ LP  W D+ FVPYD
Sbjct: 65  SILNRLRLEGSNSKADVVLGLDNNLIEEAKQTGLLATHSVETSKVTLPNGWSDNTFVPYD 124

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           YGY AF+Y+K ++  PP +  EL+      K+IYQDPRTST G GLLLW++ +YGD   Q
Sbjct: 125 YGYFAFVYNKEKLANPPTSLKELVEKRDDLKVIYQDPRTSTPGQGLLLWMKSVYGDQVPQ 184

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            WK++ +KT TVTKGW+E+Y  FL GE+D VLSY+TSP ++L+      +  A FSEGHY
Sbjct: 185 AWKQLVSKTVTVTKGWSEAYSMFLGGEADLVLSYTTSPAYHLIAENDARFATANFSEGHY 244

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK 311
           LQ+EVAA++  +K  +LA +F+QF++S  FQ ++PT NWMYPV  + +P  +  + +P +
Sbjct: 245 LQVEVAAKVKSTKNGELADKFLQFILSNEFQSVIPTGNWMYPVTAVELPKGFDTLTVPTQ 304

Query: 312 SLRFNAEETTRYRNQWISSWQNAVS 336
           SL F+A+E  + R  WI  WQ A+S
Sbjct: 305 SLSFSAQEVAQMRKPWIREWQQALS 329


>gi|161936333|ref|YP_128647.2| thiamine transporter substrate binding subunit [Photobacterium
           profundum SS9]
          Length = 328

 Score =  358 bits (919), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 159/320 (49%), Positives = 224/320 (70%), Gaps = 1/320 (0%)

Query: 18  ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKL 77
           ++   +  L     LTVYTY+SF +D G GP IK+AFE +C+C +  + L DGV++LN++
Sbjct: 10  LALIAMPALANDNTLTVYTYSSFASDWGPGPTIKKAFEAQCDCTIDFVALDDGVSILNRV 69

Query: 78  RMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAF 137
           R+EG+N+ AD++LG DNNL+  A+KTGL AK NI+ S++ LP  W D  FVPYDYGY AF
Sbjct: 70  RLEGKNTKADVLLGLDNNLMTEAKKTGLLAKHNINTSKVNLPNGWTDKTFVPYDYGYFAF 129

Query: 138 IYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIA 197
           +YD  ++T PPK+  EL+       +IYQDPRTST G GL+LW++ +YGD +   W+++A
Sbjct: 130 VYDSEKLTNPPKSLVELVQRDD-ISVIYQDPRTSTPGQGLMLWMKSVYGDKAPAAWQQLA 188

Query: 198 TKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVA 257
             T TVTKGW+E+Y  FLKGESD VLSY+TSP ++++      Y AA FSEGHY+Q+EVA
Sbjct: 189 KNTVTVTKGWSEAYNMFLKGESDMVLSYTTSPAYHIIAEKDAKYKAANFSEGHYMQVEVA 248

Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNA 317
           A+L  +K P+LA +FM F++S  FQ  +PT NWMYPV   ++PD +  + +P ++L FNA
Sbjct: 249 AKLKAAKNPKLADQFMAFILSDDFQSAMPTGNWMYPVTKQTLPDGFDQLTVPAQALEFNA 308

Query: 318 EETTRYRNQWISSWQNAVSR 337
           +E    R  WI  WQ A+++
Sbjct: 309 DEVAAQRRTWIREWQQALTQ 328


>gi|269103541|ref|ZP_06156238.1| thiamin ABC transporter substrate-binding component [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268163439|gb|EEZ41935.1| thiamin ABC transporter substrate-binding component [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 329

 Score =  358 bits (919), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 157/309 (50%), Positives = 222/309 (71%), Gaps = 1/309 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GPK+K+AFE++C C L  + L DGV++LN++R+EG  + AD+
Sbjct: 22  KPTLTVYTYSSFAADWGPGPKVKRAFEQECGCNLNFVALDDGVSILNRVRLEGSRTKADV 81

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNLI+ A+KTGL A S +D S++ +P  W D IFVPYDYGY AF+Y+  ++ Q P
Sbjct: 82  LLGLDNNLIEEAKKTGLLAPSGVDTSKVNIPNGWHDPIFVPYDYGYFAFVYNSNKLKQVP 141

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            + D+LI+  +   +IYQDPRTST G GL+LWI+ +YGD + Q W+ +A  T TVTKGW+
Sbjct: 142 SSLDQLIHD-QSISVIYQDPRTSTPGQGLMLWIKSVYGDKAPQAWQALAKHTVTVTKGWS 200

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+Y  FL+GE+D VLSY+TSP ++++   +  Y AA F EGHY+Q+EVAA+L  S  P+L
Sbjct: 201 EAYNMFLQGEADMVLSYTTSPAYHIIEENKQQYRAADFKEGHYMQVEVAAKLKNSTHPKL 260

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A EFMQF+++  FQ ++ T NWMYPV+   +P  +  + IP K+L F+ E+  + R  WI
Sbjct: 261 ADEFMQFILTKPFQSLMATGNWMYPVISEPLPKGFDQLTIPTKALEFSPEKIAQERRSWI 320

Query: 329 SSWQNAVSR 337
             WQ A+++
Sbjct: 321 REWQQALTQ 329


>gi|46912050|emb|CAG18845.1| putative ABC-type thiamine transport system,periplasmic component
           [Photobacterium profundum SS9]
          Length = 336

 Score =  358 bits (918), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 158/307 (51%), Positives = 220/307 (71%), Gaps = 1/307 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTVYTY+SF +D G GP IK+AFE +C+C +  + L DGV++LN++R+EG+N+ AD++L
Sbjct: 31  TLTVYTYSSFASDWGPGPTIKKAFEAQCDCTIDFVALDDGVSILNRVRLEGKNTKADVLL 90

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DNNL+  A+KTGL AK NI+ S++ LP  W D  FVPYDYGY AF+YD  ++T PPK+
Sbjct: 91  GLDNNLMTEAKKTGLLAKHNINTSKVNLPNGWTDKTFVPYDYGYFAFVYDSEKLTNPPKS 150

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+       +IYQDPRTST G GL+LW++ +YGD +   W+++A  T TVTKGW+E+
Sbjct: 151 LVELVQRDD-ISVIYQDPRTSTPGQGLMLWMKSVYGDKAPAAWQQLAKNTVTVTKGWSEA 209

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           Y  FLKGESD VLSY+TSP ++++      Y AA FSEGHY+Q+EVAA+L  +K P+LA 
Sbjct: 210 YNMFLKGESDMVLSYTTSPAYHIIAEKDAKYKAANFSEGHYMQVEVAAKLKAAKNPKLAD 269

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           +FM F++S  FQ  +PT NWMYPV   ++PD +  + +P ++L FNA+E    R  WI  
Sbjct: 270 QFMAFILSDDFQSAMPTGNWMYPVTKQTLPDGFDQLTVPAQALEFNADEVAAQRRTWIRE 329

Query: 331 WQNAVSR 337
           WQ A+++
Sbjct: 330 WQQALTQ 336


>gi|262275050|ref|ZP_06052861.1| thiamin ABC transporter substrate-binding component [Grimontia
           hollisae CIP 101886]
 gi|262221613|gb|EEY72927.1| thiamin ABC transporter substrate-binding component [Grimontia
           hollisae CIP 101886]
          Length = 331

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 156/307 (50%), Positives = 216/307 (70%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTVYTY+SF AD G GP +K+AFE +C+C L L+ L DGV +LN+LR+EG+NS AD++L
Sbjct: 25  TLTVYTYDSFAADWGPGPAVKKAFEAECHCTLNLVALEDGVTILNRLRLEGKNSKADVIL 84

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G D NL+  A KTGL A  N+D   + LP  W    FVPYDYGY AF+YDK ++T PPK+
Sbjct: 85  GLDTNLMAEAEKTGLLATHNVDTKSVTLPEGWSSQTFVPYDYGYFAFVYDKTKLTNPPKS 144

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+       +IYQDPRTST G GL+LW++ +YGD+ +  W+++A KT TVTKGW+E+
Sbjct: 145 LKELVEKRDDISVIYQDPRTSTPGQGLMLWMKSVYGDDVSGAWQQLAKKTVTVTKGWSEA 204

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           Y  FL+GESD VLSY+TSP ++L+     ++ +A F+EGHY+Q+EVAA++  S++  LA 
Sbjct: 205 YNMFLEGESDLVLSYTTSPAYHLIAEENPNFSSANFAEGHYMQVEVAAKVKSSEKQALAD 264

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           +FMQF++S  FQ  +PT  WMYPV DI++P  +  + +P KSL+F  E     R  WI  
Sbjct: 265 QFMQFILSDGFQNAVPTGQWMYPVTDIALPAGFDTLSVPAKSLQFTPENVADNRRTWIRE 324

Query: 331 WQNAVSR 337
           WQ+A+ +
Sbjct: 325 WQSALVK 331


>gi|330448792|ref|ZP_08312439.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328492983|dbj|GAA06936.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 320

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 222/321 (69%), Gaps = 2/321 (0%)

Query: 18  ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCN-CELKLIGLSDGVALLNK 76
           +S        A   L VYTY+SF ++ G GP IK+AFE +CN C++  + L DGV++LN+
Sbjct: 1   MSLIASSAFAADNTLNVYTYSSFASEWGPGPVIKKAFEAQCNGCKVNFVSLEDGVSILNR 60

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA 136
           +R+EG+NS ADI+LG DNNL+  A+ TGL   SN+D S+L LP  W DD FVPYDYGY A
Sbjct: 61  VRLEGKNSKADILLGLDNNLMTEAKNTGLLTNSNVDTSKLTLPKGWSDDTFVPYDYGYFA 120

Query: 137 FIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKI 196
           F+YD  ++  PP + D LI       +IYQDPRTST G GL+LWI+ +YGD + ++W+++
Sbjct: 121 FVYDSSKLPNPPASLDALIKDQNI-SVIYQDPRTSTPGQGLMLWIKSVYGDKAPEMWQQL 179

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
           A  T TVTKGW+E+Y  FLKGESD VLSY+TSP ++++   +  Y AA F EGHY+Q+EV
Sbjct: 180 AKHTVTVTKGWSEAYNMFLKGESDMVLSYTTSPAYHIIAENKHQYKAADFKEGHYMQVEV 239

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFN 316
           AA++  S  P+LA EFMQF+IS +FQ  + T NWMYPV   S+P  +  + +P K+L F+
Sbjct: 240 AAKMKNSPHPKLADEFMQFIISDAFQSQIATHNWMYPVTKQSLPKGFDELTVPSKALEFS 299

Query: 317 AEETTRYRNQWISSWQNAVSR 337
           A+E   +R  WI  WQ A+++
Sbjct: 300 ADEVATHRKAWIREWQQALTQ 320


>gi|89075570|ref|ZP_01161975.1| putative ABC-type thiamine transport system, periplasmic component
           [Photobacterium sp. SKA34]
 gi|89048710|gb|EAR54282.1| putative ABC-type thiamine transport system, periplasmic component
           [Photobacterium sp. SKA34]
          Length = 332

 Score =  356 bits (913), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 156/308 (50%), Positives = 222/308 (72%), Gaps = 2/308 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCN-CELKLIGLSDGVALLNKLRMEGENSAADIV 89
            L VYTY+SF +D G GP +K+AFE++CN C +  + L DGV++LN++R+EG+NS AD++
Sbjct: 26  TLNVYTYSSFASDWGPGPVVKKAFEKQCNGCTVNFVSLEDGVSILNRVRLEGKNSKADVL 85

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG DNNL+  A+ TGL AKS++D S+L LP  W DD F+PYDYGY AF+YD  ++  PP 
Sbjct: 86  LGLDNNLMTEAKNTGLLAKSDVDTSKLTLPKGWSDDTFIPYDYGYFAFVYDSDKLKNPPA 145

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           + D LI   +   +IYQDPRTST G GL+LWI+ +YGD + ++W+++A  T TVTKGW+E
Sbjct: 146 SLDALIKD-QDISVIYQDPRTSTPGQGLMLWIKSVYGDKAPEMWQQLAKHTVTVTKGWSE 204

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +Y  FLKGESD VLSY+TSP ++++   +  Y AA F EGHY+Q+EVAA++  S  P+LA
Sbjct: 205 AYSMFLKGESDMVLSYTTSPAYHIIAEDKHQYKAANFKEGHYMQVEVAAKMKNSPHPKLA 264

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWIS 329
            +FMQF++S +FQ  + T NWMYPV   S+P  +  + +P K+L F+A+E   +R  WI 
Sbjct: 265 DQFMQFIVSDAFQSQIATHNWMYPVTKQSLPKGFDELTVPSKALEFSADEVATHRKAWIR 324

Query: 330 SWQNAVSR 337
            WQ A+++
Sbjct: 325 EWQQALTQ 332


>gi|90580788|ref|ZP_01236591.1| putative ABC-type thiamine transport system,periplasmic component
           [Vibrio angustum S14]
 gi|90438056|gb|EAS63244.1| putative ABC-type thiamine transport system,periplasmic component
           [Vibrio angustum S14]
          Length = 332

 Score =  355 bits (912), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 156/308 (50%), Positives = 221/308 (71%), Gaps = 2/308 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCN-CELKLIGLSDGVALLNKLRMEGENSAADIV 89
            L VYTY+SF +D G GP +K+AFE++CN C +  + L DGV++LN++R+EG+NS AD++
Sbjct: 26  TLNVYTYSSFASDWGPGPVVKKAFEKQCNGCTVNFVSLEDGVSILNRVRLEGKNSKADVL 85

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG DNNL+  A+ TGL AKS++D S+L LP  W DD F+PYDYGY AF+YD  ++  PP 
Sbjct: 86  LGLDNNLMTEAKNTGLLAKSDVDTSKLTLPKGWSDDTFIPYDYGYFAFVYDSDKLKNPPA 145

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           + D LI       +IYQDPRTST G GL+LWI+ +YGD + ++W+++A  T TVTKGW+E
Sbjct: 146 SLDALIKDQNI-SVIYQDPRTSTPGQGLMLWIKSVYGDKAPEMWQQLAKHTVTVTKGWSE 204

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +Y  FLKGESD VLSY+TSP ++++   +  Y AA F EGHY+Q+EVAA++  S  P+LA
Sbjct: 205 AYNMFLKGESDMVLSYTTSPAYHIIAEDKHQYKAANFKEGHYMQVEVAAKMKNSSHPKLA 264

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWIS 329
            +FMQF++S +FQ  + T NWMYPV   S+P  +  + +P K+L F+A+E   +R  WI 
Sbjct: 265 DQFMQFIVSDAFQSQIATHNWMYPVTKQSLPKGFDELTVPSKALEFSADEVATHRKAWIR 324

Query: 330 SWQNAVSR 337
            WQ A+++
Sbjct: 325 EWQQALTQ 332


>gi|330831081|ref|YP_004394033.1| thiamine ABC transporter periplasmic binding protein [Aeromonas
           veronii B565]
 gi|328806217|gb|AEB51416.1| ABC-type thiamine transporter, periplasmic binding protein
           [Aeromonas veronii B565]
          Length = 326

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/310 (52%), Positives = 219/310 (70%), Gaps = 1/310 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A   LTVYTY+SF A+ G GPKIKQAFE+ C+C L L+ L DGVA+LN+LR+EG +S AD
Sbjct: 18  AADTLTVYTYSSFTAEWGPGPKIKQAFEKACDCTLNLVPLEDGVAILNRLRLEGNHSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG D+ LI  A+++GLFA        +K+P  W DD FVPYDYGY AF+YDK ++ QP
Sbjct: 78  LVLGLDDALISEAKQSGLFAPHPAKLDGIKVPGGWQDDTFVPYDYGYFAFVYDKDKLKQP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      K+IYQDPRTST G GL+LW++ +YGD +   W ++A KT TVTKGW
Sbjct: 138 PKSLKELVERPD-LKVIYQDPRTSTPGQGLMLWMKSVYGDKAPAAWTELAKKTVTVTKGW 196

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FL GE+D VLSY+TSP ++L+   +  Y AA F EGHY Q+EVAA+L  +KQ +
Sbjct: 197 SEAYGMFLDGEADMVLSYTTSPAYHLIAENKPQYQAAAFEEGHYRQVEVAAKLKSAKQEK 256

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA +F+QFM+SP+FQ  +PT NWMYPV+D  +P  ++ +    K L F+++E    R  W
Sbjct: 257 LADQFLQFMVSPAFQNEIPTGNWMYPVIDTPLPKGFEQMITVAKPLAFSSDEVAANRKGW 316

Query: 328 ISSWQNAVSR 337
           I  W  AV++
Sbjct: 317 IREWLQAVTQ 326


>gi|90411933|ref|ZP_01219941.1| putative ABC-type thiamine transport system, periplasmic component
           [Photobacterium profundum 3TCK]
 gi|90327191|gb|EAS43563.1| putative ABC-type thiamine transport system, periplasmic component
           [Photobacterium profundum 3TCK]
          Length = 328

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 222/320 (69%), Gaps = 1/320 (0%)

Query: 18  ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKL 77
           ++   +  L     LTVYTY+SF +D G GP IK+AFE +C+C +  + L DGV++LN++
Sbjct: 10  LALIAMPALANDNTLTVYTYSSFASDWGPGPTIKKAFEAQCDCTIDFVALDDGVSILNRV 69

Query: 78  RMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAF 137
           R+EG+N+ AD++LG DNNL+  A+KTGL A+ NI+ S++ LP  W D  FVPYDYGY AF
Sbjct: 70  RLEGKNTKADVLLGLDNNLMTEAKKTGLLAEHNINTSKVILPNGWTDKTFVPYDYGYFAF 129

Query: 138 IYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIA 197
           +YD  ++  PPK+  EL+       +IYQDPRTST G GL+LW++ +YGD +   W+++A
Sbjct: 130 VYDSEKLANPPKSLAELVKRDD-ISVIYQDPRTSTPGQGLMLWMKSVYGDKAPAAWQQLA 188

Query: 198 TKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVA 257
             T TVTKGW+E+Y  FLKGESD VLSY+TSP ++++      Y AA FSEGHY+Q+EVA
Sbjct: 189 KNTVTVTKGWSEAYNMFLKGESDMVLSYTTSPAYHIIAEKDAKYKAANFSEGHYMQVEVA 248

Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNA 317
           A+L  +  P+LA +FM F++S  FQ  +PT NWMYPV   ++PD +  + +P ++L FNA
Sbjct: 249 AKLKAANNPKLADQFMAFILSDDFQSAMPTGNWMYPVTKQALPDGFNQLTVPAQALEFNA 308

Query: 318 EETTRYRNQWISSWQNAVSR 337
           +E    R  WI  WQ A+++
Sbjct: 309 DEVAAQRRSWIREWQQALTQ 328


>gi|145300297|ref|YP_001143138.1| ABC-type thiamine transporter, periplasmic binding protein
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|142853069|gb|ABO91390.1| ABC-type thiamine transporter, periplasmic binding protein
           [Aeromonas salmonicida subsp. salmonicida A449]
          Length = 326

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 160/310 (51%), Positives = 216/310 (69%), Gaps = 1/310 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A   LTVYTY+SF A  G GPKIKQAFE++C C L L+ L DGVA+LN+LR+EG++S AD
Sbjct: 18  AADTLTVYTYSSFTAKWGPGPKIKQAFEKECGCNLNLVALEDGVAILNRLRLEGKHSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG D+ LI  A+++GLFA        +K+P  W DD FVPYDYGY AF+Y+K ++  P
Sbjct: 78  LVLGLDDALISEAKQSGLFAPHTTKLDGIKVPGGWQDDTFVPYDYGYFAFVYNKDKLKAP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      K+IYQDPRTST G GL+LW++ IYG+ +   W ++A KT TVTKGW
Sbjct: 138 PKSLKELVERPD-LKVIYQDPRTSTPGQGLMLWMKSIYGEQAPAAWTELAKKTVTVTKGW 196

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FL GE+D VLSY++SP ++L+   +  Y AA F EGHY Q+EVAA+L  +KQ +
Sbjct: 197 SEAYGMFLDGEADMVLSYTSSPAYHLIAENKPQYQAAAFEEGHYRQVEVAAKLKSAKQGK 256

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA +F+QFMISP+FQ+ +P  NWMYPV D  +P  ++ +    K L F ++E    R  W
Sbjct: 257 LADQFLQFMISPAFQQEIPAGNWMYPVTDAPLPKGFEQMITVSKPLSFTSDEVAANRKNW 316

Query: 328 ISSWQNAVSR 337
           I  W  AV++
Sbjct: 317 IREWLQAVTQ 326


>gi|114769936|ref|ZP_01447546.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [alpha proteobacterium HTCC2255]
 gi|114549641|gb|EAU52523.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [alpha proteobacterium HTCC2255]
          Length = 334

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 165/339 (48%), Positives = 227/339 (66%), Gaps = 7/339 (2%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           M KF     G ++ +  ++  + D LP    LT+YTY+SFV+D G GP IK+AFE+ CNC
Sbjct: 1   MNKFINFAAGFLLAS--VTTASADDLPK---LTIYTYDSFVSDWGPGPAIKKAFEKTCNC 55

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           EL L+G  DG ALL++L++EG  + ADI LG D NL   A  TGLFA  N     L LPI
Sbjct: 56  ELNLVGAGDGAALLSRLQLEGMRTQADIALGLDTNLTARAASTGLFANHNNSLKNLNLPI 115

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            W DD+F+PYD+GY AFIYD  ++  PPK+F ELI     +KI+ QDPR+ST GLGLLLW
Sbjct: 116 DWSDDLFIPYDWGYFAFIYDNIKVKNPPKSFQELIMMPDDFKIVIQDPRSSTPGLGLLLW 175

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           +++ Y D +A++W+ +A K  TVT GW+E+YG F +GE+D VLSY+TSP ++++    + 
Sbjct: 176 VKEAYPDRAAEIWEGLAPKILTVTAGWSEAYGMFTEGEADMVLSYTTSPAYHIIAENDET 235

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV--DIS 298
             AA F EGHY+QIEVAA+L  SK P LA +F++FM S  FQ I+PTTNWMYP V     
Sbjct: 236 KSAANFDEGHYMQIEVAAKLASSKNPVLADKFLEFMTSNDFQSIIPTTNWMYPAVLAKNG 295

Query: 299 MPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +PD ++ +  P KSL   +++    R++ +S W  A+S+
Sbjct: 296 LPDGFEKLISPSKSLLIPSDKAENVRSEALSEWLTALSQ 334


>gi|117619164|ref|YP_855416.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117560571|gb|ABK37519.1| thiamin/thiamin pyrophosphate ABC transporter, periplasmic
           thiamin/thiamin pyrophospate-binding protein [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 326

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 158/310 (50%), Positives = 216/310 (69%), Gaps = 1/310 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A   LTVYTYNSF A+ G GPKIKQAFE++C C LKL+ L DGVA+LN+LR+EG++S AD
Sbjct: 18  AADTLTVYTYNSFTAEWGPGPKIKQAFEKECGCTLKLVPLEDGVAILNRLRLEGKHSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG D+ L+  A+++GLFA        +K+P  W DD FVPYDYGY AF+YD+ ++  P
Sbjct: 78  LVLGLDDALVSEAKQSGLFAPHGSKLDGVKVPGGWQDDTFVPYDYGYFAFVYDQSKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      K+IYQDPRTST G GL+LW++ +YG  +   W ++A KT TVTKGW
Sbjct: 138 PKSLKELVERPD-LKVIYQDPRTSTPGQGLMLWMKSVYGGEAPAAWAQLAKKTVTVTKGW 196

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG FL GE+D VLSY++SP ++L+   +  Y AA F EGHY Q+EVAA+L  + Q +
Sbjct: 197 SEAYGMFLDGEADMVLSYTSSPAYHLIAENKPQYQAAAFEEGHYRQVEVAAKLNSATQGK 256

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           LA +F+QFM SP+FQ  + T NWMYPV+D  +P  ++ +    K L F+++E    R  W
Sbjct: 257 LADKFLQFMTSPAFQNEMATGNWMYPVIDTPLPKGFEQMITVAKPLAFSSDEVAANRKNW 316

Query: 328 ISSWQNAVSR 337
           I  W  AV++
Sbjct: 317 IREWLQAVTQ 326


>gi|327392699|dbj|BAK10121.1| thiamine-binding periplasmic protein precursor TbpA [Pantoea
           ananatis AJ13355]
          Length = 259

 Score =  345 bits (884), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 145/259 (55%), Positives = 205/259 (79%)

Query: 79  MEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           MEG+N+ AD+VLG DNNL+  A++TGLFAKS++D  +L++P  W D  FVP+DYGY AF+
Sbjct: 1   MEGKNTKADVVLGLDNNLLQAAQQTGLFAKSDVDTRELQVPGGWKDTTFVPFDYGYFAFV 60

Query: 139 YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIAT 198
           Y+K  +  PP +  EL+ S + W++IY+DPRTST GLGLLLW+QK+YGDN+ + W+K+A 
Sbjct: 61  YNKNTLKNPPTSLKELVESPEKWRVIYEDPRTSTPGLGLLLWMQKVYGDNAPEAWQKLAK 120

Query: 199 KTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           KT TVTKGW+E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F+EG+YLQ+EVAA
Sbjct: 121 KTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAASFAEGNYLQVEVAA 180

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE 318
           +L  SKQP+LA++FMQFM++P+FQ  +PT NWMYPV+   +P  + ++ +P+ +L+F+ E
Sbjct: 181 RLANSKQPKLAEQFMQFMVTPAFQNTIPTGNWMYPVIKTDLPAGFASLSVPKTTLQFSPE 240

Query: 319 ETTRYRNQWISSWQNAVSR 337
           E   +R+QW+S WQ AVSR
Sbjct: 241 EVASHRSQWVSQWQRAVSR 259


>gi|149909709|ref|ZP_01898361.1| putative ABC-type thiamine transport system,periplasmic component
           [Moritella sp. PE36]
 gi|149807223|gb|EDM67178.1| putative ABC-type thiamine transport system,periplasmic component
           [Moritella sp. PE36]
          Length = 337

 Score =  340 bits (873), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 220/329 (66%), Gaps = 12/329 (3%)

Query: 18  ISYCTLDGLPA----------KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
           ++ CT   LP+          KPVL VYTY+SF +D G GPKIK AFE +CNCEL L+ L
Sbjct: 8   LALCTALLLPSLSLQVANAADKPVLNVYTYDSFASDWGPGPKIKTAFEAECNCELNLVAL 67

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
            DGV++LN++++EG+ + AD++LG DNNL+  A KT L A    D S L LP +W +  F
Sbjct: 68  EDGVSILNRVKLEGKYTKADVLLGLDNNLMAEAVKTNLLAPHQQDTSNLSLPNEWTNKYF 127

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           VP+DYG+ AFIYD  ++  PP +  EL+   K   IIYQDPRTST GLG +LW++ +YGD
Sbjct: 128 VPFDYGHFAFIYDSEKLANPPASLAELVER-KDLSIIYQDPRTSTPGLGFMLWVKAVYGD 186

Query: 188 NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
            + Q W++IA KT T+TKGW+++YG FLKGE+D VLSY+TSP ++++   +  Y AA FS
Sbjct: 187 KAPQAWQQIAAKTVTITKGWSQAYGMFLKGEADMVLSYTTSPAYHMIAEKEFKYKAAEFS 246

Query: 248 EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAI 306
           EGHY Q EV A+L  +  P+LA +FM F+++P+FQ ++ T NWM P     ++P  +  +
Sbjct: 247 EGHYQQTEVVARLKDAANPELADQFMAFVLTPAFQDLIATGNWMLPAKQAAALPSEFDQL 306

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQNAV 335
             P K+L F  EE  + R  W+  W+NAV
Sbjct: 307 ITPAKTLEFTPEEVAQSRKSWVKEWRNAV 335


>gi|237807445|ref|YP_002891885.1| thiamine ABC transporter, periplasmic binding protein [Tolumonas
           auensis DSM 9187]
 gi|237499706|gb|ACQ92299.1| thiamine ABC transporter, periplasmic binding protein [Tolumonas
           auensis DSM 9187]
          Length = 333

 Score =  338 bits (867), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 209/309 (67%), Gaps = 1/309 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF  + G G KIK AFE  C+CELK + L DGVA+LN+L++EG +S AD+
Sbjct: 26  KPVLTVYTYDSFAGEWGPGAKIKLAFEAVCDCELKWVALEDGVAILNRLKLEGAHSKADV 85

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
            LG D  ++  A  + LF   N+D   L LP  W D+ F+P+DYGY AF+YD  ++ QPP
Sbjct: 86  ALGMDEVMLAAAHDSNLFVPHNVDLQSLTLPGGWQDNTFLPFDYGYFAFVYDSSKLKQPP 145

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           ++  EL+      KIIY+DPRTST G GLLLW++++YGD +   W+++A KT TVTKGW+
Sbjct: 146 QSLKELVERND-LKIIYEDPRTSTPGQGLLLWVKQVYGDKAPAAWEQLAKKTVTVTKGWS 204

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKG+SD VLSY+TSP ++ L   +  Y AA+FSEGH  Q+EVAAQL  +  P+L
Sbjct: 205 EAYGMFLKGQSDLVLSYTTSPAYHRLAEDKQQYRAAMFSEGHLRQVEVAAQLKNAPHPEL 264

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           AQ FMQF++   FQ  +P  NWMYPV  + +P+ +     P ++L+ + ++    R  W+
Sbjct: 265 AQRFMQFIVYEHFQNQIPEGNWMYPVTSVKLPEGFNQNETPAQTLQVDTQQIATQRKVWV 324

Query: 329 SSWQNAVSR 337
             W  AVS 
Sbjct: 325 KEWLQAVSH 333


>gi|254513167|ref|ZP_05125233.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221533166|gb|EEE36161.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 360

 Score =  337 bits (863), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 158/311 (50%), Positives = 220/311 (70%), Gaps = 7/311 (2%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SFV+D G GPK+++AFE +C+C+L L+G+ DG ALL++LR+EG+N+ ADI
Sbjct: 55  KPQLTVYTYDSFVSDWGPGPKVEEAFEAECDCDLNLVGVEDGAALLSRLRLEGKNTDADI 114

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG D NLI  A++TGLFA  ++ A    LP+ W D +FVPYD+GY AF+++       P
Sbjct: 115 VLGLDTNLITAAKETGLFAPHSVTA-DYTLPVDWTDTVFVPYDWGYFAFVHNAD--LPAP 171

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            NF  L +S    KII QDPR+ST GLGLLLW++  YG+++  +W  +A    TVTKGW+
Sbjct: 172 ANFRALADSDT--KIIIQDPRSSTPGLGLLLWVKAAYGEDAPAIWADLADNIVTVTKGWS 229

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FL+GE+D VLSY+TSP ++++        AA F EGHY+Q+EVAA+L  S+Q +L
Sbjct: 230 EAYGLFLEGEADMVLSYTTSPAYHVIAEEDASKAAAAFDEGHYMQVEVAAKLANSEQSEL 289

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQ 326
           A +F+ FM+S  FQ+I+PTTNWMYP V  S  +P+ +  +  PQKSL F+ E     R+Q
Sbjct: 290 ADQFLTFMVSDKFQQIIPTTNWMYPAVTPSSGLPEGFDTLVTPQKSLLFDQETAASVRDQ 349

Query: 327 WISSWQNAVSR 337
            +S W  A+S+
Sbjct: 350 ALSEWLGALSQ 360


>gi|254473766|ref|ZP_05087161.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Pseudovibrio sp. JE062]
 gi|211957152|gb|EEA92357.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Pseudovibrio sp. JE062]
          Length = 326

 Score =  335 bits (858), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 158/337 (46%), Positives = 224/337 (66%), Gaps = 14/337 (4%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCEL 62
           K   I  G++  T  ++         KP LTVYTY+SFV+D G GPK+++AFE  C C+L
Sbjct: 2   KHLLIAAGLLTATSAMA-------AEKPELTVYTYDSFVSDWGPGPKVEEAFEAICECDL 54

Query: 63  KLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
            L+G+ DG ALL++LR+EG N+ AD+VLG D NLI+ A+KTGLFA   ++A +  LP+ W
Sbjct: 55  NLVGVEDGAALLSRLRLEGNNTDADVVLGLDTNLIETAKKTGLFAPHAVEA-KYTLPVDW 113

Query: 123 DDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
            D+ FVPYD+GY AF++ K      P NF EL  S    KI+ QDPR+ST GLGLLLW++
Sbjct: 114 ADETFVPYDWGYFAFVHKKGATV--PSNFRELAESDT--KILIQDPRSSTPGLGLLLWVK 169

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV 242
             YGD +A +W  ++    TVTKGW+E+YG FL GE+D VLSY+TSP ++L+    D   
Sbjct: 170 SAYGDEAADIWAGLSDNIVTVTKGWSEAYGLFLDGEADMVLSYTTSPAYHLIAEEDDSKT 229

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MP 300
            A F EGHY+Q+EVAA+L  + QP+LA +F+ FM+S +FQ I+PTTNWMYP V  +  +P
Sbjct: 230 TAAFDEGHYMQVEVAAKLAGTDQPELADKFLNFMVSDAFQSIIPTTNWMYPAVTPASGLP 289

Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
             ++ ++ P+K+L    ++    R + +  W  A+S+
Sbjct: 290 AGFETLQTPEKALLLAPKDAVAARREALPEWLEALSQ 326


>gi|159185343|ref|NP_355647.2| thiamine transporter substrate binding subunit [Agrobacterium
           tumefaciens str. C58]
 gi|159140596|gb|AAK88432.2| ABC transporter, substrate binding protein (thiamine)
           [Agrobacterium tumefaciens str. C58]
          Length = 337

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 212/319 (66%), Gaps = 5/319 (1%)

Query: 23  LDGLPA---KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRM 79
           L GL A   KP LTVYTY SFV++ G GPK+K+AFE+ C C +  +G++DGVALLN+L++
Sbjct: 17  LPGLAAAQDKPELTVYTYESFVSEWGPGPKVKEAFEKVCVCTVNFVGVADGVALLNRLKL 76

Query: 80  EGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIY 139
           EG  S AD+V+G D NL+  A++TGLF  S IDAS  K+P  + DD+FVPYDYG+ A IY
Sbjct: 77  EGSGSKADVVVGLDTNLVAEAKQTGLFDASGIDASAAKVPGGYKDDVFVPYDYGHFAVIY 136

Query: 140 DKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATK 199
           D + +  PP +  EL+      KI  QDPRTST GLGLLLW++ +YGD + + W K+  +
Sbjct: 137 DTQAVKNPPASLKELVEGDSAQKIAIQDPRTSTPGLGLLLWVKSVYGDKAPEAWAKLRKR 196

Query: 200 TATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQ 259
             TVT GW+ESYG F KGE   VLSY+TSP ++++    D Y AA FSEGHY+QIEV+  
Sbjct: 197 ILTVTPGWSESYGLFTKGEVPMVLSYTTSPAYHMVAEKSDRYQAAAFSEGHYIQIEVSGL 256

Query: 260 LVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNA 317
           L  +   +LA++F+ F ++  FQ  +P  NWM PV   S  +P+ +  + +PQK+   + 
Sbjct: 257 LKNAPHKELAKQFLAFTLTSGFQDAIPENNWMMPVAATSAPLPEAFSKLVVPQKTFLMDP 316

Query: 318 EETTRYRNQWISSWQNAVS 336
           EE  + R  WI  W +A+S
Sbjct: 317 EEVAKNRKAWIDEWLSAMS 335


>gi|222087725|ref|YP_002546262.1| ABC transporter, substrate binding protein [Agrobacterium
           radiobacter K84]
 gi|221725173|gb|ACM28329.1| ABC transporter, substrate binding protein [Agrobacterium
           radiobacter K84]
          Length = 342

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 149/308 (48%), Positives = 207/308 (67%), Gaps = 2/308 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LT+YTY SF A+ G G K+K AFE+ C C +  + ++DGVALL++L++EG  + AD+VL
Sbjct: 33  TLTIYTYESFTAEWGPGAKVKAAFEKTCGCTVNYVSVTDGVALLSRLKLEGAGTKADVVL 92

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G D NL+D A+ TGLF  S +D S LK+P ++ DD+FVPYDYG+ A IYD + I  PPK+
Sbjct: 93  GLDTNLVDEAKDTGLFDTSGVDTSALKVPGEFKDDVFVPYDYGHFAVIYDTQTIKNPPKS 152

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+      KI+ +DPRTST GLGLLLW++ +YGD +A  W K+  +  TVT GW+E+
Sbjct: 153 LKELVEGDPSQKIVIEDPRTSTPGLGLLLWVKSVYGDKAADAWTKLKGRILTVTPGWSEA 212

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           YG F KGE+  VLSY+TSP ++++    D Y AA FSEGHY+QIEVA  +  S   +LA+
Sbjct: 213 YGLFTKGEAPMVLSYTTSPAYHMIEEKTDRYQAASFSEGHYIQIEVAGLIKSSPNKELAR 272

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           +F++FM+SP FQ  +PT NWM PV   S  +PD +  + +P K+   + +E  + R  WI
Sbjct: 273 DFLKFMVSPGFQDTIPTNNWMMPVSATSEPLPDAFSKLVVPAKTFLMSPDEVEKNRKAWI 332

Query: 329 SSWQNAVS 336
             W  A S
Sbjct: 333 DEWLAATS 340


>gi|163759992|ref|ZP_02167076.1| thiamin transporter substrate binding subunit [Hoeflea
           phototrophica DFL-43]
 gi|162282950|gb|EDQ33237.1| thiamin transporter substrate binding subunit [Hoeflea
           phototrophica DFL-43]
          Length = 336

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 151/308 (49%), Positives = 209/308 (67%), Gaps = 2/308 (0%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LT+YTY+SFVA+ G GPKI+ AFE  C C+LK +G++DGVALLN+L++EGE + A IVLG
Sbjct: 29  LTIYTYDSFVAEWGPGPKIEAAFEANCECDLKWVGVADGVALLNRLKLEGEKAKAGIVLG 88

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNF 151
            D NL+  A+ TGLF    +D + + +P  + DD F+PYDYG+ A IYD + I  PP + 
Sbjct: 89  LDTNLVAEAKATGLFDAHGLDTAAISVPGGFADDTFIPYDYGHFAVIYDSQSIETPPASL 148

Query: 152 DELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY 211
            +L+      KI+ QDPRTST GLGLLLW++ +YGD +A  W+K++ +  TVT GW+E+Y
Sbjct: 149 KDLVEGDADQKIVIQDPRTSTPGLGLLLWVKSVYGDEAAAAWEKLSGRVLTVTPGWSEAY 208

Query: 212 GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQE 271
           G F  GE+  VLSY+TSP ++++    D Y AA FSEGHYLQIEVA  L  +   +LA+E
Sbjct: 209 GLFTSGEAPMVLSYTTSPAYHMVVEDTDRYRAAEFSEGHYLQIEVAGLLSNAPDKELARE 268

Query: 272 FMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQWIS 329
           F+ FM++P FQ  +PT NWM+P    S  +P+ +  +  P+K+L F+ EE    R  WI 
Sbjct: 269 FLAFMMTPGFQNEIPTNNWMWPAAATSTDLPEAFATLVNPEKTLLFSPEEVAGNRAAWID 328

Query: 330 SWQNAVSR 337
            W  A+SR
Sbjct: 329 EWLGAMSR 336


>gi|150398301|ref|YP_001328768.1| thiamine transporter substrate binding subunit [Sinorhizobium
           medicae WSM419]
 gi|150029816|gb|ABR61933.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Sinorhizobium medicae WSM419]
          Length = 342

 Score =  332 bits (852), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 145/335 (43%), Positives = 214/335 (63%), Gaps = 2/335 (0%)

Query: 5   ARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKL 64
            R + G M+    ++  +     A+  LTVYTY SF+ + G G K+ +AFE+ C+C++  
Sbjct: 7   GRTLAGFMIAAATVTGVSASAFAAEKTLTVYTYESFITEWGPGAKVSEAFEKVCDCKVDY 66

Query: 65  IGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDD 124
           +G++DGV LL +L++EGE S AD+VLG D NL+  A+ TG F    +D + + +P  + D
Sbjct: 67  VGVADGVELLTRLKLEGEGSKADVVLGLDTNLVAEAKATGFFVPHGVDTTSVDVPGGFTD 126

Query: 125 DIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKI 184
           D F+PYDYG+ A +YD   +  PPK+  +L+      KI+ +DPRTST GLGLLLW++ +
Sbjct: 127 DTFIPYDYGHFAVVYDTEMLKSPPKSLRDLVEGDPTQKIVIEDPRTSTPGLGLLLWVKSV 186

Query: 185 YGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA 244
           YGD + + W K+  +  TVT GW+E+YG F KGE+  VLSY+TSP ++++    + Y AA
Sbjct: 187 YGDRAGEAWAKLKARVLTVTPGWSEAYGLFTKGEAPMVLSYTTSPAYHMVAEDTERYQAA 246

Query: 245 LFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDV 302
            F+EGHY+QIEVAA    +K P+LA++F+ FMI P FQ I+PTTNWM PV      +P+ 
Sbjct: 247 PFTEGHYIQIEVAALTKNAKDPELARKFLDFMIGPEFQSIIPTTNWMMPVTATKEPLPEA 306

Query: 303 YQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +  +  P+K+    +EE    R  WI  W  A+SR
Sbjct: 307 FGKLVEPRKTFLIPSEEVAANRRAWIDEWLTAMSR 341


>gi|239832843|ref|ZP_04681172.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Ochrobactrum intermedium
           LMG 3301]
 gi|239825110|gb|EEQ96678.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Ochrobactrum intermedium
           LMG 3301]
          Length = 352

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 153/312 (49%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LTVYTY+SFV++ G GPK+K+ FE++C+CE+  I  +DGVALLN+L++EG N+ AD
Sbjct: 41  AKDKLTVYTYDSFVSEWGPGPKVKENFEKECDCEVDWIASADGVALLNRLKLEGSNTKAD 100

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR TG FA S ID S + +P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 101 IVLGLDTNLTTEARATGFFAPSGIDQSNVNVPGGFRDDIFVPYDYGYFAVVYDSEKLPNP 160

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRTST GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 161 PKSLKELVEGDPSQKIVLQDPRTSTPGLGMLLWMKSVYGDEAEAAWQKLQKRILTVTPGW 220

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 221 SEAYGLFTKGEAPMVLSYTTSPAYHMIAEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 280

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LAQ+F+ FM  P FQ  +P TNWMYP    S  +P  + A+  P+K+L   ++E  R R 
Sbjct: 281 LAQKFLAFMTGPGFQDAIPETNWMYPAGKTSARLPAAFDAMPKPEKTLLIPSDEVARNRK 340

Query: 326 QWISSWQNAVSR 337
            W+  W  A S+
Sbjct: 341 AWVDEWLAATSK 352


>gi|153008476|ref|YP_001369691.1| thiamine transporter substrate-binding subunit [Ochrobactrum
           anthropi ATCC 49188]
 gi|151560364|gb|ABS13862.1| thiamine ABC transporter, periplasmic binding protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 334

 Score =  331 bits (848), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 210/312 (67%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LTVYTY+SFV++ G GPKIK+ FE++C+CE+  I  +DGVALLN+L++EG N+ AD
Sbjct: 23  AKDKLTVYTYDSFVSEWGPGPKIKENFEKECDCEVDWIASADGVALLNRLKLEGGNTKAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR TG FA S ID S + +P  + D+IFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARATGFFAPSGIDQSNVSIPGGFKDNIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRTST GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDASQKIVLQDPRTSTPGLGMLLWMKSVYGDEAEAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    + Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMIAEKTERYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LAQ+F+ FM SP FQ ++P TNWMYP    S  +P  + A+  P+K+L   ++E  + R 
Sbjct: 263 LAQKFLAFMTSPGFQDVIPETNWMYPASKTSTPLPAAFDAMPKPEKTLLLPSDEVAKNRK 322

Query: 326 QWISSWQNAVSR 337
            W+  W  A S+
Sbjct: 323 SWVDEWLAATSK 334


>gi|222150144|ref|YP_002551101.1| thiamine transporter substrate binding subunit [Agrobacterium vitis
           S4]
 gi|221737126|gb|ACM38089.1| ABC transporter substrate binding protein (thiamine) [Agrobacterium
           vitis S4]
          Length = 333

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 208/308 (67%), Gaps = 2/308 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           VLT+YTY SFV++ G GPK+K  FE+ C C +K +GL DGVALLN+L++EG +S AD+ L
Sbjct: 24  VLTIYTYESFVSEWGPGPKVKATFEKTCGCTVKFVGLEDGVALLNRLKLEGASSEADLAL 83

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G D NL + AR+TGLFA   IDAS  ++P  + DD+FVPYDYG+ A +YD + I  PPK+
Sbjct: 84  GLDTNLTEEARQTGLFAPHGIDASTAQVPGGFKDDMFVPYDYGHFAVVYDTQTIKNPPKS 143

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+      KI+ +DPRTST GLGLLLW++ +YG ++   W K+  +  TVT GW+E+
Sbjct: 144 LKELVEGDPAQKIVIEDPRTSTPGLGLLLWVKSVYGKDAPAAWAKLKDRVLTVTPGWSEA 203

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           YG F KGE   V SY+TSP +++++   + Y AA FSEGHY+QIEVA  L  +K  QLA+
Sbjct: 204 YGLFTKGEVPMVFSYTTSPAYHMVSENTERYQAAFFSEGHYIQIEVAGVLKGTKHKQLAE 263

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           +F++FM++  FQ  +PT NWM PV   S  +P+ +  +  P K+   + +E    R  WI
Sbjct: 264 DFLKFMLTSGFQDDIPTNNWMMPVTKTSTPLPEAFDRLVKPAKTFLMSPQEVAANRKAWI 323

Query: 329 SSWQNAVS 336
           + WQ A++
Sbjct: 324 AEWQAAMA 331


>gi|306844745|ref|ZP_07477330.1| thiamine transporter substrate binding subunit [Brucella sp. BO1]
 gi|306274917|gb|EFM56687.1| thiamine transporter substrate binding subunit [Brucella sp. BO1]
          Length = 334

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 211/312 (67%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L   A+E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPADEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 AWVNEWLAATSR 334


>gi|325294087|ref|YP_004279951.1| thiamine transporter substrate binding subunit [Agrobacterium sp.
           H13-3]
 gi|325061940|gb|ADY65631.1| thiamine transporter substrate binding subunit [Agrobacterium sp.
           H13-3]
          Length = 337

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 148/307 (48%), Positives = 208/307 (67%), Gaps = 2/307 (0%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTVYTY SFV++ G GPK+K+AFE+ CNC +  +G++DGVALLN+L++EG  S AD+V+G
Sbjct: 29  LTVYTYESFVSEWGPGPKVKEAFEKVCNCTVNFVGVADGVALLNRLKLEGAASKADVVVG 88

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNF 151
            D NL+  A++TGLF  S IDAS  K+P  + DD+FVPYDYG+ A +YD + I  PP + 
Sbjct: 89  LDTNLVAEAKQTGLFDISGIDASAAKVPGGYKDDVFVPYDYGHFAVVYDTQTIKNPPTSL 148

Query: 152 DELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY 211
            +L++     KI  QDPRTST GLGLLLW++ +YGD + + W K+  +  TVT GW+ESY
Sbjct: 149 KDLVDGDPSQKIAIQDPRTSTPGLGLLLWVKSVYGDKAPEAWAKLRKRILTVTPGWSESY 208

Query: 212 GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQE 271
           G F KGE   VLSY+TSP +++++   D Y AA FSEGHY+QIEV+  L  +   +LA++
Sbjct: 209 GLFTKGEVPMVLSYTTSPAYHMVSEKTDRYQAAAFSEGHYIQIEVSGLLKNAPHKELAKQ 268

Query: 272 FMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQWIS 329
           F+ F ++  FQ  +P  NWM PV   S  +P+ +  + +PQK+   + EE  + R  WI 
Sbjct: 269 FLAFTLTSGFQDAIPENNWMMPVAATSTPLPEAFSKLVVPQKTFLIDPEEVAKNRKAWID 328

Query: 330 SWQNAVS 336
            W  A+S
Sbjct: 329 EWLTAMS 335


>gi|306841473|ref|ZP_07474173.1| thiamine transporter substrate binding subunit [Brucella sp. BO2]
 gi|306288437|gb|EFM59793.1| thiamine transporter substrate binding subunit [Brucella sp. BO2]
          Length = 334

 Score =  328 bits (842), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 210/312 (67%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SF+++ G GPK+K+ FE++C+CE+  I  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFISEWGPGPKVKENFEKECDCEVDWIAAADGVALLNRLKLEGNKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +++P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVRVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLWI+ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWIKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMIVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P K+L   A+E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPDKTLLIPADEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 AWVNEWLAATSR 334


>gi|23502614|ref|NP_698741.1| thiamine transporter substrate binding subunit [Brucella suis 1330]
 gi|81752099|sp|Q8FYV1|THIB_BRUSU RecName: Full=Thiamine-binding periplasmic protein; Flags:
           Precursor
 gi|23348619|gb|AAN30656.1| thiamine ABC transporter, thiamine-binding periplasmic binding
           protein [Brucella suis 1330]
          Length = 334

 Score =  328 bits (840), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDTLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGES  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGESPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|254703531|ref|ZP_05165359.1| thiamine transporter substrate binding subunit [Brucella suis bv. 3
           str. 686]
 gi|260568836|ref|ZP_05839304.1| thiamine-binding periplasmic protein [Brucella suis bv. 4 str. 40]
 gi|261754162|ref|ZP_05997871.1| thiamine-binding periplasmic protein [Brucella suis bv. 3 str. 686]
 gi|260154220|gb|EEW89302.1| thiamine-binding periplasmic protein [Brucella suis bv. 4 str. 40]
 gi|261743915|gb|EEY31841.1| thiamine-binding periplasmic protein [Brucella suis bv. 3 str. 686]
          Length = 334

 Score =  327 bits (838), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGES  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGESPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|126741011|ref|ZP_01756694.1| thiamin transporter subunit [Roseobacter sp. SK209-2-6]
 gi|126717937|gb|EBA14656.1| thiamin transporter subunit [Roseobacter sp. SK209-2-6]
          Length = 334

 Score =  326 bits (836), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 209/310 (67%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P LTVYTY+SFV+D G GP +++AFE +C C+LKL+G  DG ALL ++++EG  S AD+V
Sbjct: 30  PELTVYTYDSFVSDWGPGPAVEKAFEAQCGCDLKLVGAGDGAALLARIKLEGARSDADVV 89

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A++TGLFA+  + A    LP+ W+D  F PYD+GY AF+++       P 
Sbjct: 90  LGLDTNLTAAAKETGLFAEHGVSA-DYSLPVAWEDATFAPYDWGYFAFVHNADAAA--PA 146

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F  L  S K  KI+ QDPR+ST GLGLLLW++  YGD +  +W+ ++    TVTKGW+E
Sbjct: 147 DFKALAASDK--KIVIQDPRSSTPGLGLLLWVKAAYGDEATAIWEALSDNVVTVTKGWSE 204

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F EGHY+Q+EVA  L  S QP+LA
Sbjct: 205 AYGMFLEGEADMVLSYTTSPAYHLIAEEDASKAAAAFDEGHYMQVEVAGILAGSDQPELA 264

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVD--ISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           + FM FM+S  FQ I+PTTNWMYP V     +P+ ++ +  P KSL  +A+E    R+  
Sbjct: 265 KSFMAFMVSEEFQSIIPTTNWMYPAVTPAAGLPEGFETLVTPAKSLLLSADEAAAVRDAA 324

Query: 328 ISSWQNAVSR 337
           +S W +A+S+
Sbjct: 325 LSEWLDALSQ 334


>gi|254700412|ref|ZP_05162240.1| thiamine transporter substrate binding subunit [Brucella suis bv. 5
           str. 513]
 gi|261750908|ref|ZP_05994617.1| thiamine-binding periplasmic protein [Brucella suis bv. 5 str. 513]
 gi|294851002|ref|ZP_06791678.1| thiamin/thiamine pyrophosphate ABC transporter [Brucella sp. NVSL
           07-0026]
 gi|261740661|gb|EEY28587.1| thiamine-binding periplasmic protein [Brucella suis bv. 5 str. 513]
 gi|294821645|gb|EFG38641.1| thiamin/thiamine pyrophosphate ABC transporter [Brucella sp. NVSL
           07-0026]
          Length = 334

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|227823772|ref|YP_002827745.1| thiamine transporter substrate binding subunit [Sinorhizobium
           fredii NGR234]
 gi|227342774|gb|ACP26992.1| thiamine ABC transporter periplasmic binding protein [Sinorhizobium
           fredii NGR234]
          Length = 342

 Score =  326 bits (835), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 205/312 (65%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+  LT+YTY SF+ + G G K+ +AFE+ C+C++  +G++DGV LL +L++EGE S AD
Sbjct: 30  AEKTLTIYTYESFITEWGPGAKVAEAFEKTCDCKVNYVGVADGVELLTRLKLEGEGSKAD 89

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +V+G D NL+  A+ TG FA   +D   +K+P  + DD FVPYDYG+ A IYD   +  P
Sbjct: 90  VVVGLDTNLVAEAKATGYFAPHGVDTKDVKVPGGFSDDTFVPYDYGHFAVIYDTETLKNP 149

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ +DPRTST GLGLLLW++ +YGD + + W K+  +  TVT GW
Sbjct: 150 PKSLKELVEGDPAQKIVIEDPRTSTPGLGLLLWVKSVYGDKAGEAWAKLKERVLTVTPGW 209

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++  G D Y AA F+EGHY+QIEVA     +K+P+
Sbjct: 210 SEAYGLFTKGEAPMVLSYTTSPAYHMVAEGTDRYQAAPFAEGHYIQIEVAGLTKNAKEPE 269

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPV--VDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA+ F+ FM    FQ I+PTTNWM PV      +P+ +  +  PQK+    +EE    R 
Sbjct: 270 LARTFLAFMTGSEFQSIIPTTNWMMPVGATKEPLPEAFGKLVNPQKTFLLPSEEVAANRK 329

Query: 326 QWISSWQNAVSR 337
            WI  W  A+S+
Sbjct: 330 AWIDEWLAAMSK 341


>gi|254465007|ref|ZP_05078418.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Rhodobacterales bacterium
           Y4I]
 gi|206685915|gb|EDZ46397.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Rhodobacterales bacterium
           Y4I]
          Length = 325

 Score =  325 bits (834), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 212/310 (68%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P LTVYTY+SFV+D G GP +++AFE  C C+LKL+G  DG ALL ++++EG  S AD+V
Sbjct: 21  PELTVYTYDSFVSDWGPGPAVEKAFEEVCGCDLKLVGAGDGAALLARVKLEGARSDADVV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A++TGLFA+ ++ A +  LP++W D  FVPYD+GY AF+++       P 
Sbjct: 81  LGLDTNLTAAAKETGLFAEHSVSA-EYALPVEWSDATFVPYDWGYFAFVHNADAAA--PA 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F  L  S K  KI+ QDPR+ST GLGLLLW++  YGD + ++WK ++    TVTKGW+E
Sbjct: 138 DFKALAASDK--KIVIQDPRSSTPGLGLLLWVKAAYGDEAPEIWKGLSDNVVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F EGHY+Q+EVA +L  S QP+LA
Sbjct: 196 AYGMFLEGEADMVLSYTTSPAYHLIAEEDGSKAAAAFDEGHYMQVEVAGKLANSDQPELA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             F+ FM+S +FQ I+PTTNWMYP V  +  +P+ ++ +  P+KSL  +  E    R+  
Sbjct: 256 DRFLAFMVSDAFQSIIPTTNWMYPAVTPEGGLPEGFETLIAPEKSLLLSETEAAEVRDAA 315

Query: 328 ISSWQNAVSR 337
           +  W +A+S+
Sbjct: 316 LGEWLDALSQ 325


>gi|256061789|ref|ZP_05451924.1| thiamine transporter substrate binding subunit [Brucella neotomae
           5K33]
 gi|261325792|ref|ZP_05964989.1| thiamine-binding periplasmic protein [Brucella neotomae 5K33]
 gi|261301772|gb|EEY05269.1| thiamine-binding periplasmic protein [Brucella neotomae 5K33]
          Length = 334

 Score =  325 bits (834), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEDDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRILTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|62290628|ref|YP_222421.1| thiamine transporter substrate binding subunit [Brucella abortus
           bv. 1 str. 9-941]
 gi|82700543|ref|YP_415117.1| thiamine transporter substrate binding subunit [Brucella melitensis
           biovar Abortus 2308]
 gi|189024841|ref|YP_001935609.1| thiamine transporter substrate binding subunit [Brucella abortus
           S19]
 gi|254689919|ref|ZP_05153173.1| thiamine transporter substrate binding subunit [Brucella abortus
           bv. 6 str. 870]
 gi|254694411|ref|ZP_05156239.1| thiamine transporter substrate binding subunit [Brucella abortus
           bv. 3 str. Tulya]
 gi|254698068|ref|ZP_05159896.1| thiamine transporter substrate binding subunit [Brucella abortus
           bv. 2 str. 86/8/59]
 gi|254730953|ref|ZP_05189531.1| thiamine transporter substrate binding subunit [Brucella abortus
           bv. 4 str. 292]
 gi|256258173|ref|ZP_05463709.1| thiamine transporter substrate binding subunit [Brucella abortus
           bv. 9 str. C68]
 gi|260547133|ref|ZP_05822871.1| thiamine-binding periplasmic protein [Brucella abortus NCTC 8038]
 gi|260755452|ref|ZP_05867800.1| thiamine ABC transporter, periplasmic binding protein [Brucella
           abortus bv. 6 str. 870]
 gi|260758674|ref|ZP_05871022.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Brucella abortus bv. 4 str. 292]
 gi|260762508|ref|ZP_05874845.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884470|ref|ZP_05896084.1| thiamine-binding periplasmic protein [Brucella abortus bv. 9 str.
           C68]
 gi|261214723|ref|ZP_05929004.1| thiamine ABC transporter, periplasmic binding protein [Brucella
           abortus bv. 3 str. Tulya]
 gi|297249022|ref|ZP_06932730.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophosphate-binding protein [Brucella abortus bv. 5
           str. B3196]
 gi|75496300|sp|Q57BC4|THIB_BRUAB RecName: Full=Thiamine-binding periplasmic protein; Flags:
           Precursor
 gi|123546249|sp|Q2YLW8|THIB_BRUA2 RecName: Full=Thiamine-binding periplasmic protein; Flags:
           Precursor
 gi|62196760|gb|AAX75060.1| ThiB, thiamine-binding periplasmic binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616644|emb|CAJ11726.1| Thiamine ABC transporter periplasmic binding
           protein:Proteobacterial thiamine ABC transporter,
           periplasmic binding protein:Ba [Brucella melitensis
           biovar Abortus 2308]
 gi|189020413|gb|ACD73135.1| ThiB, thiamine-binding periplasmic binding protein [Brucella
           abortus S19]
 gi|260095498|gb|EEW79376.1| thiamine-binding periplasmic protein [Brucella abortus NCTC 8038]
 gi|260668992|gb|EEX55932.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Brucella abortus bv. 4 str. 292]
 gi|260672934|gb|EEX59755.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675560|gb|EEX62381.1| thiamine ABC transporter, periplasmic binding protein [Brucella
           abortus bv. 6 str. 870]
 gi|260873998|gb|EEX81067.1| thiamine-binding periplasmic protein [Brucella abortus bv. 9 str.
           C68]
 gi|260916330|gb|EEX83191.1| thiamine ABC transporter, periplasmic binding protein [Brucella
           abortus bv. 3 str. Tulya]
 gi|297174155|gb|EFH33512.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophosphate-binding protein [Brucella abortus bv. 5
           str. B3196]
          Length = 334

 Score =  325 bits (833), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDLIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|237816130|ref|ZP_04595126.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Brucella abortus str. 2308
           A]
 gi|237788793|gb|EEP63005.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Brucella abortus str. 2308
           A]
          Length = 329

 Score =  325 bits (833), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 18  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 78  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 138 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 198 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 257

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 258 LAKKFLAFMTGPGFQDLIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 317

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 318 LWVNEWLAATSR 329


>gi|84685940|ref|ZP_01013836.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84666033|gb|EAQ12507.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 332

 Score =  325 bits (833), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 142/312 (45%), Positives = 217/312 (69%), Gaps = 4/312 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+  LTVYTY+SFVA+ G GP I++AFE +C+C+L+ + + DG  +L++LR+EG  + AD
Sbjct: 23  AQDTLTVYTYDSFVAEWGPGPVIEKAFEARCDCDLEFVAVGDGAEILSRLRLEGARTEAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG D NL + AR+T LFA   I++ QL LPI+W D++F+P+D+GY AFIYDK ++  P
Sbjct: 83  VVLGLDENLAEAARETALFAPHGIESPQLDLPIEWQDELFLPFDWGYFAFIYDKTKVDNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +F+EL +S     I+ QDPR+ST GLGL+LW++ +YG+ +   W+++  +  TVTKGW
Sbjct: 143 PTSFEELADSD--LSILIQDPRSSTPGLGLILWVKAVYGEEAGAYWERLNDQIVTVTKGW 200

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F++GE+D VLSY+TSP ++L+    D   AA F +GHY+QIE+A ++  ++Q +
Sbjct: 201 SEAYGMFVEGEADMVLSYTTSPAYHLIAEDDDTKAAAAFDDGHYMQIEIAGKVASTEQGE 260

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA  FM FM++  FQ  +PTTNWMYP  +    +PD ++ +  P+ +L +   E    R+
Sbjct: 261 LADMFMDFMLTDGFQSAIPTTNWMYPAKIPTEGLPDGFETLHEPESALIYLGAEAEAIRD 320

Query: 326 QWISSWQNAVSR 337
             I  W+ A +R
Sbjct: 321 DAIEEWRAASTR 332


>gi|17986568|ref|NP_539202.1| thiamine transporter substrate binding subunit [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982177|gb|AAL51466.1| thiamine-binding periplasmic protein precursor [Brucella melitensis
           bv. 1 str. 16M]
          Length = 335

 Score =  324 bits (831), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 24  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 83

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 84  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 143

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 144 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 203

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    + Y A  + EG+YLQIE+AAQ     +  
Sbjct: 204 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTNRYKALAYPEGNYLQIELAAQTTTGAKNP 263

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 264 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 323

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 324 LWVNEWLAATSR 335


>gi|256160464|ref|ZP_05458153.1| thiamine transporter substrate binding subunit [Brucella ceti
           M490/95/1]
 gi|256255671|ref|ZP_05461207.1| thiamine transporter substrate binding subunit [Brucella ceti
           B1/94]
 gi|261222876|ref|ZP_05937157.1| thiamine-binding periplasmic protein [Brucella ceti B1/94]
 gi|265998836|ref|ZP_06111393.1| thiamine-binding periplasmic protein [Brucella ceti M490/95/1]
 gi|260921460|gb|EEX88113.1| thiamine-binding periplasmic protein [Brucella ceti B1/94]
 gi|262553525|gb|EEZ09294.1| thiamine-binding periplasmic protein [Brucella ceti M490/95/1]
          Length = 334

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P    A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAASDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|161619683|ref|YP_001593570.1| thiamine transporter substrate binding subunit [Brucella canis ATCC
           23365]
 gi|161336494|gb|ABX62799.1| thiamin/thiamin pyrophosphate ABC transporter binding protein
           [Brucella canis ATCC 23365]
          Length = 334

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT  W
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPSW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGES  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGESPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|15967005|ref|NP_387358.1| thiamine transporter substrate binding subunit [Sinorhizobium
           meliloti 1021]
 gi|307302473|ref|ZP_07582230.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Sinorhizobium meliloti BL225C]
 gi|307316197|ref|ZP_07595641.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Sinorhizobium meliloti AK83]
 gi|15076278|emb|CAC47831.1| Thiamine-binding periplasmic protein precursor [Sinorhizobium
           meliloti 1021]
 gi|306898037|gb|EFN28779.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Sinorhizobium meliloti AK83]
 gi|306903143|gb|EFN33733.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Sinorhizobium meliloti BL225C]
          Length = 342

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 144/309 (46%), Positives = 203/309 (65%), Gaps = 2/309 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTVYTY SF+ + G G K+ +AFE+ C+C++  +G++DGV LL +L++EG+ S ADIVL
Sbjct: 33  TLTVYTYESFITEWGPGAKVAEAFEKTCDCKVDYVGVADGVELLTRLKLEGQGSKADIVL 92

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G D NL+  A+ TG FA    D + +K+P  + DD F+PYDYG+ A +YD   +  PPK+
Sbjct: 93  GLDTNLVAEAKATGFFAPHGADTASVKVPGGFSDDTFIPYDYGHFAVVYDTEALKDPPKS 152

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
             EL+      KI+ +DPRTST GLGLLLW++ +YGD + + W K+  +  TVT GW+E+
Sbjct: 153 LKELVEGDPSQKIVIEDPRTSTPGLGLLLWVKSVYGDKAGEAWAKLKDRVLTVTPGWSEA 212

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           YG F KGE+  VLSY+TSP ++++    + Y AA F+EGHY+QIEVAA    +K P+LA+
Sbjct: 213 YGLFTKGEAPMVLSYTTSPAYHMVAENTERYQAAPFAEGHYIQIEVAALTKNAKDPELAR 272

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
            F+ FMI P FQ I+PTTNWM PV      +P+ +  +  PQK+    + E    R  WI
Sbjct: 273 NFLTFMIGPEFQSIIPTTNWMMPVTATKEPLPEAFGKLVDPQKTFLIPSGEVAASRKAWI 332

Query: 329 SSWQNAVSR 337
             W  A+SR
Sbjct: 333 DEWLAAMSR 341


>gi|225628321|ref|ZP_03786355.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Brucella ceti str. Cudo]
 gi|254708381|ref|ZP_05170209.1| thiamine transporter substrate binding subunit [Brucella
           pinnipedialis M163/99/10]
 gi|254708765|ref|ZP_05170576.1| thiamine transporter substrate binding subunit [Brucella
           pinnipedialis B2/94]
 gi|254714610|ref|ZP_05176421.1| thiamine transporter substrate binding subunit [Brucella ceti
           M644/93/1]
 gi|254717508|ref|ZP_05179319.1| thiamine transporter substrate binding subunit [Brucella ceti
           M13/05/1]
 gi|256030291|ref|ZP_05443905.1| thiamine transporter substrate binding subunit [Brucella
           pinnipedialis M292/94/1]
 gi|260167965|ref|ZP_05754776.1| thiamine transporter substrate binding subunit [Brucella sp. F5/99]
 gi|261219340|ref|ZP_05933621.1| thiamine-binding periplasmic protein [Brucella ceti M13/05/1]
 gi|261315881|ref|ZP_05955078.1| thiamine-binding periplasmic protein [Brucella pinnipedialis
           M163/99/10]
 gi|261316257|ref|ZP_05955454.1| thiamine-binding periplasmic protein [Brucella pinnipedialis B2/94]
 gi|261322401|ref|ZP_05961598.1| thiamine-binding periplasmic protein [Brucella ceti M644/93/1]
 gi|261757406|ref|ZP_06001115.1| thiamine-binding periplasmic protein [Brucella sp. F5/99]
 gi|265987322|ref|ZP_06099879.1| thiamine-binding periplasmic protein [Brucella pinnipedialis
           M292/94/1]
 gi|225616167|gb|EEH13215.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Brucella ceti str. Cudo]
 gi|260924429|gb|EEX90997.1| thiamine-binding periplasmic protein [Brucella ceti M13/05/1]
 gi|261295091|gb|EEX98587.1| thiamine-binding periplasmic protein [Brucella ceti M644/93/1]
 gi|261295480|gb|EEX98976.1| thiamine-binding periplasmic protein [Brucella pinnipedialis B2/94]
 gi|261304907|gb|EEY08404.1| thiamine-binding periplasmic protein [Brucella pinnipedialis
           M163/99/10]
 gi|261737390|gb|EEY25386.1| thiamine-binding periplasmic protein [Brucella sp. F5/99]
 gi|264659519|gb|EEZ29780.1| thiamine-binding periplasmic protein [Brucella pinnipedialis
           M292/94/1]
          Length = 334

 Score =  324 bits (831), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P    A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAASDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|254719753|ref|ZP_05181564.1| thiamine transporter substrate binding subunit [Brucella sp. 83/13]
 gi|265984770|ref|ZP_06097505.1| thiamine-binding periplasmic protein [Brucella sp. 83/13]
 gi|306839448|ref|ZP_07472256.1| thiamine transporter substrate binding subunit [Brucella sp. NF
           2653]
 gi|264663362|gb|EEZ33623.1| thiamine-binding periplasmic protein [Brucella sp. 83/13]
 gi|306405393|gb|EFM61664.1| thiamine transporter substrate binding subunit [Brucella sp. NF
           2653]
          Length = 334

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGNKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+A Q     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMIVEKTDRYKALAYPEGNYLQIELATQTTTGTKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|225853208|ref|YP_002733441.1| thiamine transporter substrate binding subunit [Brucella melitensis
           ATCC 23457]
 gi|256045361|ref|ZP_05448255.1| thiamine transporter substrate binding subunit [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256114325|ref|ZP_05455063.1| thiamine transporter substrate binding subunit [Brucella melitensis
           bv. 3 str. Ether]
 gi|256263301|ref|ZP_05465833.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 2
           str. 63/9]
 gi|260565746|ref|ZP_05836229.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 1
           str. 16M]
 gi|265991787|ref|ZP_06104344.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|265995627|ref|ZP_06108184.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 3
           str. Ether]
 gi|143587125|sp|Q8YJ02|THIB_BRUME RecName: Full=Thiamine-binding periplasmic protein; Flags:
           Precursor
 gi|225641573|gb|ACO01487.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Brucella melitensis ATCC
           23457]
 gi|260151119|gb|EEW86214.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 1
           str. 16M]
 gi|262766911|gb|EEZ12529.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 3
           str. Ether]
 gi|263002743|gb|EEZ15146.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 1
           str. Rev.1]
 gi|263093270|gb|EEZ17367.1| thiamine-binding periplasmic protein [Brucella melitensis bv. 2
           str. 63/9]
 gi|326409767|gb|ADZ66832.1| thiamine transporter substrate binding subunit [Brucella melitensis
           M28]
 gi|326539481|gb|ADZ87696.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Brucella melitensis M5-90]
          Length = 334

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 209/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    + Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTNRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|163845335|ref|YP_001622990.1| thiamine transporter substrate binding subunit [Brucella suis ATCC
           23445]
 gi|163676058|gb|ABY40168.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Brucella suis ATCC 23445]
          Length = 334

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPR +T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRPATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|256370164|ref|YP_003107675.1| thiamine ABC transporter, thiamine-binding periplasmic binding
           protein [Brucella microti CCM 4915]
 gi|256000327|gb|ACU48726.1| thiamine ABC transporter, thiamine-binding periplasmic binding
           protein [Brucella microti CCM 4915]
          Length = 334

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 208/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV++ G GPK+K+ FE++C+CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSEWGPGPKVKENFEKECDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPR +T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRIATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPGFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|259417481|ref|ZP_05741400.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophospate-binding protein [Silicibacter sp.
           TrichCH4B]
 gi|259346387|gb|EEW58201.1| thiamine/thiamin pyrophosphate ABC transporter, thiamine/thiamin
           pyrophospate-binding protein [Silicibacter sp.
           TrichCH4B]
          Length = 325

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 211/310 (68%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV++ G GP ++ AFE  C+C+LK +G  DG ALL ++++EGE S ADIV
Sbjct: 21  PQLVVYTYDSFVSEWGPGPAVEAAFEATCDCDLKFVGAGDGAALLARIKLEGERSDADIV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A++TGLFA  ++ A++  LPI+W D  FVPYD+GY AF+++       P 
Sbjct: 81  LGLDTNLTAAAKETGLFAPMSV-AAEYALPIEWKDTHFVPYDWGYFAFVHNAD--ADVPS 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF  L  S    KI+ QDPR+ST GLGLL+W++  Y D +  +W+ ++    TVTKGW+E
Sbjct: 138 NFKALGESDV--KIVIQDPRSSTPGLGLLMWVKAAYADEAPAIWESLSDNIVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+    D   AALF EGHY+Q+EVA +L  S QP+LA
Sbjct: 196 AYGLFLEGEADMVLSYTTSPAYHLIAENDDSKAAALFDEGHYMQVEVAGKLAASDQPELA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+QFM+S +FQ ++PTTNWMYP V  S  +P  ++ +  P+KSL    EE    R + 
Sbjct: 256 DQFLQFMVSDAFQSVIPTTNWMYPAVTPSEGLPQGFETLVSPEKSLLLPEEEAASIRAEA 315

Query: 328 ISSWQNAVSR 337
           +  W+ A+S+
Sbjct: 316 LDEWRAALSQ 325


>gi|110635588|ref|YP_675796.1| thiamine transporter substrate binding subunit [Mesorhizobium sp.
           BNC1]
 gi|110286572|gb|ABG64631.1| thiamine ABC transporter, periplasmic binding protein
           [Chelativorans sp. BNC1]
          Length = 332

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 152/312 (48%), Positives = 201/312 (64%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+  LTVYTY SF A+ G GP ++ AFE +C C+L+ + ++DGVALLN+LR+EGE + AD
Sbjct: 21  AQEKLTVYTYESFTAEWGPGPVVETAFEAECGCDLEFVSVADGVALLNRLRLEGEGTEAD 80

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   A++TGLFA   I+   + +P  + DD+FVPYDYGY AF+YD + +  P
Sbjct: 81  IVLGLDTNLTHEAKETGLFAPHGIELGNVDVPGGFQDDVFVPYDYGYFAFVYDTQALENP 140

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +  +L+ S    KI  QDPRTST GLGLLLWI+ +Y D++A  W K+     TVT GW
Sbjct: 141 PTSLRDLVESGSDLKIAIQDPRTSTPGLGLLLWIKAVYKDDAADAWGKLKNNVLTVTPGW 200

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +ESYG F  GE   VLSY+TSP ++ +  G   Y AA FSEGHYLQIEVAA+  R+K   
Sbjct: 201 SESYGLFTSGEVPMVLSYTTSPAYHEIAEGTQRYKAAAFSEGHYLQIEVAARTARAKDNP 260

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMP--DVYQAIRIPQKSLRFNAEETTRYRN 325
           LA +F+ FM  P FQ  +P  NWM+P    S P   V++ +  P  +L F+ EE    R 
Sbjct: 261 LAAQFLSFMTGPGFQDAIPEKNWMFPAGKTSEPLDPVFRQLVQPATTLLFSPEEVAENRK 320

Query: 326 QWISSWQNAVSR 337
            W+  W   +SR
Sbjct: 321 AWVDEWLAVMSR 332


>gi|297180178|gb|ADI16400.1| ABC-type thiamine transport system, periplasmic component
           [uncultured bacterium HF130_12L15]
          Length = 337

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 145/311 (46%), Positives = 202/311 (64%), Gaps = 2/311 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
            K  LTVYTY SF AD G GP++++AFE +C C+L+ + ++DGVALLN+L++EG+ + AD
Sbjct: 26  GKDTLTVYTYESFTADWGPGPQVEKAFEAECGCDLEFVSVADGVALLNRLKLEGDQTEAD 85

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   A++TGLF+   I   ++++P  W DD+F+P+DYGY A IYD + I  P
Sbjct: 86  IVLGLDTNLTADAKETGLFSPHGIKTPKVEVPGGWTDDVFLPFDYGYFAVIYDTQTIETP 145

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +  EL+      KI+ QDPRTST GLGLLLW++ +YGD +   W K+  +  TVT GW
Sbjct: 146 PSSLKELVEGDPEQKIVIQDPRTSTPGLGLLLWMKAVYGDGAGDAWAKLKDRVLTVTPGW 205

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F  GE+  VLSY+TSP ++++    + Y AA FSEGHYLQ+EVA    R     
Sbjct: 206 SEAYGLFTSGEAPMVLSYTTSPAYHMIAEDTERYQAAQFSEGHYLQVEVAGITARGADNP 265

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDISMP--DVYQAIRIPQKSLRFNAEETTRYRN 325
           LA+EFM+FM  P FQ  +P  NWMYP  + S P    +  +  P ++L F+ EE    R 
Sbjct: 266 LAKEFMEFMTGPGFQDAIPEANWMYPAGETSEPLDPAFDKLVEPDETLVFSPEEVADNRK 325

Query: 326 QWISSWQNAVS 336
            W+  W + +S
Sbjct: 326 AWVDEWLSVMS 336


>gi|148559754|ref|YP_001259604.1| thiamine transporter substrate binding subunit [Brucella ovis ATCC
           25840]
 gi|148371011|gb|ABQ60990.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Brucella ovis ATCC 25840]
          Length = 334

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 207/312 (66%), Gaps = 2/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LT+YTY+SFV+  G GPK+K+ FE++ +CE+  +  +DGVALLN+L++EG  +AAD
Sbjct: 23  AKDKLTIYTYDSFVSKWGPGPKVKENFEKESDCEVNFVASADGVALLNRLKLEGSKTAAD 82

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   AR +G FA S ID + +K+P  + DDIFVPYDYGY A +YD  ++  P
Sbjct: 83  IVLGLDTNLTTEARASGFFAPSGIDQTNVKVPGNFKDDIFVPYDYGYFAVVYDSEKLPNP 142

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+      KI+ QDPRT+T GLG+LLW++ +YGD +   W+K+  +  TVT GW
Sbjct: 143 PKSLKELVEGDPAQKIVLQDPRTATPGLGMLLWMKSVYGDEAGAAWQKLQKRVLTVTPGW 202

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    D Y A  + EG+YLQIE+AAQ     +  
Sbjct: 203 SEAYGLFTKGEAPMVLSYTTSPAYHMVVEKTDRYKALAYPEGNYLQIELAAQTTTGAKNP 262

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA++F+ FM  P FQ ++P TNWM+P    S  +P  + A+  P+K+L     E  + R 
Sbjct: 263 LAKKFLAFMTGPRFQDVIPETNWMFPAGKTSKPLPAAFDALPKPEKTLLIPPYEVAKNRR 322

Query: 326 QWISSWQNAVSR 337
            W++ W  A SR
Sbjct: 323 LWVNEWLAATSR 334


>gi|90420280|ref|ZP_01228188.1| periplasmic substrate-binding protein, ABC-type thiamine
           transporter [Aurantimonas manganoxydans SI85-9A1]
 gi|90335614|gb|EAS49364.1| periplasmic substrate-binding protein, ABC-type thiamine
           transporter [Aurantimonas manganoxydans SI85-9A1]
          Length = 342

 Score =  320 bits (821), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 146/310 (47%), Positives = 203/310 (65%), Gaps = 1/310 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY SF  + G GPKI+  FE  CNC+L+ +GL DGVA+LN+L++EG ++ AD+
Sbjct: 33  KPVLTVYTYESFTPEWGPGPKIEAGFEAVCNCDLQFVGLEDGVAILNRLKLEGPSTEADV 92

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG   +LI  A+ TG+FA S  D S L +P  + DDIFVPYDY YLAF+YD   I +PP
Sbjct: 93  VLGLTTDLIPEAKATGMFAPSGADLSGLDVPTGFSDDIFVPYDYSYLAFVYDSEMIAEPP 152

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            + D+L+N     KI  +D RTST GLG++LW++KIYGD +A  W++++ +  TVT GW+
Sbjct: 153 ASLDDLVNGDPEVKIAIEDARTSTPGLGMMLWMKKIYGDEAAAKWEQLSKRILTVTPGWS 212

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG F  GE   VLSY+TSP ++++    D Y AA F+EGHYLQIEVAA L  ++  +L
Sbjct: 213 EAYGLFTSGEVPMVLSYTTSPAYHMIEEDTDRYQAAAFAEGHYLQIEVAAMLKTTETAEL 272

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           A  F+ +M++   Q ++PTTNW  PV   I +P+ +  +   +  L  + E     R  W
Sbjct: 273 ATRFLDYMLTAEVQSLIPTTNWTLPVAGGIDLPEAFGRLVQVETPLMIDPETVAANRKAW 332

Query: 328 ISSWQNAVSR 337
              W  A+ R
Sbjct: 333 TQEWLEAIGR 342


>gi|126725328|ref|ZP_01741170.1| thiamin transporter subunit [Rhodobacterales bacterium HTCC2150]
 gi|126704532|gb|EBA03623.1| thiamin transporter subunit [Rhodobacterales bacterium HTCC2150]
          Length = 316

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/311 (49%), Positives = 209/311 (67%), Gaps = 7/311 (2%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
            PVLTVYTY+SFV+D G GP++K AFE  C CEL L+G+ DG ALL+++R+EG+N+ ADI
Sbjct: 11  APVLTVYTYDSFVSDWGPGPQVKAAFEAVCACELNLVGVEDGAALLSRVRLEGKNTDADI 70

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG D NL   A +TGLFA  ++ A    LPI+W D  FVP+D+GY +FI +       P
Sbjct: 71  VLGLDTNLTAAANETGLFAPHSVTA-DYALPIEWTDTTFVPFDWGYFSFIANAGA--DFP 127

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            NF EL  S     I+ QDPRTST GLGLLLW++  YGD +  +W  ++    TVTKGW+
Sbjct: 128 ANFAELAASDT--SIVIQDPRTSTPGLGLLLWVKAAYGDEALAIWADLSDNIVTVTKGWS 185

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FL+GE+D VLSY+TSP ++L+       VA  F EGHY QIEVAA+L  + Q +L
Sbjct: 186 EAYGLFLEGEADMVLSYTTSPAYHLIAEDDASKVAVSFDEGHYAQIEVAAKLASTDQSEL 245

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQ 326
           A +F+ FM+S +FQ I+PTTNWMYP V  +  +PD ++ +  P+ +L  +A      R++
Sbjct: 246 ADQFLAFMVSDAFQNIIPTTNWMYPAVTPANGLPDGFETLITPKSTLLLDAAMAGEMRDK 305

Query: 327 WISSWQNAVSR 337
            ++ W  A+SR
Sbjct: 306 ALTEWLGALSR 316


>gi|254474360|ref|ZP_05087746.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Ruegeria sp. R11]
 gi|214028603|gb|EEB69438.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Ruegeria sp. R11]
          Length = 340

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 207/310 (66%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV+D G GP +++AFE +C C+LKL+G  DG ALL ++++EG  S AD+V
Sbjct: 36  PELIVYTYDSFVSDWGPGPAVEKAFEAECGCDLKLVGAGDGAALLARIKLEGARSDADVV 95

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A+ TGLFA   + A    LP  W+D  F PYD+GY AF+++       PK
Sbjct: 96  LGLDTNLTSAAKATGLFADHAVSA-DYALPFAWEDTTFAPYDWGYFAFVHNADATA--PK 152

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF EL  S    KI+ QDPR+ST GLGLL+W++  YGD + ++W+ +A    TVTKGW+E
Sbjct: 153 NFGELAASD--LKIVIQDPRSSTPGLGLLMWVKAAYGDKAPEIWEGLADNVLTVTKGWSE 210

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F EGHY+Q+EVA +L  + QP+LA
Sbjct: 211 AYGLFLEGEADMVLSYTTSPAYHLIAEEDASKAAAAFDEGHYMQVEVAGKLAATDQPELA 270

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+ FM+S +FQ I+PTTNWMYP V  +  +P+ ++ +  P+KSL     +    R+  
Sbjct: 271 DQFLAFMVSDAFQSIIPTTNWMYPAVTPAEGLPEGFETLISPEKSLLLTENDAADLRDMA 330

Query: 328 ISSWQNAVSR 337
           +  W +A+SR
Sbjct: 331 LEEWLSALSR 340


>gi|163743338|ref|ZP_02150718.1| thiamin transporter subunit [Phaeobacter gallaeciensis 2.10]
 gi|161383332|gb|EDQ07721.1| thiamin transporter subunit [Phaeobacter gallaeciensis 2.10]
          Length = 329

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 206/310 (66%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV+D G GP +++AFE  C C+LKL+G  DG ALL ++++EG  S AD+V
Sbjct: 25  PELIVYTYDSFVSDWGPGPAVEKAFEATCGCDLKLVGAGDGAALLARVKLEGARSDADVV 84

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A+ TGLFA   + A    LP  W+D  F PYD+GY AF++  +     P 
Sbjct: 85  LGLDTNLTAAAKATGLFADHAVSA-DYALPFAWEDATFAPYDWGYFAFVH--KAGMDAPA 141

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF EL  S    KI+ QDPR+ST GLGLL+W++  +GD + ++W  +A    TVTKGW+E
Sbjct: 142 NFAELAKSD--LKIVIQDPRSSTPGLGLLMWVKAAHGDKAPEIWDGLADNVLTVTKGWSE 199

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+    D   AA+F EGHY+Q+EVA +L  S QP+LA
Sbjct: 200 AYGLFLEGEADMVLSYTTSPAYHLIAEEDDSKAAAVFDEGHYMQVEVAGKLANSDQPELA 259

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+ FM+S +FQ ++PTTNWMYP V  +  +P  ++ +  P+KSL  + +E    R+  
Sbjct: 260 DQFLAFMVSDAFQSVIPTTNWMYPAVTPADGLPKGFETLVAPEKSLLLSEDEAAALRDVA 319

Query: 328 ISSWQNAVSR 337
           +  W  A+SR
Sbjct: 320 LDEWLTALSR 329


>gi|163737886|ref|ZP_02145302.1| thiamin transporter substrate binding subunit [Phaeobacter
           gallaeciensis BS107]
 gi|161388502|gb|EDQ12855.1| thiamin transporter substrate binding subunit [Phaeobacter
           gallaeciensis BS107]
          Length = 325

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 147/310 (47%), Positives = 206/310 (66%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV+D G GP +++AFE  C C+LKL+G  DG ALL ++++EG  S AD+V
Sbjct: 21  PELIVYTYDSFVSDWGPGPAVEKAFEATCGCDLKLVGAGDGAALLARVKLEGARSDADVV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A+ TGLFA   + A    LP  W+D  F PYD+GY AF++  +     P 
Sbjct: 81  LGLDTNLTAAAKATGLFADHAVSA-DYALPFAWEDATFAPYDWGYFAFVH--KAGMGAPA 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF EL  S    KI+ QDPR+ST GLGLL+W++  +GD + ++W  +A    TVTKGW+E
Sbjct: 138 NFAELAESDL--KIVIQDPRSSTPGLGLLMWVKAAHGDKAPEIWDGLADNVLTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+    D   AA+F EGHY+Q+EVA +L  S QP+LA
Sbjct: 196 AYGLFLEGEADMVLSYTTSPAYHLIAEEDDSKAAAVFDEGHYMQVEVAGKLANSDQPELA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+ FM+S +FQ ++PTTNWMYP V  +  +P  ++ +  P+KSL  + +E    R+  
Sbjct: 256 DQFLAFMVSDAFQSVIPTTNWMYPAVTPADGLPKGFETLVAPEKSLLLSEDEAAALRDVA 315

Query: 328 ISSWQNAVSR 337
           +  W  A+SR
Sbjct: 316 LDEWLTALSR 325


>gi|86136879|ref|ZP_01055457.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Roseobacter sp. MED193]
 gi|85826203|gb|EAQ46400.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Roseobacter sp. MED193]
          Length = 326

 Score =  317 bits (813), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 150/310 (48%), Positives = 210/310 (67%), Gaps = 6/310 (1%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P LTVYTY+SFV+D G GP +++AFE +C C+LKLIG  DG ALL ++++EG  S AD+V
Sbjct: 21  PELTVYTYDSFVSDWGPGPAVEKAFEAQCGCDLKLIGAGDGAALLARVKLEGARSQADVV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A  TGLFA+  + A +  LP+ W+D  F PYD+GY AF+++   ++ P  
Sbjct: 81  LGLDTNLTAAAAATGLFAEHGVQA-EYSLPVSWEDAYFAPYDWGYFAFVHNADAVSVP-T 138

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F  L  S    KI+ QDPR+ST GLGLL+W++  YGD +  +W  +A    TVTKGW+E
Sbjct: 139 DFKALGASDV--KIVIQDPRSSTPGLGLLMWVKAAYGDEAPAIWADLADNVVTVTKGWSE 196

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F+EGHYLQ+EVA  +  S QP+LA
Sbjct: 197 AYGLFLEGEADMVLSYTTSPAYHLIAEEDGSKAAAAFAEGHYLQVEVAGIMAASDQPELA 256

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           ++FM FM+S  FQ I+PTTNWMYP V  S  +P+ ++ +  P KSL  +A+E    R+  
Sbjct: 257 KDFMNFMVSEEFQSIIPTTNWMYPAVTPSAGLPEGFETLITPAKSLLLSADEAAALRDGA 316

Query: 328 ISSWQNAVSR 337
           +  W +A+S+
Sbjct: 317 LGEWLDALSQ 326


>gi|83952593|ref|ZP_00961324.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Roseovarius nubinhibens ISM]
 gi|83836266|gb|EAP75564.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Roseovarius nubinhibens ISM]
          Length = 328

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 153/324 (47%), Positives = 211/324 (65%), Gaps = 12/324 (3%)

Query: 21  CTLDGLPAK-----PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
           C    LP       P LTVYTY+SFV+D G GPKI+ AFE  C C+L L+G+ DG ALL 
Sbjct: 10  CLGGALPGAVIADTPELTVYTYDSFVSDWGPGPKIEAAFEESCGCDLNLVGIEDGAALLA 69

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYL 135
           ++R+EG +S AD+VLG D NL+  A +TGLFA   + A +  LPI W+D  F+PYD+GY 
Sbjct: 70  RVRLEGAHSEADVVLGIDTNLMAAAAETGLFAPHEVSA-EYDLPIAWEDASFLPYDWGYF 128

Query: 136 AFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK 195
           AF++++      P +F  L  S    KI+ QDPR+ST GLGLL W++  YGD +  +W+ 
Sbjct: 129 AFVHNEGFAA--PGDFRALAESDT--KIVIQDPRSSTPGLGLLYWVKSAYGDEAPAIWQG 184

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
           ++    TVTKGW+E+YG FL+GE+D VLSY+TSP ++L+        AALF EGHY+Q+E
Sbjct: 185 LSDNIVTVTKGWSEAYGLFLEGEADMVLSYTTSPAYHLIAEEDASKAAALFDEGHYMQVE 244

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSL 313
           VA  L  S QP LA++F+ FM+S + Q ILPTTNWMYP V  +  +P  ++ +  P+K+L
Sbjct: 245 VAGMLKGSDQPDLARQFLAFMVSDAAQSILPTTNWMYPAVTPEAGLPKGFETLTQPEKAL 304

Query: 314 RFNAEETTRYRNQWISSWQNAVSR 337
            + A+E    R   +  W  A+SR
Sbjct: 305 FYTADEAEALRKPALDEWLTALSR 328


>gi|152997475|ref|YP_001342310.1| thiamine ABC transporter periplasmic-binding protein [Marinomonas
           sp. MWYL1]
 gi|150838399|gb|ABR72375.1| thiamine ABC transporter, periplasmic binding protein [Marinomonas
           sp. MWYL1]
          Length = 337

 Score =  315 bits (806), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 145/336 (43%), Positives = 219/336 (65%), Gaps = 10/336 (2%)

Query: 4   FARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
           F+  VV + ++   ++  T         L VYTY++F +D G GPKIK  FE++C CE+ 
Sbjct: 10  FSAAVVSLGVVLSPVALAT-------ETLNVYTYDAFASDWGPGPKIKANFEKECACEVN 62

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD 123
            + L   V +L++ ++EG++S AD++LG D NL++ A++TGL A  ++D S + +   W 
Sbjct: 63  FVALDSSVGILSRAQLEGKSSQADVLLGLDLNLMEAAKQTGLLADHSVDTSAVTIAGGWS 122

Query: 124 DDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
           D IFVP+D G+ AFIY+   +  PP +  E++++ +  ++IYQDPRTST GLGLLLW++ 
Sbjct: 123 DKIFVPFDQGHFAFIYNSETLQNPPASLKEVVDN-QDLRVIYQDPRTSTPGLGLLLWMKS 181

Query: 184 IYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
           +YG+N+   W+++A+ T TVTKGW++SY  FLKGE+D VLSY+TSP ++++  G D Y A
Sbjct: 182 VYGENATDAWERLASHTVTVTKGWSDSYSLFLKGEADVVLSYTTSPAYHIVAEGDDKYKA 241

Query: 244 ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV--DISMPD 301
           A  +EG Y QIEVAA +  +  P LA+ FMQF++ P FQ  + T NWM PVV  D  +P 
Sbjct: 242 ATATEGLYPQIEVAAMMKDAPNPALAKRFMQFILQPGFQSTVATGNWMLPVVKLDEKLPA 301

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            + +   P KSL   A++  ++R  WI  W NA +R
Sbjct: 302 AFDSALKPVKSLVLPAKDVAQHRKAWIDEWLNATTR 337


>gi|83953181|ref|ZP_00961903.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83842149|gb|EAP81317.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 325

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/310 (47%), Positives = 210/310 (67%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFVA+ G GP I+ AFE +C C+LK +G+ DG ALL +L++EG  S AD+V
Sbjct: 21  PELVVYTYDSFVAEWGPGPVIEAAFEAECACDLKFVGMGDGAALLARLKLEGARSDADLV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D +LI  A++TGLFA + ++A    LP+ W+DD F PYD+GY AF+++      PP 
Sbjct: 81  LGLDTSLIAAAKETGLFAPATVNA-DYDLPVTWEDDSFAPYDWGYFAFVHNVD--LTPPA 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF  L +S    KI+ QDPR+ST GLGLL+W++  YGD +  +W+ +A    TVTKGW+E
Sbjct: 138 NFRALADSDL--KIVIQDPRSSTPGLGLLMWVKDAYGDEAPAIWEGLADNVVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F EGHY+QIEV  +L  S QP+LA
Sbjct: 196 AYGLFLEGEADMVLSYTTSPAYHLIAEEDATKAAAAFDEGHYMQIEVVGKLAGSDQPELA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDI--SMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +FMQFM+S + Q +LPTTNWMYP V     +P+ ++ +  P K+L    ++    R + 
Sbjct: 256 DQFMQFMVSDAAQSVLPTTNWMYPAVTPQGGLPEGFEQLIEPGKALLIPNDDVPALREEA 315

Query: 328 ISSWQNAVSR 337
           ++ W +A+S+
Sbjct: 316 LAEWLSALSQ 325


>gi|83942126|ref|ZP_00954588.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Sulfitobacter sp. EE-36]
 gi|83847946|gb|EAP85821.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Sulfitobacter sp. EE-36]
          Length = 325

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 148/310 (47%), Positives = 210/310 (67%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFVA+ G GP I+ AFE +C C+LK +G+ DG ALL +L++EG  S AD+V
Sbjct: 21  PELVVYTYDSFVAEWGPGPVIEAAFEAECACDLKFVGMGDGAALLARLKLEGARSDADLV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D +LI  A++TGLFA + ++A    LP+ W+DD F PYD+GY AF+++      PP 
Sbjct: 81  LGLDTSLIAGAKETGLFAPATVNA-DYDLPVTWEDDSFAPYDWGYFAFVHNAD--LTPPA 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF  L +S    KI+ QDPR+ST GLGLL+W++  YGD +  +W+ +A    TVTKGW+E
Sbjct: 138 NFRALADSDL--KIVIQDPRSSTPGLGLLMWVKDAYGDEAPAIWEGLADNVVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F EGHY+QIEV  +L  S QP+LA
Sbjct: 196 AYGLFLEGEADMVLSYTTSPAYHLIAEEDATKAAAAFDEGHYMQIEVVGKLAGSDQPELA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDI--SMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +FMQFM+S + Q +LPTTNWMYP V     +P+ ++ +  P K+L    ++    R + 
Sbjct: 256 DQFMQFMVSDAAQSVLPTTNWMYPAVTPQGGLPEGFEQLIEPGKALLIPNDDVPALREEA 315

Query: 328 ISSWQNAVSR 337
           ++ W +A+S+
Sbjct: 316 LAEWLSALSQ 325


>gi|163745232|ref|ZP_02152592.1| thiamin transporter substrate binding subunit [Oceanibulbus
           indolifex HEL-45]
 gi|161382050|gb|EDQ06459.1| thiamin transporter substrate binding subunit [Oceanibulbus
           indolifex HEL-45]
          Length = 325

 Score =  313 bits (802), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 148/310 (47%), Positives = 209/310 (67%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P LTVYTY+SFV + G GP I++ FE +C C+LK +G+ DG ALL +L++EG  S ADIV
Sbjct: 21  PELTVYTYDSFVTEWGPGPAIEEGFEAQCGCDLKFVGMGDGAALLARLKLEGARSDADIV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D +L+  A++T LFA S + A +  LPI W+D +FVPYD+GY AF++        P 
Sbjct: 81  LGLDTSLVAAAKETELFAPSELQA-EYDLPIAWEDKVFVPYDWGYFAFVHGTD--LDAPA 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F  L  S    KI+ QDPR+ST GLGLL+W++  YGD + +VW  +A    TVTKGW+E
Sbjct: 138 DFKALAESDL--KIVIQDPRSSTPGLGLLMWVKAAYGDEAPEVWAGLADNIVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+    D   AALF EGHY+QIEVA +L  S QP+LA
Sbjct: 196 AYGLFLEGEADMVLSYTTSPAYHLIAEEDDSKTAALFDEGHYMQIEVAGKLAGSDQPELA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+Q+++S + Q +LPTTNWMYP V  +  +P+ ++ +  P K+L     +    R + 
Sbjct: 256 DQFLQYLVSNAAQSVLPTTNWMYPAVTPEGGLPEGFKGMIQPGKALLVPNADVPALREEA 315

Query: 328 ISSWQNAVSR 337
           ++ W  A+SR
Sbjct: 316 LNEWLTALSR 325


>gi|254486167|ref|ZP_05099372.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Roseobacter sp. GAI101]
 gi|214043036|gb|EEB83674.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Roseobacter sp. GAI101]
          Length = 325

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 207/310 (66%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV+D G GP I++AFE  C C+LK +G+ DG ALL +L++EG  S AD+V
Sbjct: 21  PELVVYTYDSFVSDWGPGPVIEKAFEETCECDLKFVGMGDGAALLARLKLEGARSDADVV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D +LI  A++TGLF  +++ A    LPI W+DD FVPYD+GY AF++       PP 
Sbjct: 81  LGLDTSLIAAAKETGLFEPTSVTA-DYDLPIAWNDDSFVPYDWGYFAFVHGTD--LTPPT 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF  L +S    KI+ QDPR+ST GLGLL+W++  YGD++  +W+ +A    TVTKGW+E
Sbjct: 138 NFKALADSDL--KIVIQDPRSSTPGLGLLMWVKAAYGDDAPAIWEGLADNVVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+        AA F EGHY+QIEV  +L  S QP LA
Sbjct: 196 AYGLFLEGEADMVLSYTTSPAYHLIAEEDATKSAAAFDEGHYMQIEVVGKLSGSDQPDLA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FMQFM+S + Q +LPTTNWMYP V     +P  ++ +  P+K+L    +     R + 
Sbjct: 256 DAFMQFMVSDAAQSVLPTTNWMYPAVIPADGLPKGFETLITPEKALLVPNDAVPALREKA 315

Query: 328 ISSWQNAVSR 337
           ++ W +A+S+
Sbjct: 316 LAEWLSALSQ 325


>gi|326796498|ref|YP_004314318.1| thiamine ABC transporter periplasmic binding protein [Marinomonas
           mediterranea MMB-1]
 gi|326547262|gb|ADZ92482.1| thiamine ABC transporter, periplasmic binding protein [Marinomonas
           mediterranea MMB-1]
          Length = 335

 Score =  312 bits (800), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 143/312 (45%), Positives = 209/312 (66%), Gaps = 3/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A   L VYTY+SF +D G GPKIK  FE +C+C L  + L   V +L+++++EG +S+AD
Sbjct: 25  AASTLNVYTYDSFASDWGPGPKIKTKFEAQCDCTLNYVTLDSSVGILSRVQLEGLSSSAD 84

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG D N+++ A+KTGL A+  +D S + +   W D  FVP+D GY AFIY+   + QP
Sbjct: 85  VVLGLDLNVMEAAKKTGLLAEHAVDTSNVNVAGGWSDKYFVPFDQGYFAFIYNSEAMAQP 144

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  E++ + K  ++IYQDPRTST GLGLLLW++ +YGD++ Q W+ +A+ T TVTKGW
Sbjct: 145 PKSLKEVVEN-KDLRVIYQDPRTSTPGLGLLLWMKSVYGDSADQAWETLASHTVTVTKGW 203

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
            ++Y  FLKGE+D VLSY+TSP ++++  G+  Y AA  SEG Y Q+EVAA L  +    
Sbjct: 204 YDAYSLFLKGEADVVLSYTTSPAYHVVAEGETKYKAAPASEGFYPQVEVAATLKNAPNKA 263

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVD--ISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LAQ+FM F+++  FQ  + T NWM PV+D    +P+++  ++ P K L   A +   +R 
Sbjct: 264 LAQQFMSFILTSEFQNTVATGNWMLPVIDDVNELPEIFSQLQQPTKVLTLPANDVAEHRK 323

Query: 326 QWISSWQNAVSR 337
            WI+ W NA +R
Sbjct: 324 AWINEWLNATTR 335


>gi|260461449|ref|ZP_05809696.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Mesorhizobium opportunistum WSM2075]
 gi|259032519|gb|EEW33783.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Mesorhizobium opportunistum WSM2075]
          Length = 332

 Score =  312 bits (799), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 146/312 (46%), Positives = 199/312 (63%), Gaps = 3/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LTVYTY SF AD G GP +K+ FE +C C+++ + ++DGVALLN++++EG ++ AD
Sbjct: 22  AKDKLTVYTYESFTADWGPGPVVKKEFEAECGCDVEFVSVADGVALLNRVKLEGASTKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   A+ TGLFA      S + +P  W DD FVP+DYGY A +YD +++  P
Sbjct: 82  IVLGLDTNLTADAKATGLFAPHGA-VSDVDVPGGWSDDTFVPFDYGYFAVVYDTQKLKTP 140

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+  +   KI+ QDPRTST GLGLLLW++ +YGD + + W K+  K  TVT GW
Sbjct: 141 PKSLKELVEGSADDKIVIQDPRTSTPGLGLLLWVKSVYGDKAPEAWAKLKAKVLTVTPGW 200

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    + Y AA F EG YLQIEVA       +  
Sbjct: 201 SEAYGLFTKGEAPMVLSYTTSPAYHMIAENTERYQAASFEEGEYLQIEVAGITTTGAKNP 260

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPV--VDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA +FM FM SP FQ  +P TNWM+P    D  +   +  +  P K+L F+ EE    R 
Sbjct: 261 LAAKFMAFMTSPKFQDAIPETNWMFPAGKTDKPLNPAFGKLVKPTKTLLFSPEEVAANRK 320

Query: 326 QWISSWQNAVSR 337
            W+  W   +SR
Sbjct: 321 AWVDEWLAVMSR 332


>gi|89067281|ref|ZP_01154794.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Oceanicola granulosus HTCC2516]
 gi|89046850|gb|EAR52904.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Oceanicola granulosus HTCC2516]
          Length = 327

 Score =  311 bits (798), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 213/328 (64%), Gaps = 7/328 (2%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           M  T  I+   L    +   LT+YTY+SFV + G GP +  AFE +C CE++ +   DG 
Sbjct: 5   MRTTATIAGLMLATTASAETLTIYTYDSFVPEWGPGPAVAAAFEAQCGCEIEFVAAGDGA 64

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
           ALL++LR+EG  + ADIVLG D+NL+  AR+TGLFA   ++A    LP+ WDDD F+P+D
Sbjct: 65  ALLSRLRLEGARTEADIVLGLDSNLVAQARETGLFAPHGVEA-DFDLPVAWDDDTFLPFD 123

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
           +GY AF+      T+ P NF EL  S     I  QDPR+ST GLGL+LW+++ YG+ + +
Sbjct: 124 WGYFAFV--SSADTEAPANFRELAESDL--SIAIQDPRSSTPGLGLVLWVEQAYGEEAGE 179

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
           VW+ +A    TVT GW+E+YG FL+GE+D VLSY+TSP ++ +    D  VA  F EGHY
Sbjct: 180 VWQGLADNVLTVTPGWSEAYGLFLEGEADAVLSYTTSPAYHAIAEEDDSKVAWAFDEGHY 239

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIP 309
           LQIEV A +  + QP+LAQ+FM F+ +  FQ ++PTTNWMYP V  +  +P+ +  +  P
Sbjct: 240 LQIEVVAMVEGTDQPELAQDFMAFVATDGFQSVIPTTNWMYPAVTPAEGLPEGFGELVQP 299

Query: 310 QKSLRFNAEETTRYRNQWISSWQNAVSR 337
           + +L +  +E    R   I++W++A+++
Sbjct: 300 ETALLYPPQEAAEVREDAIATWRDALAQ 327


>gi|13473311|ref|NP_104878.1| thiamine transporter substrate binding subunit [Mesorhizobium loti
           MAFF303099]
 gi|14024059|dbj|BAB50664.1| thiamin ABC transporter, periplasmic-binding protein [Mesorhizobium
           loti MAFF303099]
          Length = 332

 Score =  309 bits (791), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 197/312 (63%), Gaps = 3/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LTVYTY SF AD G GP +K+ FE +C C+++ + ++DGVALLN++++EG ++ AD
Sbjct: 22  AKDKLTVYTYESFTADWGPGPVVKKEFEAECGCDVEFVSVADGVALLNRVKLEGASTKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   A+ +GLFA      S + +P  W DD FVP+DYGY A +YD  ++  P
Sbjct: 82  IVLGLDTNLTADAKASGLFAPHGA-VSDVNVPGGWSDDTFVPFDYGYFAVVYDTEKLKTP 140

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  EL+  +   KI+ QDPRTST GLGLLLW++ +YGD + + W K+ TK  TVT GW
Sbjct: 141 PKSLKELVEGSADDKIVIQDPRTSTPGLGLLLWVKSVYGDKAPEAWAKLKTKVLTVTPGW 200

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++      Y AA F EG YLQIEVA       +  
Sbjct: 201 SEAYGLFTKGEAPMVLSYTTSPAYHMVAENTQRYQAASFEEGEYLQIEVAGITTTGAKNP 260

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPV--VDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA +FM FM  P FQ  +P TNWM+P    D  +   +  +  P K+L F+ EE    R 
Sbjct: 261 LAAKFMAFMTGPKFQDAIPETNWMFPAGKTDKPLNPAFDKLVKPAKTLLFSPEEVAANRK 320

Query: 326 QWISSWQNAVSR 337
            W+  W   +S+
Sbjct: 321 AWVDEWLAVMSK 332


>gi|319781047|ref|YP_004140523.1| ABC transporter periplasmic binding protein [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317166935|gb|ADV10473.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 332

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 143/312 (45%), Positives = 197/312 (63%), Gaps = 3/312 (0%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AK  LTVYTY SF AD G GP +K+ FE +C C++  + ++DGVALLN++R+EG ++ AD
Sbjct: 22  AKDKLTVYTYESFTADWGPGPVVKKEFEAECGCDVDFVSVADGVALLNRVRLEGASTKAD 81

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG D NL   A+ +GLFA      + + +P  W DD FVP+DYGY A +YD +++  P
Sbjct: 82  IVLGLDTNLTADAKASGLFAPHGA-VTDVNVPGGWSDDTFVPFDYGYFAVVYDTQKMKTP 140

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           PK+  ELI  +   KI+ QDPRTST GLGLLLW++ +YGD + + W K+  K  TVT GW
Sbjct: 141 PKSLKELIEGSANDKIVIQDPRTSTPGLGLLLWVKSVYGDKAPEAWAKLKAKVLTVTPGW 200

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +E+YG F KGE+  VLSY+TSP ++++    + Y AA F EG YLQIEVA       +  
Sbjct: 201 SEAYGLFTKGEAPMVLSYTTSPAYHMVAENTERYQAASFEEGEYLQIEVAGITTTGAKNP 260

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPV--VDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA +FM FM  P FQ  +P TNWM+P    D  +   +  +  P K+L F+ +E    R 
Sbjct: 261 LAAKFMAFMTGPKFQDAIPETNWMFPAGKTDKPLNPAFDKLVKPTKTLLFSPQEVAANRK 320

Query: 326 QWISSWQNAVSR 337
            W+  W   +S+
Sbjct: 321 AWVDEWLAVMSK 332


>gi|83644459|ref|YP_432894.1| thiamine transporter substrate binding subunit [Hahella chejuensis
           KCTC 2396]
 gi|83632502|gb|ABC28469.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-bind [Hahella chejuensis KCTC 2396]
          Length = 339

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 142/307 (46%), Positives = 203/307 (66%), Gaps = 4/307 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTVYTY+SFV++ G GP +++ FE  C C++K + L DGV++LN+LR+EG+ + AD+VLG
Sbjct: 36  LTVYTYDSFVSEWGPGPALEKGFEATCQCDVKFVALEDGVSILNRLRIEGKKAKADVVLG 95

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNF 151
            D  LI+  RK GL     +    L   +KW D  FVP+DYGY +FIYD ++I QP ++ 
Sbjct: 96  LDTGLIEETRKEGLVQPHAVAFDALTPELKWSDKDFVPFDYGYFSFIYDSQKIKQPAQSL 155

Query: 152 DELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY 211
            EL++S+    +IYQDPRTST G G+++W++  YGD +   WKK+A  T TVTKGW E+Y
Sbjct: 156 QELVDSSA--SVIYQDPRTSTPGQGMMMWMKSAYGDQAESAWKKLAQHTVTVTKGWWEAY 213

Query: 212 GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQE 271
             FL+G++D+VLSYSTSP ++ +   +  Y AALFSEGH +Q+EVAA    S++ +LA  
Sbjct: 214 SMFLEGDADYVLSYSTSPAYHQVAEDKTQYKAALFSEGHVMQVEVAAIAANSEKKELANR 273

Query: 272 FMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           F+ F+IS   Q I+P TNWM PV   + +P+ +  +  P KS+    E     R  WI  
Sbjct: 274 FLNFLISQEAQEIIPVTNWMLPVRKGVKLPEAFDTLIQP-KSIELTPEYIAANRKAWIKE 332

Query: 331 WQNAVSR 337
           W+ AVS+
Sbjct: 333 WRGAVSQ 339


>gi|99082658|ref|YP_614812.1| thiamine transporter substrate binding subunit [Ruegeria sp.
           TM1040]
 gi|99038938|gb|ABF65550.1| ABC transporter periplasmic binding protein thiB subfamily
           [Ruegeria sp. TM1040]
          Length = 326

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 209/310 (67%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV++ G GP +++AFE  C C+LK +G  DG ALL ++++EG  S AD+V
Sbjct: 22  PELVVYTYDSFVSEWGPGPAVEEAFEAVCGCDLKFVGAGDGAALLARIKLEGARSDADVV 81

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A++TGLFA  +++A    LPI W D  F PYD+GY AF+++       P 
Sbjct: 82  LGLDTNLTAAAKETGLFAPVSVEA-DYALPITWSDTHFAPYDWGYFAFVHNAD--VPAPS 138

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF+ L +S    KI+ QDPR+ST GLGLL+W++  YG+++  +W+ ++    TVTKGW+E
Sbjct: 139 NFEALADSDL--KIVIQDPRSSTPGLGLLMWVKAAYGEDAPALWEGLSDNIVTVTKGWSE 196

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+    D   AALF EGHY+Q+EVA +L  S +  LA
Sbjct: 197 AYGLFLEGEADMVLSYTTSPAYHLIAEEDDSKSAALFDEGHYMQVEVAGKLAASDESALA 256

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F++FM+S +FQ I+PTTNWMYP V  D  +P  ++ +  P+KSL    +E    R + 
Sbjct: 257 DQFLEFMVSDAFQSIIPTTNWMYPAVTPDSGLPQGFETLISPEKSLLLPEDEAAALRAEA 316

Query: 328 ISSWQNAVSR 337
           +  W+ A+SR
Sbjct: 317 LEEWRAALSR 326


>gi|333021692|gb|EGK40941.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Shigella flexneri K-227]
          Length = 295

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 136/207 (65%), Positives = 171/207 (82%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKGW
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGW 197

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLL 234
           +E+YG FLKGESD VLSY+TSP +++L
Sbjct: 198 SEAYGLFLKGESDLVLSYTTSPAYHIL 224


>gi|126734350|ref|ZP_01750097.1| thiamin transporter substrate binding subunit [Roseobacter sp.
           CCS2]
 gi|126717216|gb|EBA14080.1| thiamin transporter substrate binding subunit [Roseobacter sp.
           CCS2]
          Length = 329

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 209/322 (64%), Gaps = 7/322 (2%)

Query: 18  ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKL 77
           ++ C        PVL V TY+SFV + G GP I+ AFE +C C+L+ +G  DG ALL +L
Sbjct: 13  LALCATSAWAETPVLQVLTYDSFVTEWGPGPAIETAFEAECACDLQFVGAGDGAALLARL 72

Query: 78  RMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAF 137
           ++EG  + ADIVLG D NL   AR+TGLFA   I+A  L LPI+W D  F+P+D+GY AF
Sbjct: 73  QLEGPRTDADIVLGLDTNLTAAARETGLFAPHGINA-DLDLPIEWTDADFLPFDWGYFAF 131

Query: 138 IYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIA 197
           + +       P++   L +S    +I+ QDPR+ST GLGLL+W++  YGD++  +W  ++
Sbjct: 132 VGNAG--ADAPQSLRALADSDA--QIVIQDPRSSTPGLGLLMWVKTAYGDDAPALWADLS 187

Query: 198 TKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVA 257
               TVT GW+E+YG FL+GE+D VLSY+TSP ++L+    D  VA  F EGHY+Q+EVA
Sbjct: 188 DNIVTVTSGWSEAYGMFLEGEADAVLSYTTSPAYHLIAEEDDSKVAWAFDEGHYMQVEVA 247

Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRF 315
            ++  + QP+LA +F+ FM+S  FQ ++PTTNWMYP V  +  +P+ ++ +  P KSL  
Sbjct: 248 GKVAGTDQPELADKFLAFMVSEGFQSVIPTTNWMYPAVTPEGGLPEGFETLVTPAKSLLL 307

Query: 316 NAEETTRYRNQWISSWQNAVSR 337
           + E+    R+  +  W+ A+SR
Sbjct: 308 SPEDAAAKRDVALDEWRTALSR 329


>gi|84514974|ref|ZP_01002337.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Loktanella vestfoldensis SKA53]
 gi|84511133|gb|EAQ07587.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Loktanella vestfoldensis SKA53]
          Length = 329

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 145/310 (46%), Positives = 207/310 (66%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVL V TY+SFV++ G GP I  AFE+ C C+L+ IG  DG ALL +L++EG  + ADIV
Sbjct: 25  PVLQVMTYDSFVSEWGPGPAIAAAFEQTCGCDLQFIGTGDGAALLARLQLEGPRTEADIV 84

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NLI  AR+TGLFA   + A  L LPI WDD  F+P+D+GY AF+ +     + P 
Sbjct: 85  LGLDTNLIAAARETGLFAPHRVTA-DLDLPITWDDPEFLPFDWGYFAFVGNAG--AEAPI 141

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +   L +S    +I+ QDPR+ST GLGLL+W++  Y D++A++W  +A    TVT GW+E
Sbjct: 142 SLRALADSDI--RIVIQDPRSSTPGLGLLMWVKTAYPDSAAELWADLADNIVTVTPGWSE 199

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D VLSY+TSP ++L+    D  VA  F EGHY+Q+EVAA++  + QP+LA
Sbjct: 200 AYGLFLEGEADAVLSYTTSPAYHLIAEEDDSKVAWAFDEGHYMQVEVAAKVAGTDQPELA 259

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+ FM+S +FQ I+P TNWMYP V  +  +P  ++ +  P  +L  + EE    R+  
Sbjct: 260 DQFLAFMVSDAFQSIIPETNWMYPAVVPEGGLPAGFETLITPATALLLSPEEAAAIRDVA 319

Query: 328 ISSWQNAVSR 337
           +  W+NA+S+
Sbjct: 320 LDEWRNALSQ 329


>gi|114706323|ref|ZP_01439225.1| ABC transporter, substrate binding protein (thiamine) [Fulvimarina
           pelagi HTCC2506]
 gi|114538184|gb|EAU41306.1| ABC transporter, substrate binding protein (thiamine) [Fulvimarina
           pelagi HTCC2506]
          Length = 357

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 202/310 (65%), Gaps = 1/310 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLT+YTY SFV + G GPKI+ AFE KC C+L+  GL+DGVA+LN+L++EG +S AD 
Sbjct: 48  KPVLTIYTYESFVPEWGPGPKIEAAFEAKCECDLQFEGLADGVAILNRLKLEGASSPADA 107

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           V+G   +L+  A+ TGLFA S  D S L LP+ ++DD FVP+DY YLA + D  +    P
Sbjct: 108 VIGLTTDLVPEAKATGLFASSETDLSPLALPVDYNDDTFVPFDYSYLAVMVDTEEAGDWP 167

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+ + L+      KI  +DPRTST GLG LLW++ +YG+++   W++++ +  TVT GW+
Sbjct: 168 KSLNALVTGDSEQKIAIEDPRTSTPGLGFLLWMKAVYGEDAKAKWEELSDRILTVTPGWS 227

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG F  GE   V+SYSTSP ++++    + Y AA FSEG YLQIEVA  L  +  P+L
Sbjct: 228 EAYGLFTSGEVPLVVSYSTSPAYHMIEEETERYTAAEFSEGLYLQIEVAGMLEGTDTPEL 287

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           A++F+ F+++  FQ ++PT NW YPV+D + +P+ +  +   +  L  + E     R  W
Sbjct: 288 ARKFLDFILTEDFQSVIPTGNWAYPVIDGVDLPEAFDKLIEVENPLYIDPETVAENRQAW 347

Query: 328 ISSWQNAVSR 337
              W  A+ R
Sbjct: 348 TQEWLEALGR 357


>gi|88798204|ref|ZP_01113790.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Reinekea sp. MED297]
 gi|88778980|gb|EAR10169.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Reinekea sp. MED297]
          Length = 339

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 144/336 (42%), Positives = 213/336 (63%), Gaps = 3/336 (0%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCEL 62
           +F  I    M +  ++S  TL G  A   LT+YTY SF  + G GP +++AFE +CNC++
Sbjct: 6   QFLLIQETTMKLKTLLSLMTLSGTLAAADLTIYTYESFTGEWGPGPALEKAFEAQCNCDI 65

Query: 63  KLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
             +GL DGVALLN+LR+EGE S ADI+LG D+ L+      GL A+     S L LP +W
Sbjct: 66  AFVGLEDGVALLNRLRLEGEQSQADIILGLDDGLVAETEALGLLAEHQQSLSDLTLPYRW 125

Query: 123 DDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
            ++ FVPYDYG+ AF+YD +++++ P +  EL+  +    +IYQDPR ST G GL+LW++
Sbjct: 126 SNEYFVPYDYGHFAFVYDDQRVSEVPGSLKELVEESD-LSVIYQDPRLSTPGQGLMLWMK 184

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV 242
            ++G ++A  W ++  KT TVT GW+E+Y  FL+G SD VLSY TSP +++     + Y 
Sbjct: 185 SVFGADAADAWTQLQEKTVTVTPGWSEAYSLFLEGNSDMVLSYVTSPAYHISFEETEQYK 244

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPD 301
           AA F+EGHY+QIEVA+ L  S    LA++F+ F++S   Q +   TNWM+PV+ +   P 
Sbjct: 245 AAEFAEGHYVQIEVASALKSSGNLPLARDFLAFLVSKPAQDVFGGTNWMWPVLAEAETPA 304

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +  +  P+ +L F +E+    R  WI  W+NA S+
Sbjct: 305 SFDKLISPE-TLYFRSEDVAANRKAWIREWRNAASQ 339


>gi|33151789|ref|NP_873142.1| thiamine-binding periplasmic protein [Haemophilus ducreyi 35000HP]
 gi|33148010|gb|AAP95531.1| thiamine-binding periplasmic protein [Haemophilus ducreyi 35000HP]
          Length = 322

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 149/307 (48%), Positives = 205/307 (66%), Gaps = 9/307 (2%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP+LTVYTY+SFV+D GA PK+++ FE+ C+C++K I   DG+ +LN++R+EG+ + ADI
Sbjct: 22  KPLLTVYTYDSFVSDWGAAPKLEEKFEKVCDCDVKFIPFEDGITMLNRIRLEGKKTKADI 81

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DN  +  A K+GLFA  N+   Q    IKW D+ F PYDY   AFIY+K +IT PP
Sbjct: 82  MLGIDNFTMPEAVKSGLFAAHNLPIDQ----IKWQDNTFFPYDYSEYAFIYNKEKITNPP 137

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+   +  K+IYQDPRTST+G GLL W+  +Y  N+ Q WK +A  T TV KGW+
Sbjct: 138 KSLKELVER-QDLKVIYQDPRTSTVGRGLLFWLNTVYAGNAEQAWKTLAKHTVTVGKGWS 196

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++  +   D YVAA F EGH +Q EVAA L  SKQP L
Sbjct: 197 ETYGAFLKGESDLVLSYTTSPLYHYWHEQTDKYVAAEFEEGHLVQTEVAAILKTSKQPAL 256

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ-KSLRFNAEETTRYRNQW 327
           A+ F+ F+  P  Q+I+   N M PV+   +   +  +R+P  K+L F   E+   + QW
Sbjct: 257 AKAFLTFLHHPEAQKIIAYHNVMKPVITTEVDPAF--VRLPTYKTLAFEQPESNVVK-QW 313

Query: 328 ISSWQNA 334
           I++W  +
Sbjct: 314 IATWAKS 320


>gi|221640888|ref|YP_002527150.1| thiamine transporter substrate binding subunit [Rhodobacter
           sphaeroides KD131]
 gi|221161669|gb|ACM02649.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Rhodobacter sphaeroides KD131]
          Length = 342

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 139/310 (44%), Positives = 212/310 (68%), Gaps = 6/310 (1%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTV TY+SF ++ G GP +++AFE  C C+L+ +   DG ALL +L++EG  S AD+V
Sbjct: 37  PVLTVLTYDSFTSEWGPGPAVEKAFEEICACDLRFVAAGDGAALLARLQLEGARSEADVV 96

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A +TGLFA   + ++ L LP+ W+D +F+P+D+G+ AF++D+R +   P 
Sbjct: 97  LGLDTNLTAAAAETGLFAPHGV-STPLDLPVAWEDPLFLPFDWGWFAFVHDRR-MEDVPA 154

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+EL+ S    +I+ QDPR+ST GLGLL+W++  YGD + ++W+ +A    TVT GW+E
Sbjct: 155 SFEELVASDA--RIVIQDPRSSTPGLGLLMWVKAAYGDRAPEIWEGLADNIVTVTPGWSE 212

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG F++GE+D VLSY+TSP ++L+    D   AA F EGHYLQ+EVA +L  + QP+LA
Sbjct: 213 AYGLFMEGEADMVLSYTTSPAYHLIAEEDDTKTAAAFREGHYLQVEVAGKLAATDQPELA 272

Query: 270 QEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FM F++    Q +LPTTNWMYP  +    +P+ ++ +  P+ SL  +A+E    R + 
Sbjct: 273 DRFMAFLLEEPVQSVLPTTNWMYPAKLPAAGLPEGFETLVQPETSLLLSADEALALRPEA 332

Query: 328 ISSWQNAVSR 337
           ++ WQ+A++R
Sbjct: 333 LAEWQDALAR 342


>gi|120554127|ref|YP_958478.1| ABC transporter periplasmic-binding protein [Marinobacter aquaeolei
           VT8]
 gi|120323976|gb|ABM18291.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Marinobacter aquaeolei VT8]
          Length = 334

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 199/309 (64%), Gaps = 3/309 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           VL VYT+ SF A+ G GP +K+AFE +C C L    L  G  +L +LR+EG ++ AD+VL
Sbjct: 25  VLNVYTHPSFAAEWGPGPAVKEAFEAQCGCSLNYTVLDSGGDILQRLRLEGSSTPADVVL 84

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G D   ++ AR+TGL  +      +L LP+ WDDD FVPYD+GY AF+YD  Q+++PP +
Sbjct: 85  GLDTGTMETARQTGLLGRHGQSLERLALPVNWDDDTFVPYDWGYFAFVYDTEQLSEPPSS 144

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
            +EL+N+    KII QDPRTST GLGLLLW+  +YGD +   W++++ K    T+ W++ 
Sbjct: 145 LEELVNAPDDLKIIIQDPRTSTPGLGLLLWMHAVYGDEAPAKWQQLSDKILATTQSWSDG 204

Query: 211 Y-GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           Y   F+ GE+  +LSYSTSP +++     D Y AA F+EGHYLQ+EVAA +  S    LA
Sbjct: 205 YFSLFMNGEAPMILSYSTSPAYHMAIDKTDRYQAARFNEGHYLQVEVAALVESSDNKTLA 264

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDI--SMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           +EF+ FM++  FQR LP  N MYP VD+   +PDV+  +  P ++L  +  +    R Q 
Sbjct: 265 REFLDFMLTADFQRHLPLKNVMYPAVDLGDELPDVFDKLITPSEALYIDPAKVATIRRQL 324

Query: 328 ISSWQNAVS 336
           ++ W +A++
Sbjct: 325 VNDWLDALT 333


>gi|332290177|ref|YP_004421029.1| thiamine transporter substrate binding subunit [Gallibacterium
           anatis UMN179]
 gi|330433073|gb|AEC18132.1| thiamine transporter substrate binding subunit [Gallibacterium
           anatis UMN179]
          Length = 331

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 219/329 (66%), Gaps = 7/329 (2%)

Query: 13  MITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVA 72
           +  G ++  TL    A+  LTVYTY+SF +D G  PK++  FE++C C+LK +   D V 
Sbjct: 6   LFLGTLAVSTLSFANAE-TLTVYTYDSFASDWGPAPKLEAIFEKQCGCDLKFVPFEDSVT 64

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDY 132
           + N++R+EG+ S AD+VLG D +LI+ A ++ LF K++I    L LP+ W +  ++PYD+
Sbjct: 65  MFNRVRLEGKKSKADVVLGLDQSLIEAADQSQLFTKTDIKLDNLHLPLNWQNQTYIPYDF 124

Query: 133 GYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQ 191
           G  AF+YDK +++ PPK+  ELI   +  ++IYQDPRTS++G GLLLW+ ++Y  D  AQ
Sbjct: 125 GSFAFVYDKTKLSNPPKSLKELIER-QDLRVIYQDPRTSSVGRGLLLWVNQVYPQDQVAQ 183

Query: 192 VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHY 251
            W+++A  T TV KGWTE+YG FLKGESD VLSY +SP ++ LN  + +Y A  FSEG+ 
Sbjct: 184 AWQQLAKHTVTVGKGWTETYGAFLKGESDLVLSYRSSPLYHQLNEQKQNYAATAFSEGNI 243

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR---I 308
           LQIE+AA+L  SKQ +LA +F+QF++S   Q I+  +N M+ V D  +   Y  +R   +
Sbjct: 244 LQIEIAAKLKASKQTKLADQFLQFLLSSEAQNIISQSNVMFAVTDAPIEPHYDQLRHQVL 303

Query: 309 PQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +K++   +  + +   QW++ WQNA+++
Sbjct: 304 TEKTID-TSNISHQQTKQWLAVWQNALAK 331


>gi|89052821|ref|YP_508272.1| thiamine transporter substrate binding subunit [Jannaschia sp.
           CCS1]
 gi|88862370|gb|ABD53247.1| thiamine ABC transporter periplasmic binding protein [Jannaschia
           sp. CCS1]
          Length = 335

 Score =  298 bits (762), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 213/336 (63%), Gaps = 14/336 (4%)

Query: 5   ARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKL 64
           A I  G+ ++TG             PVLTVYTY+SF ++ G GP ++ AFE  C C+L+ 
Sbjct: 11  AGITAGLTLLTGA-------AFAQVPVLTVYTYDSFNSEWGPGPGVELAFEEICECDLQF 63

Query: 65  IGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDD 124
               DG ALL +LR+EG  S  DIVLG D NL+  A   GL A+ +     L LP+ WDD
Sbjct: 64  TSTGDGAALLARLRLEGARSEGDIVLGLDTNLMAAALDAGLIAEHDSTPGDLTLPMTWDD 123

Query: 125 DIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKI 184
             F+P+D+GY AF++ +  +   P +F++L  S     I+ QDPR+ST GLGLL+W+Q  
Sbjct: 124 PHFMPFDWGYFAFVH-RTDMETVPGSFEDLAASDA--SIVIQDPRSSTPGLGLLMWVQNA 180

Query: 185 YGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA 244
           YGD +A +W+ +A    TVT GW+E+YG FL+GE+D VLSY+TSP ++L+      + AA
Sbjct: 181 YGDEAAAIWEGLADNVVTVTPGWSEAYGLFLEGEADMVLSYTTSPAYHLIAEDDAGFEAA 240

Query: 245 LFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV---VDISMPD 301
            F+EGHY+QIEV   L  +  P LAQ+F+ FMISP+FQ ++P TNWMYP    VD  +P+
Sbjct: 241 AFAEGHYMQIEVGGILQTADNPDLAQQFLDFMISPAFQTVIPETNWMYPAALPVD-QLPE 299

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ +  P+ +L F  EE    R+  +++WQNA+S+
Sbjct: 300 GFETLIQPETALIFTPEEAAAIRDDALATWQNALSQ 335


>gi|295698572|ref|YP_003603227.1| thiamine-binding periplasmic protein [Candidatus Riesia
           pediculicola USDA]
 gi|291156980|gb|ADD79425.1| thiamine-binding periplasmic protein [Candidatus Riesia
           pediculicola USDA]
          Length = 324

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/311 (45%), Positives = 199/311 (63%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
            + AKP LT+Y  N F ++ G    IK  FERK +C L      +   LLN L+      
Sbjct: 12  SIQAKPTLTIYACNLFSSNLGPKDLIKSEFERKYDCNLNFFSFWNENTLLNILKKNKRKF 71

Query: 85  AADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQI 144
           +ADI+LG ++N I   +   LF +  I   + K P+K  +   +PY+YGYLAFIY+ ++I
Sbjct: 72  SADIILGINDNRIGSLQIRDLFLEYRIKNLKFKFPLKEYNKFLIPYNYGYLAFIYNNKKI 131

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVT 204
            + P +F+ELI+    WKIIYQDPRTS+ GLG+L WI+KIY  NS+++W+KIA KT TVT
Sbjct: 132 LKVPDSFEELISEKSSWKIIYQDPRTSSSGLGMLFWIKKIYEKNSSEIWRKIARKTVTVT 191

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSK 264
           K W ESY  FLKGE DF LSYS+SPGF+LL     DY + +F EGHYLQ E+    +RS+
Sbjct: 192 KSWGESYELFLKGEGDFFLSYSSSPGFFLLKKNNYDYSSIIFKEGHYLQTELIGISIRSQ 251

Query: 265 QPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYR 324
             +L+++F+ F++SP  QR L   NWMYP + I +P VY  +  P+K L+F+ +ET +  
Sbjct: 252 NVELSKKFVDFILSPKIQRKLSIYNWMYPSIRIKLPKVYDFVPEPKKFLQFDIQETNQNY 311

Query: 325 NQWISSWQNAV 335
            +WI  W +AV
Sbjct: 312 QKWIQEWLHAV 322


>gi|87119514|ref|ZP_01075411.1| putative ABC-type thiamine transport system,periplasmic component
           [Marinomonas sp. MED121]
 gi|86164990|gb|EAQ66258.1| putative ABC-type thiamine transport system,periplasmic component
           [Marinomonas sp. MED121]
          Length = 337

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 205/309 (66%), Gaps = 3/309 (0%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            L +YTY+SF +D G GPKIK  FE++C C L  + L   V +L+++++EG  S AD++L
Sbjct: 30  TLNIYTYDSFASDWGPGPKIKANFEKECACTLNYVTLDSSVGILSRVQLEGSASKADVLL 89

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G D NL+  A+ +GL A+ N++ +Q+  P  W D+ FVP+D GY AFIY+   + + P +
Sbjct: 90  GLDLNLMHAAKASGLLAEHNVNTNQVTTPGGWSDNYFVPFDQGYFAFIYNTETLKEVPTS 149

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
              ++ + +   +IYQDPRTST GLGL+LW++ +YGD++A+ W+ +A+ T TVTKGW + 
Sbjct: 150 LKNVVEN-QDLSVIYQDPRTSTPGLGLMLWMKSVYGDDAAKAWQTLASHTKTVTKGWYDG 208

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           Y  FLKGE+D VLSY+TSP ++++  G+  Y A   SEG Y Q+EVAAQL  +    LA 
Sbjct: 209 YSMFLKGEADLVLSYTTSPAYHMVVEGESKYKAVPASEGFYPQVEVAAQLKNAPNKALAD 268

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDI--SMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           +FMQF+++  FQ  + T NWM+PV+++  S+P  +  +  P K L   AE+    R QWI
Sbjct: 269 QFMQFILTQGFQGEVATGNWMFPVIELGDSLPKAFTGLEQPTKVLTLPAEQIAAKRKQWI 328

Query: 329 SSWQNAVSR 337
           + W ++V++
Sbjct: 329 NEWLDSVTQ 337


>gi|77464967|ref|YP_354471.1| thiamine transporter substrate binding subunit [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389385|gb|ABA80570.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
          Length = 342

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 210/310 (67%), Gaps = 6/310 (1%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTV TY+SF ++ G GP +++AFE  C C+L+ +   DG ALL +L++EG  S AD+V
Sbjct: 37  PVLTVLTYDSFTSEWGPGPAVEKAFEETCACDLRFVAAGDGAALLARLQLEGARSEADVV 96

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A  TGLFA   + ++ L LP+ W+D +F+P+D+G+ AF++D+R +   P 
Sbjct: 97  LGLDTNLTAAAAATGLFAPHGV-STPLDLPVAWEDPVFLPFDWGWFAFVHDRR-MEDVPA 154

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+EL  S    KI+ QDPR+ST GLGLL+W++  YGD + ++W+ +A    TVT GW+E
Sbjct: 155 SFEELAASDS--KIVIQDPRSSTPGLGLLMWVEAAYGDRAPEIWEGLADNIVTVTPGWSE 212

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG F++GE+D VLSY+TSP ++L+    D   AA F EGHYLQ+EVA +L  + QP+LA
Sbjct: 213 AYGLFMEGEADMVLSYTTSPAYHLIAEEDDTKTAAAFREGHYLQVEVAGKLAATDQPELA 272

Query: 270 QEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FM F++    Q +LPTTNWMYP  +    +P+ ++ +  P+ SL  +A+E    R + 
Sbjct: 273 DRFMAFLLEEPVQSVLPTTNWMYPAKLPAAGLPEGFETLVQPETSLLLSADEALALRPEA 332

Query: 328 ISSWQNAVSR 337
           ++ WQ+A++R
Sbjct: 333 LAEWQDALAR 342


>gi|332559866|ref|ZP_08414188.1| thiamine transporter substrate binding subunit [Rhodobacter
           sphaeroides WS8N]
 gi|332277578|gb|EGJ22893.1| thiamine transporter substrate binding subunit [Rhodobacter
           sphaeroides WS8N]
          Length = 327

 Score =  295 bits (756), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 210/310 (67%), Gaps = 6/310 (1%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTV TY+SF ++ G GP +++AFE  C C+L+ +   DG ALL +L++EG  S AD+V
Sbjct: 22  PVLTVLTYDSFTSEWGPGPAVEKAFEETCACDLRFVAAGDGAALLARLQLEGARSEADVV 81

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A  TGLFA   + ++ L LP+ W+D +F+P+D+G+ AF++D+R +   P 
Sbjct: 82  LGLDTNLTAAAAATGLFAPHGV-STPLDLPVAWEDPLFLPFDWGWFAFVHDRR-MEDVPA 139

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+EL  S    KI+ QDPR+ST GLGLL+W++  YGD + ++W+ +A    TVT GW+E
Sbjct: 140 SFEELAASDS--KIVIQDPRSSTPGLGLLMWVKAAYGDRAPEIWRGLADNIVTVTPGWSE 197

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG F++GE+D VLSY+TSP ++L+    D   AA F EGHYLQ+EVA +L  + QP+LA
Sbjct: 198 AYGLFMEGEADMVLSYTTSPAYHLIAEEDDTKTAAAFREGHYLQVEVAGKLAATDQPELA 257

Query: 270 QEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FM F++    Q +LPTTNWMYP  +    +P+ ++ +  P+ SL  +A+E    R + 
Sbjct: 258 DRFMAFLLEEPVQSVLPTTNWMYPAKLPAAGLPEGFETLVQPETSLLLSADEALALRPEA 317

Query: 328 ISSWQNAVSR 337
           ++ WQ+A++R
Sbjct: 318 LAEWQDALAR 327


>gi|146278831|ref|YP_001168990.1| thiamine transporter substrate binding subunit [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145557072|gb|ABP71685.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 327

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 147/337 (43%), Positives = 215/337 (63%), Gaps = 13/337 (3%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCEL 62
           KF  +  G ++  GV +  T       PVLTV TY+SF ++ G GP ++ AFE  C C+L
Sbjct: 2   KFPMLAAGFVLTAGVAAAQT-------PVLTVLTYDSFTSEWGPGPAVETAFEEVCGCDL 54

Query: 63  KLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
           + +   DG ALL +L++EG  S AD+V+G D NL   A  TGLFA     A ++ LP+ W
Sbjct: 55  RFVAAGDGAALLARLQLEGARSEADVVVGLDTNLTAAAAATGLFAPHGA-AVEVDLPVAW 113

Query: 123 DDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
           DD +F+P+D+G+ AF++D R++ + P +F+EL  S    +I+ QDPR+ST GLGLL+W++
Sbjct: 114 DDPLFLPFDWGWFAFVHD-RKMAEVPGSFEELAASDA--RIVIQDPRSSTPGLGLLMWVK 170

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV 242
             YGD + ++W  +A    TVT GW+E+YG FL+GE+D VLSY+TSP ++L+    D   
Sbjct: 171 AAYGDRAPEIWGALADNIVTVTPGWSEAYGLFLEGEADMVLSYTTSPAYHLIAEEDDSKA 230

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYP--VVDISMP 300
           AA F EGHYLQ+EVA +L  S QP+LA  F+ F++    Q +LPTTNWMYP  +    +P
Sbjct: 231 AAPFREGHYLQVEVAGKLAASDQPELADRFLAFLLEEPVQSVLPTTNWMYPARLPAGGLP 290

Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           D ++ +  P  SL   A+E    R + +  WQ+A++R
Sbjct: 291 DGFETLVRPDVSLLLPADEALSLRPEALREWQDALAR 327


>gi|126460836|ref|YP_001041950.1| thiamine transporter substrate binding subunit [Rhodobacter
           sphaeroides ATCC 17029]
 gi|126102500|gb|ABN75178.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 327

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 210/310 (67%), Gaps = 6/310 (1%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTV TY+SF ++ G GP +++AFE  C C+L+ +   DG ALL +L++EG  S AD+V
Sbjct: 22  PVLTVLTYDSFTSEWGPGPAVEKAFEETCACDLRFVAAGDGAALLARLQLEGARSEADVV 81

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A  TGLFA   + ++ L LP+ W+D +F+P+D+G+ AF++D+R +   P 
Sbjct: 82  LGLDTNLTAAAAATGLFAPHGV-STPLDLPVAWEDPLFLPFDWGWFAFVHDRR-MEDVPA 139

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+EL  S    KI+ QDPR+ST GLGLL+W++  YGD + ++W+ +A    TVT GW+E
Sbjct: 140 SFEELAASDS--KIVIQDPRSSTPGLGLLMWVKAAYGDRAPEIWEGLADNIVTVTPGWSE 197

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG F++GE+D VLSY+TSP ++L+    D   AA F EGHYLQ+EVA +L  + QP+LA
Sbjct: 198 AYGLFMEGEADMVLSYTTSPAYHLIAEEDDTKTAAAFREGHYLQVEVAGKLAATDQPELA 257

Query: 270 QEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FM F++    Q +LPTTNWMYP  +    +P+ ++ +  P+ SL  +A+E    R + 
Sbjct: 258 DRFMAFLLEEPVQSVLPTTNWMYPAKLPAAGLPEGFETLVQPETSLLLSADEALALRPEA 317

Query: 328 ISSWQNAVSR 337
           ++ WQ+A++R
Sbjct: 318 LAEWQDALAR 327


>gi|84503491|ref|ZP_01001546.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Oceanicola batsensis HTCC2597]
 gi|84388169|gb|EAQ01122.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Oceanicola batsensis HTCC2597]
          Length = 325

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 136/310 (43%), Positives = 203/310 (65%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P LTVYTY+SF  + G GP I++ FE +C C+L+ +   DG ALL++LR+EG+ + AD+V
Sbjct: 21  PDLTVYTYDSFATEWGPGPAIEEGFEAQCGCDLEFVAAGDGAALLSRLRLEGDATRADVV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL+  AR TGLFA   ++A    LP+ W+D  F+P+D+GY AFI ++ +    P 
Sbjct: 81  LGLDTNLMAAARDTGLFAAHGVEA-DFALPVAWEDPDFLPFDWGYFAFIGNRGEPM--PT 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F +L  S +  +I+ QDPR+ST GLGLLLW++  YGD +A +W+ +A    TVT GW+E
Sbjct: 138 DFRDLAESDR--RILIQDPRSSTPGLGLLLWVKDAYGDEAAAIWEGLADNIVTVTPGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE D VLSY+TSP ++++       VA  F EGHY+QIEVAA +  S + QLA
Sbjct: 196 AYGMFLEGEGDLVLSYTTSPAYHVIAEDDTSRVALPFDEGHYMQIEVAAAVGGSDRQQLA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           ++F+ +++S   Q I+PTTNWMYP V+ S  +P+ +  +  P +       +    R+  
Sbjct: 256 RDFLAYLVSDEAQSIIPTTNWMYPAVEPSGGLPEGFGDLVEPSQPRLIAPGDVPETRDVA 315

Query: 328 ISSWQNAVSR 337
           +  W+ A+S+
Sbjct: 316 LEEWRAALSQ 325


>gi|260425409|ref|ZP_05779389.1| thiamine-binding periplasmic protein [Citreicella sp. SE45]
 gi|260423349|gb|EEX16599.1| thiamine-binding periplasmic protein [Citreicella sp. SE45]
          Length = 328

 Score =  285 bits (730), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 129/310 (41%), Positives = 203/310 (65%), Gaps = 6/310 (1%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTVY  +  V++ G GPKI++ FE +C C+L+         LL ++ +EGE++ AD+V
Sbjct: 23  PVLTVYAGDYVVSEWGPGPKIEELFEAECGCDLQF----KPGDLLPRILLEGEHTEADVV 78

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
            G + ++   AR++GLFA   +D S L LPI W D+IF+PY+YG+ AF+Y+  ++++PP+
Sbjct: 79  FGLNTDVTKKARESGLFAPHGVDLSPLTLPIDWIDEIFLPYNYGHTAFVYNTERLSEPPE 138

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+ L+N+    KI+ QDPR+S  GL  +LW++ IYGD +   W+K+A K  TVTKGW+E
Sbjct: 139 SFEALLNAPDDLKIVIQDPRSSISGLATVLWVEAIYGDGAEAAWEKLAPKILTVTKGWSE 198

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           SYG F  GE+D V+SY+TSP ++++        AA+F EGHY  +E+AA+L  + QP+LA
Sbjct: 199 SYGLFTDGEADMVMSYTTSPAYHIIAEDDRTKKAAIFPEGHYFMVELAAKLANTDQPELA 258

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FM+F++S  FQ ++ T NW  P        P+ ++ + +P+K L +  +E    R+  
Sbjct: 259 DAFMEFLLSEPFQEMIATGNWSIPAALPRDRWPEGFRELDLPEKVLFYTEDEAAELRDTA 318

Query: 328 ISSWQNAVSR 337
           I +W+ A+SR
Sbjct: 319 IDAWRRALSR 328


>gi|190149445|ref|YP_001967970.1| thiamine-binding periplasmic protein precursor [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307262764|ref|ZP_07544391.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189914576|gb|ACE60828.1| thiamine-binding periplasmic protein precursor [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306871909|gb|EFN03626.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 321

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 203/333 (60%), Gaps = 16/333 (4%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCEL 62
           K A+I      +TGV           +P L VYTY+SF +D G  PK++  FE +C C++
Sbjct: 2   KLAKIAALSAFVTGV-------AYAQQPTLVVYTYDSFSSDWGPAPKLEPLFEAQCQCDV 54

Query: 63  KLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
           K +   DG+ +LN++R+EG+ + AD++LG DN  +  A KTGLFA  +++ +    P+ W
Sbjct: 55  KFMPFEDGITMLNRIRLEGKKTKADVMLGIDNFTMAEAEKTGLFAMHDLNLA----PLNW 110

Query: 123 DDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
           ++  F PYDY   AF+YDK ++  PPK+  EL+   +  K+IYQDPRTST+G GLL W+ 
Sbjct: 111 ENKTFYPYDYSEYAFVYDKEKLANPPKSLKELVER-QDLKVIYQDPRTSTVGRGLLFWLN 169

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV 242
            +YG+ + Q W+ +A  T TV KGW+E+Y  FLKGESD VLSYSTSP ++  +   D YV
Sbjct: 170 TVYGEQAEQAWQTLAKHTVTVGKGWSETYSAFLKGESDLVLSYSTSPLYHQWHDKTDKYV 229

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDV 302
           AA F EGH +Q EVAA L  SKQ  LA++F+ F+  P  Q+++   N M PVV  S+PD 
Sbjct: 230 AAQFDEGHLVQTEVAAILNSSKQKALAKQFLAFLHQPEAQKVISYHNVMKPVVG-SVPDS 288

Query: 303 YQAIRIPQKSLRFNAEETTRYRN---QWISSWQ 332
                   K L F   + T+ +N    W  SWQ
Sbjct: 289 AFDKLPAYKPLAFKMPDATQVKNWLATWTKSWQ 321


>gi|167854822|ref|ZP_02477599.1| thiamine-binding periplasmic protein precursor [Haemophilus
           parasuis 29755]
 gi|219871420|ref|YP_002475795.1| thiamine-binding periplasmic protein [Haemophilus parasuis SH0165]
 gi|167854001|gb|EDS25238.1| thiamine-binding periplasmic protein precursor [Haemophilus
           parasuis 29755]
 gi|219691624|gb|ACL32847.1| thiamine-binding periplasmic protein [Haemophilus parasuis SH0165]
          Length = 326

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 132/309 (42%), Positives = 202/309 (65%), Gaps = 3/309 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           +P LTVYTY+SF +  G   K++  FE++C C+LK +   DGV + N++R+E   + AD+
Sbjct: 21  QPTLTVYTYDSFASKWGPAAKLEALFEKQCQCDLKFMPFEDGVTMFNRIRLEKNKTKADV 80

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG D+ L+  A K+GLF + N+  +   LP++W   IF+PYD+G  AFIY+K +++ PP
Sbjct: 81  MLGIDHFLMPEAEKSGLFVEHNLQNNANNLPLEWRSKIFLPYDFGEYAFIYNKEKVSNPP 140

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+   +  K+IYQDPRTST+G GLL W+ ++YG+ +   W+ +A  T TV KGW+
Sbjct: 141 KSLKELVER-QDLKVIYQDPRTSTVGRGLLFWVNQVYGEQAESAWQNLAKHTVTVGKGWS 199

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLK E+D VLSY+TSP ++  +   D YVAA F+EGH +Q+EVAA    S+Q +L
Sbjct: 200 ETYGAFLKNEADLVLSYTTSPLYHQWHEQTDKYVAADFAEGHLVQVEVAAITKSSRQLKL 259

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           AQ+F+ F+  P  QRI+   N M PVV      ++  +   Q ++ F   + +  + +WI
Sbjct: 260 AQQFLSFLQQPESQRIISYYNVMKPVVTTKADPLFNTLPTYQ-TISFTLPDNSEIK-RWI 317

Query: 329 SSWQNAVSR 337
           ++W N VS+
Sbjct: 318 NTWLNTVSQ 326


>gi|53728856|ref|ZP_00348257.1| COG4143: ABC-type thiamine transport system, periplasmic component
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126207662|ref|YP_001052887.1| thiamine-binding periplasmic protein precursor [Actinobacillus
           pleuropneumoniae L20]
 gi|165975630|ref|YP_001651223.1| thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|303250923|ref|ZP_07337114.1| thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303251998|ref|ZP_07338169.1| thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307247161|ref|ZP_07529212.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307249386|ref|ZP_07531378.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307251705|ref|ZP_07533609.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|307256200|ref|ZP_07537987.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307260632|ref|ZP_07542324.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|126096454|gb|ABN73282.1| thiamine-binding periplasmic protein precursor [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165875731|gb|ABY68779.1| thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|302649428|gb|EFL79613.1| thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302650229|gb|EFL80394.1| thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306856299|gb|EFM88451.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306858572|gb|EFM90636.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306860791|gb|EFM92800.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306865381|gb|EFM97277.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306869709|gb|EFN01494.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 321

 Score =  279 bits (714), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 143/333 (42%), Positives = 203/333 (60%), Gaps = 16/333 (4%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCEL 62
           K A+I      +TGV           +P L VYTY+SF +D G  PK++  FE +C C++
Sbjct: 2   KLAKIAALSAFVTGV-------AYAQQPTLVVYTYDSFSSDWGPAPKLEPLFEAQCQCDV 54

Query: 63  KLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
           K +   DG+ +LN++R+EG+ + AD++LG DN  +  A KTGLFA  +++ +    P+ W
Sbjct: 55  KFMPFEDGITMLNRIRLEGKKTKADVMLGIDNFTMAEAEKTGLFAMHDLNLA----PLNW 110

Query: 123 DDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
           ++  F PYDY   AF+YDK ++  PPK+  EL+   +  K+IYQDPRTST+G GLL W+ 
Sbjct: 111 ENKTFYPYDYSEYAFVYDKEKLANPPKSLKELVER-QDLKVIYQDPRTSTVGRGLLFWLN 169

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV 242
            +YG+ + Q W+ +A  T TV KGW+E+Y  FLKGESD VLSYSTSP ++  +   D YV
Sbjct: 170 TVYGEQAEQAWQTLAKHTVTVGKGWSETYSAFLKGESDLVLSYSTSPLYHQWHDKTDKYV 229

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDV 302
           AA F EGH +Q EVAA L  SKQ  LA++F+ F+  P  Q+++   N M PVV  S+PD 
Sbjct: 230 AAQFDEGHLVQTEVAAILNSSKQKALAKQFLAFLHQPEAQKVISYHNVMKPVVG-SVPDS 288

Query: 303 YQAIRIPQKSLRFNAEETTRYRN---QWISSWQ 332
                   K L F   + T+ ++    W  SWQ
Sbjct: 289 AFDKLPAYKPLAFKMPDATQVKSWLATWTKSWQ 321


>gi|307244986|ref|ZP_07527083.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|307253939|ref|ZP_07535791.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258394|ref|ZP_07540135.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306854151|gb|EFM86359.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306863143|gb|EFM95085.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867578|gb|EFM99425.1| Thiamine-binding periplasmic protein [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 321

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 205/333 (61%), Gaps = 16/333 (4%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCEL 62
           K A+I      +TGV +Y        +P L VYTY+SF +D G  PK++  FE +C C++
Sbjct: 2   KLAKIAALSAFVTGV-TYAQ------QPTLVVYTYDSFSSDWGPAPKLEPLFEAQCQCDV 54

Query: 63  KLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
           K +   DG+ +LN++R+EG+ + AD++LG DN  +  A KTGLFA  +++ +    P+ W
Sbjct: 55  KFMPFEDGITMLNRIRLEGKKTKADVMLGIDNFTMAEAEKTGLFAMHDLNLA----PLNW 110

Query: 123 DDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
           ++  F PYDY   AF+YDK ++  PPK+  EL+   +  K+IYQDPRTST+G GLL W+ 
Sbjct: 111 ENKTFYPYDYSEYAFVYDKEKLANPPKSLKELVER-QDLKVIYQDPRTSTVGRGLLFWLN 169

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV 242
            +YG+ + Q W+ +A  T TV KGW+E+Y  FLKGESD VLSYSTSP ++  +   D YV
Sbjct: 170 TVYGEQAEQAWQTLAKHTVTVGKGWSETYSAFLKGESDLVLSYSTSPLYHQWHDKTDKYV 229

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDV 302
           AA F EGH +Q EVAA L  SKQ  LA++F+ F+  P  Q+++   N M PVV  S+PD 
Sbjct: 230 AAQFDEGHLVQTEVAAILNSSKQKALAKQFLAFLHQPEAQKVISYHNVMKPVVG-SVPDS 288

Query: 303 YQAIRIPQKSLRFNAEETTRYRN---QWISSWQ 332
                   K L F   + T+ ++    W  SWQ
Sbjct: 289 AFDKLPAYKPLAFKMPDATQVKSWLATWTKSWQ 321


>gi|254437968|ref|ZP_05051462.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Octadecabacter antarcticus 307]
 gi|198253414|gb|EDY77728.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Octadecabacter antarcticus 307]
          Length = 328

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 213/340 (62%), Gaps = 15/340 (4%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MK     V G++  T  ++    DG    PVLTVY  + F ++ G GP I+ AFE +C+C
Sbjct: 1   MKTTLITVAGLLFGTAALA----DG--HTPVLTVYAPDYFGSEWGPGPSIEAAFEERCSC 54

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           +L+         LL +L +EG  + AD+ +GF++++   AR +GLFA   +D S L LPI
Sbjct: 55  DLQY----QTGDLLPRLLLEGTRTEADVAIGFNSDITKRARDSGLFAPHGLDLSPLTLPI 110

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            WDDD F+P++YG+ AFIYD  ++     +F+ L+N+    +I+ QDPR+S  GL L+LW
Sbjct: 111 DWDDDTFLPFNYGHTAFIYDNTKLDGF-DSFEALLNAPDDVRIVIQDPRSSISGLALVLW 169

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           +Q +YGD +   W ++A K  TVT+GW+ESYG F  GE+D VLSY+TSP ++++      
Sbjct: 170 VQAVYGDEAEAAWLRLAPKIVTVTQGWSESYGLFTDGEADVVLSYTTSPAYHIIAEEDLT 229

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISM- 299
             AA+F EGHY  +E+AA+L  + QP+LA EFM F+++  FQ ++PTTNW +P   + M 
Sbjct: 230 KSAAIFDEGHYFMVELAAKLATTDQPELADEFMAFILTEDFQTMIPTTNWSFPAA-LPMD 288

Query: 300 --PDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
             P+ +Q + +P+  L +  +E    R+  I +W++A+S+
Sbjct: 289 QWPEGFQDLPMPETVLFYTEDEAAALRDGAIEAWRSALSQ 328


>gi|126728142|ref|ZP_01743958.1| thiamin transporter subunit [Sagittula stellata E-37]
 gi|126711107|gb|EBA10157.1| thiamin transporter subunit [Sagittula stellata E-37]
          Length = 328

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 202/309 (65%), Gaps = 7/309 (2%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           VLTVY  + FV++ G GPKI++ FE +C C+L+         LL ++ +EGE + AD+V+
Sbjct: 25  VLTVYAPDYFVSEWGPGPKIEELFEAQCGCDLQF----KPGELLPRIMLEGERTGADVVI 80

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G + ++   AR++GLFA   +D S L LP+ W DD+F+P++YG+ AF+YD  ++ +PP +
Sbjct: 81  GLNTDVTKKARESGLFAPHGVDLSPLTLPLDWTDDVFLPFNYGHTAFVYDATKM-EPPAS 139

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
            + +    +  +I+ QDPRTS  GL L+LWI+ +YGD +   W+ +A    TVTKGW+ES
Sbjct: 140 LEAMETLPEDVRIVIQDPRTSISGLALVLWIKSVYGDEAGAFWEALAPNIVTVTKGWSES 199

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           YG F  GE+D VLSY+TSP ++++  G +   AA+F EGHY  +E+AA++  S QP+LAQ
Sbjct: 200 YGLFTDGEADMVLSYTTSPVYHIIAEGDETKKAAIFPEGHYFMVELAAKVAGSDQPELAQ 259

Query: 271 EFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           +FM F++S  FQ ++ T NW +P        P+ +Q + +P++ + ++ +E    R++ I
Sbjct: 260 QFMDFILSRDFQSMIATGNWSFPAALPRDEWPEGFQKLDLPEEVIFYSEDEAAALRDEAI 319

Query: 329 SSWQNAVSR 337
             W+ A+SR
Sbjct: 320 EEWRRALSR 328


>gi|315634575|ref|ZP_07889860.1| thiamine ABC superfamily ATP binding cassette transporter, binding
           protein [Aggregatibacter segnis ATCC 33393]
 gi|315476802|gb|EFU67549.1| thiamine ABC superfamily ATP binding cassette transporter, binding
           protein [Aggregatibacter segnis ATCC 33393]
          Length = 334

 Score =  276 bits (707), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 134/341 (39%), Positives = 216/341 (63%), Gaps = 11/341 (3%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCN- 59
           MKK   I+  + +  G     T+     +  + +YTY+SF +D GAGPK+KQAFE++   
Sbjct: 1   MKKTTLILTALSLCAG-----TVLANHHEETVNIYTYDSFTSDWGAGPKVKQAFEQQFPL 55

Query: 60  CELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLP 119
           C++  +    G  L N++R+EG  + ADIVLG DN ++D A+K+ LF  +N+D S+L LP
Sbjct: 56  CKVNYVPFESGGTLFNRVRLEGHKTKADIVLGLDNFVLDEAKKSHLFDANNVDLSKLSLP 115

Query: 120 IKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLL 179
            +W D+ F+PYD+G  AF+YDK ++  PPK+  EL+   +  ++IYQDPRTS++G GLL+
Sbjct: 116 NQWTDNTFLPYDFGTYAFVYDKNKVKNPPKSLKELVER-EDLRVIYQDPRTSSVGRGLLV 174

Query: 180 WIQKIY-GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQ 238
           W+  +Y  D  AQ W+++A  T TV KGW+++YG FLKGE+D VLSY+TSP ++ L   +
Sbjct: 175 WMNTVYSADQVAQAWQQLAKHTVTVGKGWSDTYGAFLKGEADVVLSYTTSPLYHQLFENK 234

Query: 239 DDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS 298
           ++Y A  F+EG+ +Q+E+AA++   K  Q A  FM F+++P  Q+ + T N M+PV+   
Sbjct: 235 ENYAATTFAEGNVMQVELAARIAEHKN-QCADHFMDFLVTPEAQKQIVTANVMFPVIQAP 293

Query: 299 MPDVYQAIR--IPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +   + A++  + ++S    +  +      WI  WQ  +++
Sbjct: 294 VEPHFDALKENVLKQSFLNTSNVSPEMLRSWIHQWQTTLTK 334


>gi|294678219|ref|YP_003578834.1| thiamine ABC transporter periplasmic thiamin-binding protein
           [Rhodobacter capsulatus SB 1003]
 gi|294477039|gb|ADE86427.1| thiamine ABC transporter, periplasmic thiamin-binding protein
           [Rhodobacter capsulatus SB 1003]
          Length = 329

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 131/328 (39%), Positives = 201/328 (61%), Gaps = 11/328 (3%)

Query: 12  MMITGVISYCTLDGLPA----KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
           M    +++ C L   P     KPVLTVY  + F ++ G GP I++ FE  C C+L+ +  
Sbjct: 1   MKTALMLAGCVLAATPVLAGDKPVLTVYAPDYFTSEWGPGPAIEKGFEADCGCDLQFVAG 60

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
                +L +L +EG  + AD+ +G + ++   AR TGLFA  + D S+L LPI W DD F
Sbjct: 61  D----VLPRLMLEGAKTEADVAIGLNTDITARARATGLFAPHHQDLSRLSLPIAWADDTF 116

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDPRTSTLGLGLLLWIQKIYG 186
           +P+D+  +AF+YDK ++T PP++F  L+++    +KI  +DPR+ST GL LLLW++ IYG
Sbjct: 117 LPFDWSEVAFVYDKTKLTAPPQSFAALLDAPDDAFKIALEDPRSSTAGLALLLWVKHIYG 176

Query: 187 DNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF 246
           D + + W K+A K  TVT  W+E+YG F +GE+D VLS++TSP ++ +    D   AA+F
Sbjct: 177 DKAGEAWAKLAPKVLTVTPDWSEAYGLFTEGEADMVLSFTTSPAYHRIAEQDDSKAAAIF 236

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQ 304
            EGHY   E+AAQL  S QP+LAQ+FM +++S  FQ ++ T NW YPV++    +P+ + 
Sbjct: 237 PEGHYFYTELAAQLKTSDQPELAQKFMDYILSDGFQGMIATANWSYPVIEKPGFLPEGFA 296

Query: 305 AIRIPQKSLRFNAEETTRYRNQWISSWQ 332
            +  P K+  +   E    R   +  W+
Sbjct: 297 TLPRPAKTFFYTETEAEALRGPALEEWR 324


>gi|310817241|ref|YP_003965205.1| thiamin transporter substrate binding subunit [Ketogulonicigenium
           vulgare Y25]
 gi|308755976|gb|ADO43905.1| thiamin transporter substrate binding subunit [Ketogulonicigenium
           vulgare Y25]
          Length = 328

 Score =  275 bits (703), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 142/339 (41%), Positives = 206/339 (60%), Gaps = 13/339 (3%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           M+K A +    ++IT  ++      L   PVLT+YTY+SF ++ G GP +K AFE +C C
Sbjct: 1   MRKTAALASAGLIITAGVA------LADTPVLTIYTYDSFTSEWGPGPAVKAAFEAECAC 54

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
            +  +   DG ALL +L+MEG  S ADI+LG D NL   A  TGLFA   +    + LPI
Sbjct: 55  TVDFVAAGDGAALLARLQMEGGTSDADILLGLDTNLTASAVATGLFAPHGV-TPDVDLPI 113

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            WDD  F+PYD+ + A I   R+    P +F  L +S     +I  DPR+ST GLGLL+W
Sbjct: 114 AWDDPTFLPYDWSHFALI--GREGGPAPASFRALADSDA--SVIIMDPRSSTPGLGLLMW 169

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           ++  YGD + Q+W  +A    TVT GW+E +G FL+GE+D VLSYSTSP + ++      
Sbjct: 170 VKAAYGDEAGQIWADLADNIVTVTPGWSEGWGLFLEGEADLVLSYSTSPAYNIVVDNDHS 229

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV--DIS 298
             A  FSEGHY+Q+EVA +L  S QP LA +F++FM++P+FQ  +P TNWMYP V  +  
Sbjct: 230 LRALPFSEGHYMQVEVAGKLAGSDQPALADQFLRFMLTPAFQSAIPETNWMYPAVMPEGG 289

Query: 299 MPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           + + +  +  P+ SL  + +E    R+  +  W++A+S+
Sbjct: 290 LGEGWSTLLQPEVSLLLSPDEAQALRSAAVDEWRDALSQ 328


>gi|240947941|ref|ZP_04752368.1| thiamine-binding periplasmic protein [Actinobacillus minor NM305]
 gi|240297735|gb|EER48194.1| thiamine-binding periplasmic protein [Actinobacillus minor NM305]
          Length = 330

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/319 (41%), Positives = 198/319 (62%), Gaps = 5/319 (1%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
            +L     KPVL VYTY+SF +  G   ++++ FE+ C C+++ +   +GV +LN++R+E
Sbjct: 15  TSLSAFAEKPVLNVYTYDSFASKYGPAAELEKLFEKDCECDVRFLPFENGVTMLNRVRLE 74

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G  + AD+V+G DN     A K+GLF++ N+    L LP  W   IF PYDY   AFIY+
Sbjct: 75  GNKTKADVVVGIDNFTQPEAEKSGLFSEHNLTLQDLSLPTIWQSSIFYPYDYSEYAFIYN 134

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD--NSAQVWKKIAT 198
           K ++  PP +  EL+   +  K+IYQDPRTST+G G L+W+ +      N ++ W+K+A 
Sbjct: 135 KEKLKNPPTSLKELMER-QDLKVIYQDPRTSTVGRGFLVWVNQALSSKGNISEFWEKLAK 193

Query: 199 KTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
            T T+ KGW+E+YG +LKGE+D VLSY+TSP ++      D  VAA+F EGH +QIE+AA
Sbjct: 194 HTVTIGKGWSETYGAYLKGEADLVLSYTTSPLYHQWYENDDKNVAAIFEEGHLMQIELAA 253

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE 318
            L  SKQ  LAQ+F++F+  P  QRI+   N M PV+   +  +  A  +P+  +  N +
Sbjct: 254 ILKSSKQKVLAQQFLRFLHQPEAQRIIAKANIMKPVISGEIDPLLTA--LPKIKVLENQQ 311

Query: 319 ETTRYRNQWISSWQNAVSR 337
             +    QW++ WQ AVSR
Sbjct: 312 PNSEVIRQWLNDWQKAVSR 330


>gi|251792308|ref|YP_003007033.1| thiamin/thiamin pyrophosphate ABC transporter [Aggregatibacter
           aphrophilus NJ8700]
 gi|247533700|gb|ACS96946.1| thiamin/thiamin pyrophosphate ABC transporter [Aggregatibacter
           aphrophilus NJ8700]
          Length = 333

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 136/332 (40%), Positives = 218/332 (65%), Gaps = 8/332 (2%)

Query: 11  IMMITGV-ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCN-CELKLIGLS 68
           I+  T +  S   L G  A+ V  +YTY+SF +D GAGPKIKQ FE+K   C++  +   
Sbjct: 5   ILFFTALSFSTAVLAGQQAQNV-NIYTYDSFTSDWGAGPKIKQGFEQKYPLCKVNYMPFE 63

Query: 69  DGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFV 128
            G  L N++R+EG  + ADIVLG DN +++ A+K+ LF  +++D S+L LP +W D+ F+
Sbjct: 64  SGGTLFNRVRLEGHKTKADIVLGLDNFVLEEAKKSKLFDINHVDLSKLSLPTQWQDNTFL 123

Query: 129 PYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GD 187
           PYD+G  AF+YDK ++  PPK+  EL+   +  ++IYQDPRTS++G GLL+W+  +Y  +
Sbjct: 124 PYDFGTYAFVYDKDKVKNPPKSLKELVER-EDLRVIYQDPRTSSVGRGLLVWMNTVYPAE 182

Query: 188 NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
             AQ W+++A  T TV KGW+++YG FLKGE+D VLSYSTSP ++ L   +++Y A  F+
Sbjct: 183 QVAQAWQQLAKHTVTVGKGWSDTYGAFLKGEADVVLSYSTSPLYHQLFENKENYAATQFA 242

Query: 248 EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR 307
           EG+ +Q+E+AA++V  K  Q A +FM ++I+P  Q+ + + N M+PV+  ++   + A++
Sbjct: 243 EGNVMQVELAARVVEHKN-QCADQFMAYLITPEAQKHIVSANVMFPVIQEAVEPHFDALK 301

Query: 308 IP--QKSLRFNAEETTRYRNQWISSWQNAVSR 337
               Q++    +  T+    +WIS WQ  +++
Sbjct: 302 AQKLQETFLDTSAATSNALKRWISQWQTTLTK 333


>gi|325577901|ref|ZP_08148134.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Haemophilus parainfluenzae
           ATCC 33392]
 gi|325160331|gb|EGC72458.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Haemophilus parainfluenzae
           ATCC 33392]
          Length = 332

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 202/314 (64%), Gaps = 6/314 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A   L VYTY+SF AD  AGPK+K AFE++   C+L  +   +   L N++R+EG+   A
Sbjct: 21  APQTLDVYTYDSFSADWSAGPKVKAAFEQQFPQCKLNYVAFDNNGTLFNRVRLEGKKIKA 80

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           D+VLG D+  I+ A+K  +F  + +D SQL+LPIKW++  F+P+DY   AFIYDK ++T 
Sbjct: 81  DVVLGLDSYQIEDAQKLNIFEPNKVDLSQLRLPIKWENHTFLPFDYAQYAFIYDKNKLTN 140

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +  K++YQDPRTS++G GLLLW+  +Y   + A  WK ++  T TVTK
Sbjct: 141 PPKSLKELV-ERQDLKVLYQDPRTSSIGRGLLLWMNAVYPAADVANAWKTLSKHTVTVTK 199

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GWTESYG FLKGE D VLS +TSP +++L+  +D+YVA  F+EG  LQ+EVAA+ V ++ 
Sbjct: 200 GWTESYGAFLKGEGDLVLSVNTSPIYHILSEQKDNYVATEFAEGSVLQVEVAAK-VANRN 258

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF--NAEETTRY 323
              A EF+ F++SP  Q  +   N M PVV+ ++     A+    KS+R       T+  
Sbjct: 259 NACADEFLGFLLSPQAQADIAKNNVMLPVVETNIESHIDALNSRAKSMRILDTTTVTSEQ 318

Query: 324 RNQWISSWQNAVSR 337
              WI+ WQ A+S+
Sbjct: 319 LKGWINQWQKALSK 332


>gi|322515235|ref|ZP_08068233.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Actinobacillus ureae ATCC
           25976]
 gi|322118740|gb|EFX90946.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Actinobacillus ureae ATCC
           25976]
          Length = 321

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/325 (41%), Positives = 203/325 (62%), Gaps = 14/325 (4%)

Query: 14  ITGVISYC-TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVA 72
           +  + ++C     +   PVLTVYTY+SF +  G  PK+++ FE++C C+++ +   DG+ 
Sbjct: 6   LLALSAWCFAAHAMAQTPVLTVYTYDSFTSKWGPAPKLEELFEKQCQCDVRFLPFEDGIT 65

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDY 132
           + N++R+EG+ + AD++LG DN  ++ A+K+G F +  +          W +++F PYDY
Sbjct: 66  MFNRIRLEGKKTKADVMLGIDNFTMEEAQKSGFFIEHELTVEDFP----WQNEVFFPYDY 121

Query: 133 GYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV 192
              AFIY+K ++ QPP++  EL+   +  K+IYQDPRTST+G GLL W+  +YGD +   
Sbjct: 122 SEYAFIYNKEKLAQPPRSLKELVER-QDLKVIYQDPRTSTVGRGLLFWVNSVYGDKAEDA 180

Query: 193 WKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYL 252
           WK +A  T TV KGW+E+YG FLKGESD VLSY+TSP ++  +   D YVAA F EGH +
Sbjct: 181 WKTLAKHTVTVGKGWSETYGAFLKGESDLVLSYATSPLYHQWHEKTDKYVAAQFEEGHLV 240

Query: 253 QIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ-K 311
           Q EVAA    SKQ  LA++F+QF+     Q ++   N M PVV       ++A  +P+ K
Sbjct: 241 QTEVAAITKVSKQKALAKQFLQFLHQAQAQNVISYHNVMKPVVGTDAVPAFKA--LPEYK 298

Query: 312 SLRF--NAEETTRYRNQWISSWQNA 334
            L F   + ET R   +W++SWQ +
Sbjct: 299 QLAFIQPSSETVR---KWLASWQQS 320


>gi|254462992|ref|ZP_05076408.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Rhodobacterales bacterium
           HTCC2083]
 gi|206679581|gb|EDZ44068.1| thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin
           pyrophospate-binding protein [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 325

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 197/310 (63%), Gaps = 7/310 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P L VYTY+SFV+D G GP +++AFE +C C+LK +G  DG +LL ++++EG  + ADIV
Sbjct: 21  PELVVYTYDSFVSDWGPGPAVEKAFEAECGCDLKFVGAGDGASLLARVKLEGARTEADIV 80

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG D NL   A  T LFA   + A +  LPI W+D  FVP+D+GY AF++  +     P 
Sbjct: 81  LGLDTNLTAAAAATELFAPHGVSA-EYNLPIAWEDANFVPFDWGYFAFVH--KDGVDAPT 137

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           NF  L  S    KI+ QDPR+ST GLGLL+W++  Y D +  +W+ ++    TVTKGW+E
Sbjct: 138 NFKALGESEL--KIVIQDPRSSTPGLGLLMWVKVAYSDEAPAIWESLSDNIVTVTKGWSE 195

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FL+GE+D  LSY+TSP ++L+      + AA F EGHY+QIEVA +L  S Q  LA
Sbjct: 196 AYGLFLEGEADMALSYTTSPAYHLIAEEDAGFAAAAFEEGHYMQIEVAGKLASSDQQDLA 255

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDIS--MPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
            +F+ FM+   FQ I+PTTNWMYP V  +  +   ++ +  P K L   A +    R++ 
Sbjct: 256 DQFLAFMVGEGFQTIIPTTNWMYPAVTPAGGLHKGFETLVTPSKPLVVPAADAPAIRDEA 315

Query: 328 ISSWQNAVSR 337
           ++ W  A+S+
Sbjct: 316 LAEWLTALSK 325


>gi|148826348|ref|YP_001291101.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae PittEE]
 gi|229846065|ref|ZP_04466177.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 7P49H1]
 gi|148716508|gb|ABQ98718.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae PittEE]
 gi|229811069|gb|EEP46786.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 7P49H1]
          Length = 332

 Score =  272 bits (696), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 202/313 (64%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF+++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFISEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N    T   
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPMVNTEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|254452276|ref|ZP_05065713.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Octadecabacter antarcticus 238]
 gi|198266682|gb|EDY90952.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Octadecabacter antarcticus 238]
          Length = 328

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 135/341 (39%), Positives = 211/341 (61%), Gaps = 17/341 (4%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MK     V G++  T  ++    DG    PVLTVY  + F ++ G GP I+ AFE +C C
Sbjct: 1   MKTTLITVTGLLFGTAALA----DG--HTPVLTVYAPDYFGSEWGPGPSIEAAFEERCEC 54

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           +L+         LL +L +EG  + AD+ +GF++++   AR +G+FA   +D S L LPI
Sbjct: 55  DLQY----QTGDLLPRLLLEGARTEADVAIGFNSDITKQARDSGMFAPHGLDLSPLTLPI 110

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            W+DD F+P++YG+ AFIYD  ++     +F+ L+N+    +I+ QDPR+S  GL L+LW
Sbjct: 111 DWNDDTFLPFNYGHTAFIYDNTKLDGF-DSFEALLNAPDDVRIVIQDPRSSISGLALVLW 169

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           +Q +YGD +   W ++A K  TVT+GW+ESYG F  GE+D VLSY+TSP ++++   +DD
Sbjct: 170 VQAVYGDEAEAAWLRLAPKIVTVTQGWSESYGLFTDGEADVVLSYTTSPAYHII--AEDD 227

Query: 241 YV--AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV--D 296
               AA+F EGHY  +E+AA+L  + QP LA EFM F+++  FQ ++PTTNW +P     
Sbjct: 228 LTKSAAIFEEGHYFMVELAAKLATTDQPDLADEFMAFILTEEFQTMIPTTNWSFPAALPV 287

Query: 297 ISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
              P+ +Q + +P+    ++  E    R+  I +W++A+S+
Sbjct: 288 EQWPEGFQDLPMPETVFFYDENEAAALRDTAIEAWRSALSQ 328


>gi|145632393|ref|ZP_01788128.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus
           influenzae 3655]
 gi|145634183|ref|ZP_01789894.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus
           influenzae PittAA]
 gi|229843933|ref|ZP_04464074.1| putative aldolase [Haemophilus influenzae 6P18H1]
 gi|144987300|gb|EDJ93830.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus
           influenzae 3655]
 gi|145268627|gb|EDK08620.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus
           influenzae PittAA]
 gi|229812927|gb|EEP48615.1| putative aldolase [Haemophilus influenzae 6P18H1]
          Length = 332

 Score =  271 bits (693), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 201/313 (64%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF+++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFISEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +  ++IYQDPRTS++G GLL+W+  +Y  D     WK +   T TV K
Sbjct: 142 PPKSLKELVER-QDLRVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKNLDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|16272953|ref|NP_439179.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae Rd KW20]
 gi|260580108|ref|ZP_05847938.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Haemophilus influenzae
           RdAW]
 gi|1174615|sp|P44984|THIB_HAEIN RecName: Full=Thiamine-binding periplasmic protein; Flags:
           Precursor
 gi|1574048|gb|AAC22678.1| thiamin ABC transporter, periplasmic-binding protein (tbpA)
           [Haemophilus influenzae Rd KW20]
 gi|260093392|gb|EEW77325.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Haemophilus influenzae
           RdAW]
          Length = 332

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 134/313 (42%), Positives = 201/313 (64%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFTSEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N    T   
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPMVNTEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|148828187|ref|YP_001292940.1| putative aldolase [Haemophilus influenzae PittGG]
 gi|148719429|gb|ABR00557.1| putative aldolase [Haemophilus influenzae PittGG]
          Length = 332

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 201/313 (64%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF+++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFISEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTMNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|261867837|ref|YP_003255759.1| thiamin/thiamin pyrophosphate ABC transporter [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413169|gb|ACX82540.1| thiamin/thiamin pyrophosphate ABC transporter [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 334

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 204/313 (65%), Gaps = 6/313 (1%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAAD 87
           K  + +YTY+SF +D GAGPK+KQAFE+    C +  +    G  L N++R+EG  + AD
Sbjct: 24  KENVNIYTYDSFTSDWGAGPKLKQAFEQNFPRCVVNYMPFESGGTLFNRVRLEGHKTKAD 83

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DN ++D A+K+ LF  + +D S+L LP +W D+ F+PYD+G  AF+YDK ++  P
Sbjct: 84  IVLGLDNFVLDEAKKSNLFDVNKVDLSKLSLPSQWADNSFLPYDFGTYAFVYDKNKLKNP 143

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTKG 206
           PK+  EL+   +  ++IYQDPRTS++G GLL+W+  +Y  +  AQ W+++A  T TV KG
Sbjct: 144 PKSLKELVER-EDLRVIYQDPRTSSVGRGLLVWMNAVYPAEQVAQAWQQLAKHTVTVGKG 202

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQP 266
           W+++YG FLKGE+D VLSYSTSP ++ L+  +D+Y A  F+EG+  Q+E+AA++   K  
Sbjct: 203 WSDTYGAFLKGEADLVLSYSTSPLYHQLSENKDNYAATEFAEGNLTQVELAARIAEHKN- 261

Query: 267 QLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI--RIPQKSLRFNAEETTRYR 324
           Q A +FM F+I+P  Q+ + T N M PV+   +   + A+  ++ ++S    +  T    
Sbjct: 262 QCADQFMDFLITPEAQKHIVTANVMLPVIHAPVEPHFNALKEKLLRQSFLNTSNVTPEAL 321

Query: 325 NQWISSWQNAVSR 337
             WIS WQ  +++
Sbjct: 322 RSWISQWQTTLTQ 334


>gi|145628038|ref|ZP_01783839.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 22.1-21]
 gi|145640685|ref|ZP_01796268.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus
           influenzae R3021]
 gi|144979813|gb|EDJ89472.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae 22.1-21]
 gi|145274611|gb|EDK14474.1| 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Haemophilus
           influenzae 22.4-21]
          Length = 332

 Score =  270 bits (691), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 200/313 (63%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF+++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFISEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK +   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKNLDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|145638162|ref|ZP_01793772.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae PittII]
 gi|145272491|gb|EDK12398.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae PittII]
 gi|309751319|gb|ADO81303.1| Thiamin ABC transporter, periplasmic-binding protein [Haemophilus
           influenzae R2866]
          Length = 332

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 200/313 (63%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFTSEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|68249592|ref|YP_248704.1| thiamine-binding periplasmic protein [Haemophilus influenzae
           86-028NP]
 gi|68057791|gb|AAX88044.1| thiamine-binding periplasmic protein [Haemophilus influenzae
           86-028NP]
          Length = 332

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 200/309 (64%), Gaps = 5/309 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + ADIVL
Sbjct: 26  VNVYSYDSFTSEWGAGPKVKQDFEKAHPQCTINFTPFESVGVLLNRVRLEGKKTKADIVL 85

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  PPK+
Sbjct: 86  GLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWTNKTFLPFDFGNYAFVYDKTKLQNPPKS 145

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTE 209
             EL+   +  ++IYQDPRTS++G GLL+W+  IY ++  Q  WK +   T TV KGW++
Sbjct: 146 LKELVER-QDLRVIYQDPRTSSVGRGLLVWMNVIYPEDKIQSAWKNLDKHTVTVGKGWSD 204

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +   Q A
Sbjct: 205 TYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHPNQCA 263

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYRNQWI 328
            +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N          WI
Sbjct: 264 DDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTPINPTVNAEQLKNWI 323

Query: 329 SSWQNAVSR 337
           S+WQ  +++
Sbjct: 324 STWQTTLTK 332


>gi|301156591|emb|CBW16062.1| thiamin transporter subunit [Haemophilus parainfluenzae T3T1]
          Length = 332

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 202/314 (64%), Gaps = 6/314 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A   L VYTY+SF AD  AGPK+K AFE++   C+L  +   +   L N++R+EG+   A
Sbjct: 21  APQTLDVYTYDSFSADWSAGPKVKAAFEQQFPQCKLNYVAFDNNGTLFNRVRLEGKKIKA 80

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           D+VLG D+  I+ A+K  +F  + +D S L+LPIKW++  F+P+DY   AFIYDK ++T 
Sbjct: 81  DVVLGLDSYQIEDAQKLNIFEPNKVDLSLLRLPIKWENHTFLPFDYAQYAFIYDKNKLTN 140

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD-NSAQVWKKIATKTATVTK 205
           PPK+  EL+   +  K++YQDPRTS++G GLLLW+  +Y + + A  WK ++  T TVTK
Sbjct: 141 PPKSLKELV-ERQDLKVLYQDPRTSSIGRGLLLWMNVVYPEADVANAWKTLSKHTVTVTK 199

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GWTESYG FLKGE D VLS +TSP +++L+  +D+YVA  F+EG  LQ+EVAA+ V ++ 
Sbjct: 200 GWTESYGAFLKGEGDVVLSVNTSPIYHILSEQKDNYVATEFAEGSVLQVEVAAK-VANRN 258

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF--NAEETTRY 323
              A EF+ F++SP  Q  +   N M PVV+ ++     A+    KS+R       T+  
Sbjct: 259 NACADEFLGFLLSPQAQADIAKNNVMLPVVETNIESHIDALNSRAKSMRILDTTTVTSEQ 318

Query: 324 RNQWISSWQNAVSR 337
              WI+ WQ A+S+
Sbjct: 319 LKGWINQWQKALSK 332


>gi|260581914|ref|ZP_05849710.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Haemophilus influenzae
           NT127]
 gi|260095107|gb|EEW78999.1| thiamin/thiamine pyrophosphate ABC transporter, thiamin/thiamine
           pyrophospate-binding protein [Haemophilus influenzae
           NT127]
          Length = 332

 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 136/329 (41%), Positives = 205/329 (62%), Gaps = 7/329 (2%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSDG 70
           ++ T + S   L   P    + VY+Y+SF ++ GAGPK+KQ FE+    C +        
Sbjct: 8   LISTALFSTAALAQAPQS--VNVYSYDSFTSEWGAGPKVKQDFEKAHPQCTINFTPFESV 65

Query: 71  VALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPY 130
             LLN++R+EG+ + ADIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+
Sbjct: 66  GVLLNRVRLEGKKTKADIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWTNKTFLPF 125

Query: 131 DYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
           D+G  AF+YDK ++  PPK+  EL+   +  ++IYQDPRTS++G GLL+W+  IY ++  
Sbjct: 126 DFGNYAFVYDKTKLQNPPKSLKELVER-QDLRVIYQDPRTSSVGRGLLVWMNVIYPEDKI 184

Query: 191 Q-VWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEG 249
           Q  WK +   T TV KGW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EG
Sbjct: 185 QSAWKNLDKHTVTVGKGWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEG 244

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIP 309
           H  Q+E+AA++      Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ 
Sbjct: 245 HITQVELAARVANHPN-QCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQ 303

Query: 310 QK-SLRFNAEETTRYRNQWISSWQNAVSR 337
           QK     N          WIS+WQ  +++
Sbjct: 304 QKMQTPINPTVNPEQLKNWISTWQTTLTK 332


>gi|260913625|ref|ZP_05920101.1| thiamin/thiamin pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Pasteurella dagmatis ATCC
           43325]
 gi|260632164|gb|EEX50339.1| thiamin/thiamin pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Pasteurella dagmatis ATCC
           43325]
          Length = 346

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 201/312 (64%), Gaps = 10/312 (3%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           L VYTY+SF +D GAGPK+K +FE+    C++      D   + N+LR+EG+ + AD+V+
Sbjct: 39  LNVYTYDSFTSDWGAGPKVKASFEKAHPQCQVNFTAFGDSGTMFNRLRLEGKKTKADVVV 98

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DN  ++ A K+GLF K+N+D +QL LPI+W +  F+PYD+G  AFIYDK ++  PPK+
Sbjct: 99  GLDNYALEEAEKSGLFTKNNVDLAQLSLPIEWKNQTFLPYDFGQFAFIYDKTKVQNPPKS 158

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTE 209
             EL+   +  K+IYQDPRTS++G GLL+W+  +Y  N  +  WK +A  T TV KGW++
Sbjct: 159 LKELVER-QDLKVIYQDPRTSSVGRGLLIWMNSVYPQNEVENAWKSLAKHTVTVGKGWSD 217

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FLKGE+D V+SYSTSP ++L+   +D YVA   SEG  LQ+E AA+++  +    A
Sbjct: 218 TYGAFLKGEADLVVSYSTSPLYHLVFEQKDQYVATELSEGGVLQVETAAKVI-DRNNACA 276

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQ--- 326
             F+ F++    Q+ L T+N M PV+   +   + A++  +K L+    +T++   +   
Sbjct: 277 DHFLSFLVQSEAQQHLVTSNVMLPVIHSKIEPHFDALK--EKQLKAKVLDTSKVTAEQLK 334

Query: 327 -WISSWQNAVSR 337
            WI+ WQ  +++
Sbjct: 335 NWIAVWQATLTK 346


>gi|145630115|ref|ZP_01785897.1| putative aldolase [Haemophilus influenzae R3021]
 gi|144984396|gb|EDJ91819.1| putative aldolase [Haemophilus influenzae R3021]
          Length = 332

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 199/313 (63%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYESFTSEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGTFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|309973493|gb|ADO96694.1| Thiamin ABC transporter, periplasmic-binding protein [Haemophilus
           influenzae R2846]
          Length = 332

 Score =  269 bits (688), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 200/309 (64%), Gaps = 5/309 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + ADIVL
Sbjct: 26  VNVYSYDSFTSEWGAGPKVKQDFEKAHPQCTINFTPFESVGVLLNRVRLEGKKTKADIVL 85

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  PPK+
Sbjct: 86  GLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWTNKTFLPFDFGNYAFVYDKTKLQNPPKS 145

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTE 209
             EL+   +  ++IYQDPRTS++G GLL+W+  IY ++  Q  WK +   T TV KGW++
Sbjct: 146 LKELVER-QDLRVIYQDPRTSSVGRGLLVWMNVIYPEDKIQSAWKNLDKHTVTVGKGWSD 204

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
           +YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +   Q A
Sbjct: 205 TYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHPNQCA 263

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYRNQWI 328
            +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N          WI
Sbjct: 264 DDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTPINPTVNPEQLKNWI 323

Query: 329 SSWQNAVSR 337
           S+WQ  +++
Sbjct: 324 STWQTTLTK 332


>gi|293392017|ref|ZP_06636351.1| thiamin/thiamine pyrophosphate ABC transporter [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952551|gb|EFE02670.1| thiamin/thiamine pyrophosphate ABC transporter [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 334

 Score =  268 bits (686), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 203/313 (64%), Gaps = 6/313 (1%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAAD 87
           K  + +YTY+SF +D GAGPK+KQAFE+    C +  +    G  L N++R+EG  + AD
Sbjct: 24  KENVNIYTYDSFTSDWGAGPKLKQAFEQNFPRCVVNYMPFESGGTLFNRVRLEGHKTKAD 83

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           IVLG DN ++D A+K+ LF  + +D S+L LP +W D+ F+PYD+G  AF+YDK ++  P
Sbjct: 84  IVLGLDNFVLDEAKKSNLFDVNKVDLSKLSLPSQWADNSFLPYDFGTYAFVYDKNKLKNP 143

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTKG 206
           PK+  EL+   +  ++IYQDPRTS++G GLL+W+  +Y  +   Q W+++A  T TV KG
Sbjct: 144 PKSLKELVER-EDLRVIYQDPRTSSVGRGLLVWMNAVYPAEQVVQAWQQLAKHTVTVGKG 202

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQP 266
           W+++YG FLKGE+D VLSYSTSP ++ L+  +D+Y A  F+EG+  Q+E+AA++   K  
Sbjct: 203 WSDTYGAFLKGEADLVLSYSTSPLYHQLSENKDNYAATEFAEGNLTQVELAARIAEHKN- 261

Query: 267 QLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI--RIPQKSLRFNAEETTRYR 324
           Q A +FM F+I+P  Q+ + T N M PV+   +   + A+  ++ ++S    +  T    
Sbjct: 262 QCADQFMDFLITPEAQKHIVTANVMLPVIHAPVEPHFNALKEKLLRQSFLNTSNVTPEAL 321

Query: 325 NQWISSWQNAVSR 337
             WIS WQ  +++
Sbjct: 322 RSWISQWQTTLTQ 334


>gi|319775059|ref|YP_004137547.1| thiamine-binding periplasmic protein [Haemophilus influenzae F3047]
 gi|317449650|emb|CBY85856.1| thiamine-binding periplasmic protein [Haemophilus influenzae F3047]
          Length = 332

 Score =  268 bits (685), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 199/313 (63%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFTSEWGAGPKVKQDFEKAHPQCTINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+F  +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFVPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|319897481|ref|YP_004135678.1| thiamine-binding periplasmic protein [Haemophilus influenzae F3031]
 gi|329123031|ref|ZP_08251602.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Haemophilus aegyptius ATCC
           11116]
 gi|317432987|emb|CBY81358.1| thiamine ABC transporter periplasmic-binding protein [Haemophilus
           influenzae F3031]
 gi|327471962|gb|EGF17402.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Haemophilus aegyptius ATCC
           11116]
          Length = 332

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 199/313 (63%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFTSEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KT +FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTAIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK++   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK+    N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|15602241|ref|NP_245313.1| TbpA [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720623|gb|AAK02460.1| TbpA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 334

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/328 (39%), Positives = 203/328 (61%), Gaps = 14/328 (4%)

Query: 18  ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNK 76
           +S  +L        + VYTY+SF ++ GAGPK+K+AFE     C++      D   + N+
Sbjct: 13  LSTLSLSVFAQTQAVNVYTYDSFTSEWGAGPKVKKAFETHFPQCQVNFTAFGDSGTMFNR 72

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA 136
           LR+EG+ + AD+V+G DN  ++ A K+GLF +  +D + L LP++W +  F+PYD+G  A
Sbjct: 73  LRLEGKKTKADVVVGLDNYNLEEAEKSGLFVQHKVDLTPLSLPVEWKNQTFLPYDFGQFA 132

Query: 137 FIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKK 195
           FIYDK ++ QPPK+  EL+      K+IYQDPRTS++G GLL+W+  +Y +N  AQ W+K
Sbjct: 133 FIYDKTKVQQPPKSLKELVER-DDLKVIYQDPRTSSVGRGLLIWMNHVYTENEVAQAWQK 191

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
           +A  T TV KGW+++YG FLKGE+D VLSY+TSP ++++   +D Y+A  F EG  LQIE
Sbjct: 192 LAKHTVTVGKGWSDTYGAFLKGEADVVLSYNTSPLYHMVFEQKDQYLATEFEEGGVLQIE 251

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ----- 310
            AA++ +      A  F+ F+I P  Q  L   N M PV++ ++   + A++  Q     
Sbjct: 252 TAARVAQHDN-HCADHFLAFLIHPEAQGHLVKNNVMLPVINTNIEPHFDALKATQMNTKV 310

Query: 311 -KSLRFNAEETTRYRNQWISSWQNAVSR 337
             + + NAE+  +    WI+ WQ  +++
Sbjct: 311 LDTSKVNAEQVKK----WIAVWQTTLTQ 334


>gi|301169775|emb|CBW29376.1| thiamin transporter subunit [Haemophilus influenzae 10810]
          Length = 332

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 198/313 (63%), Gaps = 5/313 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSDGVALLNKLRMEGENSAA 86
           A+  + VY+Y+SF ++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22  AQQSVNVYSYDSFTSEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           DIVLG DN  ++ A KTG+FA +N+D +QL LP KW +  F+P+D+G  AF+YDK ++  
Sbjct: 82  DIVLGLDNFFLEQAEKTGIFAPNNVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQN 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTK 205
           PPK+  EL+   +   +IYQDPRTS++G GLL+W+  +Y  D     WK +   T TV K
Sbjct: 142 PPKSLKELVER-QDLSVIYQDPRTSSVGRGLLVWMNAVYPADKIQSAWKNLDKHTVTVGK 200

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
           GW+++YG FLKGE+D VLSYSTSP ++ L   +D+Y A  F+EGH  Q+E+AA+ V +  
Sbjct: 201 GWSDTYGAFLKGEADLVLSYSTSPLYHQLFEKKDNYAATDFAEGHITQVELAAR-VANHP 259

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQK-SLRFNAEETTRYR 324
            Q A +FM F+ISP+ Q+ + T N M PV+   +   + A+++ QK     N        
Sbjct: 260 NQCADDFMAFLISPTAQKHIVTANIMLPVIQGEIEPHFDALKVQQKMQTPINPTVNPEQL 319

Query: 325 NQWISSWQNAVSR 337
             WIS+WQ  +++
Sbjct: 320 KNWISTWQTTLTK 332


>gi|261493334|ref|ZP_05989860.1| putative thiamine ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496599|ref|ZP_05992979.1| putative thiamine ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261307802|gb|EEY09125.1| putative thiamine ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261310978|gb|EEY12155.1| putative thiamine ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 317

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 193/306 (63%), Gaps = 8/306 (2%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           +P LTVYTY+SF ++ G  PK++Q FE++C C++K + L D V + N+LR+EG  + AD+
Sbjct: 19  QPTLTVYTYSSFASEYGPAPKLEQNFEKECGCDVKFVPLDDSVTMFNRLRLEGAKTKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           V+G DN L   A K+GLFA+      + K  ++    IF PYD G  AFIYDK ++  PP
Sbjct: 79  VVGIDNFLQPEAEKSGLFAEF-----EAKTKLETQQKIFFPYDTGSYAFIYDKEKLKNPP 133

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+   +  K+IYQDPRTS++G G L+W+ ++YGD +   WK +A  T TV KGW+
Sbjct: 134 KSLKELVER-QDLKVIYQDPRTSSVGRGFLMWVNQVYGDEAPTAWKTLAKHTVTVGKGWS 192

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++  +   D YVAA F EGH +Q+E AA +  S+Q  L
Sbjct: 193 ETYGAFLKGESDLVLSYTTSPLYHKWHENTDKYVAAPFEEGHLVQVENAAIVKSSQQKAL 252

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           A +F++F+  P  Q I+   N M PV+   +   + A+    K++ F    TT    +W+
Sbjct: 253 ANQFLEFLHKPESQHIISYHNVMNPVLTDGVDPAFAAMPT-YKTIEFTP-PTTETIQKWL 310

Query: 329 SSWQNA 334
           + W  +
Sbjct: 311 ADWSKS 316


>gi|257464915|ref|ZP_05629286.1| thiamine-binding periplasmic protein [Actinobacillus minor 202]
 gi|257450575|gb|EEV24618.1| thiamine-binding periplasmic protein [Actinobacillus minor 202]
          Length = 330

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/319 (39%), Positives = 197/319 (61%), Gaps = 5/319 (1%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
            +L     KPVL VYTY+SF +  G   +++  FE+ C C+++ +   +GV +LN++R+E
Sbjct: 15  TSLSAFAEKPVLNVYTYDSFASKYGPAAELETLFEKDCECDVRFLPFENGVTMLNRVRLE 74

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD 140
           G  + AD+V+G DN     A K+GLFA++++    L LP  W    F PYDYG  AFIY+
Sbjct: 75  GNKTKADVVVGIDNFTQPEAEKSGLFAENDLTTQDLSLPFMWKSHTFYPYDYGEYAFIYN 134

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD--NSAQVWKKIAT 198
           K ++  PP +  EL+   +  ++IYQDPRTST+G G L+W+ +      N ++ W+K+A 
Sbjct: 135 KEKLKNPPTSLKELMER-QDLRVIYQDPRTSTVGRGFLVWVNQALSSKGNISEFWEKLAK 193

Query: 199 KTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
            T T+ KGW+E+YG +LKGE+D VLSY+TSP ++      D  VAA+F EGH +Q+E+AA
Sbjct: 194 HTVTIGKGWSETYGAYLKGEADLVLSYTTSPLYHQWYENDDKNVAAIFEEGHLVQVELAA 253

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE 318
            L  S Q  LAQ+F++F+  P  Q+I+   N M PV+   +     A  +P+ ++  N +
Sbjct: 254 ILKSSSQKALAQQFLRFLHKPESQKIIAKANIMKPVISGDLDPKLSA--LPKINILDNQQ 311

Query: 319 ETTRYRNQWISSWQNAVSR 337
             +     W+++WQ AV++
Sbjct: 312 PNSDVIRNWLATWQQAVTK 330


>gi|255263024|ref|ZP_05342366.1| thiamine-binding periplasmic protein [Thalassiobium sp. R2A62]
 gi|255105359|gb|EET48033.1| thiamine-binding periplasmic protein [Thalassiobium sp. R2A62]
          Length = 340

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/339 (37%), Positives = 201/339 (59%), Gaps = 15/339 (4%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MK     V G+M  T  ++          PVLTVY  + F ++ G GP I+ AFE +C C
Sbjct: 15  MKYVLTSVAGLMFATTAVA--------DTPVLTVYAPDYFGSEWGPGPAIEAAFEAECAC 66

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           +L+ +       +L +L +EG  + AD V+G + ++   AR++ LF    +D + L +PI
Sbjct: 67  DLEFVTGD----VLPRLLLEGARTDADAVIGLNTDVTKKARESELFGPHGLDTTDLTMPI 122

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
           +W DD FVP+++ Y+AFIYD  +I  PP +FD L+      K++ QDPR+S  GL LLLW
Sbjct: 123 EWTDDTFVPFNWSYVAFIYDNTKIDTPPTSFDALLEMADV-KLVIQDPRSSASGLALLLW 181

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
           ++ +YG  +   W+K+A +  TVT+GW+E+YG F  GE+D VLSY+TSP ++L+      
Sbjct: 182 VKAVYGKEAGAAWEKMAPQILTVTQGWSEAYGMFTDGEADMVLSYTTSPAYHLIAEDDAT 241

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDIS- 298
             AA+F EGHY   EV  ++  + QP+L  +FM F++S +FQ I+P  NW +P  +D S 
Sbjct: 242 KSAAIFDEGHYFMAEVVGKIATTDQPELTDQFMAFILSEAFQSIIPEGNWSFPAKLDASR 301

Query: 299 MPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +P+ +  + +P+ ++ ++  E    R   +  W  A+SR
Sbjct: 302 LPEKFGLLGMPETAIFYDENEADALREPALDEWLAALSR 340


>gi|254360649|ref|ZP_04976798.1| possible thiamine ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica PHL213]
 gi|153091189|gb|EDN73194.1| possible thiamine ABC superfamily ATP binding cassette transporter,
           binding protein [Mannheimia haemolytica PHL213]
          Length = 302

 Score =  263 bits (671), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 126/278 (45%), Positives = 181/278 (65%), Gaps = 6/278 (2%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           +P LTVYTY+SF ++ G  PK++Q FE++C C++K + L D V + N+LR+EG  + AD+
Sbjct: 19  QPTLTVYTYSSFASEYGPAPKLEQNFEKECGCDVKFVPLDDSVTMFNRLRLEGAKTKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           V+G DN L   A K+GLFA+      + K  ++    IF PYD G  AFIYDK ++  PP
Sbjct: 79  VVGIDNFLQPEAEKSGLFAEF-----EAKTKLETQQKIFFPYDTGSYAFIYDKEKLKNPP 133

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL+   +  K+IYQDPRTS++G G L+W+ ++YGD +   WK +A  T TV KGW+
Sbjct: 134 KSLKELVER-QDLKVIYQDPRTSSVGRGFLMWVNQVYGDEAPTAWKTLAKHTVTVGKGWS 192

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQL 268
           E+YG FLKGESD VLSY+TSP ++  +   D YVAA F EGH +Q+E AA +  S+Q  L
Sbjct: 193 ETYGAFLKGESDLVLSYTTSPLYHKWHENTDKYVAAPFEEGHLVQVENAAIVKSSQQKAL 252

Query: 269 AQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI 306
           A +F++F+  P  Q I+   N M PV+   +   + A+
Sbjct: 253 ANQFLEFLHKPESQHIISYHNVMNPVLTDGVDPAFAAM 290


>gi|113461156|ref|YP_719224.1| thiamine ABC transporter periplasmic-binding protein [Haemophilus
           somnus 129PT]
 gi|112823199|gb|ABI25288.1| thiamine ABC transporter, periplasmic-binding protein [Haemophilus
           somnus 129PT]
          Length = 338

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 138/330 (41%), Positives = 201/330 (60%), Gaps = 12/330 (3%)

Query: 11  IMMITGVISYCTLDGLPAKPV--LTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGL 67
           I      +S C+     AK    LTVYTY SF +D GAGPK+KQ FE++   C +  +  
Sbjct: 8   IFTALSAMSICSFAQAEAKSAQGLTVYTYKSFSSDWGAGPKVKQGFEQQYPQCRVNYVSF 67

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
                L N+LR+EG+ + ADIVLG  N+L+  A K+ LF++  +D ++L LPI W D  F
Sbjct: 68  DSSGVLFNRLRLEGKKTKADIVLGLSNHLLQEAIKSELFSEHKVDLNRLSLPISWQDRRF 127

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +PYD+G+ AFIYDK ++  PP++  EL+   +  ++IYQDPRTS++G GL++W+  +Y  
Sbjct: 128 LPYDFGHYAFIYDKTKLVNPPQSLQELVER-QDLRVIYQDPRTSSVGRGLIIWLNLVYPQ 186

Query: 188 NSA-QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF 246
               + W+ +A  T TV KGWTESYG FLKGE+D VLSYSTSP ++LLN  +D Y A  F
Sbjct: 187 QEVDRAWQTLAKHTVTVGKGWTESYGAFLKGEADLVLSYSTSPLYHLLNEQKDQYQATDF 246

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI 306
           +EG  LQ+E+AA++  +K+      FM ++ISP  Q  +   N M  V+   +   Y A+
Sbjct: 247 AEGGVLQVELAAKIA-NKENACGDLFMDYLISPQAQTHIVKNNVMLSVISDPIEPHYDAL 305

Query: 307 RIPQ------KSLRFNAEETTRYRNQWISS 330
           +  Q       S   +AE+  ++ NQW +S
Sbjct: 306 KQYQLKTNVFDSSNISAEQLKKWINQWQAS 335


>gi|170717738|ref|YP_001784808.1| thiamine ABC transporter periplasmic binding protein [Haemophilus
           somnus 2336]
 gi|32400318|dbj|BAC78650.1| hypothetical protein [Histophilus somni]
 gi|168825867|gb|ACA31238.1| thiamine ABC transporter, periplasmic binding protein [Haemophilus
           somnus 2336]
          Length = 338

 Score =  259 bits (663), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 138/330 (41%), Positives = 200/330 (60%), Gaps = 12/330 (3%)

Query: 11  IMMITGVISYCTLDGLPAKPV--LTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGL 67
           I      +S C+     AK    LTVYTY SF +D GAGPK+KQ FE++   C +  +  
Sbjct: 8   IFTALSAMSICSFAQAEAKSAQGLTVYTYKSFSSDWGAGPKVKQGFEQQYPQCRVNYVSF 67

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF 127
                L N+LR+EG+ + ADIVLG  N+L+  A K+ LF++  +D ++L LPI W D  F
Sbjct: 68  DSSGVLFNRLRLEGKKTKADIVLGLSNHLLQEAIKSELFSEHKVDLNRLSLPISWQDRRF 127

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +PYD+G+ AFIYDK ++  PP +  EL+   +  ++IYQDPRTS++G GL++W+  +Y  
Sbjct: 128 LPYDFGHYAFIYDKTKLVNPPHSLRELVER-QDLRVIYQDPRTSSVGRGLIIWLNLVYPQ 186

Query: 188 NSA-QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF 246
               + W+ +A  T TV KGWTESYG FLKGE+D VLSYSTSP ++LLN  +D Y A  F
Sbjct: 187 QEVDRAWQTLAKHTVTVGKGWTESYGAFLKGEADLVLSYSTSPLYHLLNEQKDQYQATDF 246

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI 306
           +EG  LQ+E+AA++  +K+      FM ++ISP  Q  +   N M  V+   +   Y A+
Sbjct: 247 AEGGVLQVELAAKIA-NKENACGDLFMDYLISPQAQTHIVKNNVMLSVISDPIEPHYDAL 305

Query: 307 RIPQ------KSLRFNAEETTRYRNQWISS 330
           +  Q       S   +AE+  ++ NQW +S
Sbjct: 306 KQYQLKTNVFDSSNISAEQLKKWINQWQAS 335


>gi|114764183|ref|ZP_01443421.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114543335|gb|EAU46351.1| ABC thiamine transporter, periplasmic substrate-binding protein
           [Roseovarius sp. HTCC2601]
          Length = 302

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 117/309 (37%), Positives = 192/309 (62%), Gaps = 9/309 (2%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           +LTVY  +  V++ G           + + E      +    LL ++ +EGE + AD+V 
Sbjct: 1   MLTVYAGDYVVSEWGPA-------RDRGDVEASAAATAVSPRLLPRILLEGERTEADVVF 53

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
           G + ++   AR++GLFA  N+D S L LPI W DD+F+PY+YG+ AFIY+  ++ +PP++
Sbjct: 54  GLNTDVTKQARESGLFAPHNVDLSPLTLPIDWSDDVFLPYNYGHTAFIYNTERLAEPPES 113

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
           FD L+ +    KI+ QDPR+S  GL  +LW+Q +YGD +   W+K+A K  TVTKGW+ES
Sbjct: 114 FDALLEAPDDLKIVIQDPRSSISGLATVLWVQSVYGDGAEAAWEKLAPKILTVTKGWSES 173

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           YG F  GE+D V+SY+TSP ++++        AA+F EGHY  +E+AA++  + QP+LA 
Sbjct: 174 YGLFTDGEADMVMSYTTSPAYHIIAEEDRTKKAAIFPEGHYFMVELAAKVASTDQPELAD 233

Query: 271 EFMQFMISPSFQRILPTTNWMYPVV--DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWI 328
           +F+ F +S  FQ ++ T NW +P        P+ ++ + +P++ L ++ +E    R++ +
Sbjct: 234 QFLAFTLSEPFQEMIATGNWSFPAALPREQWPEGFKELALPEEVLFYSEDEAAALRDEAV 293

Query: 329 SSWQNAVSR 337
            +W+ A+SR
Sbjct: 294 EAWRRALSR 302


>gi|110677941|ref|YP_680948.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Roseobacter denitrificans OCh 114]
 gi|109454057|gb|ABG30262.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Roseobacter denitrificans OCh 114]
          Length = 326

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 191/312 (61%), Gaps = 10/312 (3%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTVY  + F ++ G GP I+  FE  C C+L+    S G  L+ +L +EG  + AD+V
Sbjct: 21  PVLTVYAGDYFTSEWGPGPMIETGFEEICGCDLQF---STG-DLVPRLLLEGARTKADVV 76

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           +G  +++   AR TGLFA    D   L LP+ W DD F+P++YG+ AF+Y+   +  PP 
Sbjct: 77  MGLTSDVTSKARATGLFAPHGQDNGALTLPVDWTDDTFLPFNYGHAAFVYNTATVANPPA 136

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+ +++     KI+ QDPRTS  GL L+LW+Q ++GD++   W+K+A    TVTK W+ 
Sbjct: 137 SFEAMLDMPDDVKIVIQDPRTSLSGLALVLWVQSVFGDDAGAAWEKLAPNILTVTKDWSA 196

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV--AALFSEGHYLQIEVAAQLVRSKQPQ 267
           SYG F  GE+D VLSY+TSP +++  + +DD+   AA+F EGHY  +E   ++  + QP+
Sbjct: 197 SYGMFTDGEADMVLSYTTSPAYHM--FAEDDFTRKAAIFPEGHYFMVETVGKIAATDQPE 254

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA  FM +++S SFQ  +P  NW  P  +     P+ +  + +P K L ++  + T  + 
Sbjct: 255 LADAFMAYVMSESFQSSIPQANWSLPSALPQDQWPEGWAQLPLPDKVLFYSEADATALQA 314

Query: 326 QWISSWQNAVSR 337
           + I +W+ A+S+
Sbjct: 315 EAIETWRAALSQ 326


>gi|163734429|ref|ZP_02141869.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Roseobacter litoralis Och 149]
 gi|161392437|gb|EDQ16766.1| thiamin ABC transporter, periplasmic thiamin-binding protein
           [Roseobacter litoralis Och 149]
          Length = 316

 Score =  257 bits (656), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 191/312 (61%), Gaps = 10/312 (3%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           PVLTVY  + F ++ G GP I+  FE  C C+L+    S G  L+ +L +EG  + AD+V
Sbjct: 11  PVLTVYAGDYFTSEWGPGPMIETGFEEICGCDLQF---STG-DLVPRLLLEGARTKADVV 66

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           +G  +++   AR TGLFA    D   L LP+ W DD F+P++YG+ AF+Y+   +  PP 
Sbjct: 67  MGLTSDVTSKARATGLFAPHGQDNGALTLPVDWTDDTFLPFNYGHAAFVYNTATVANPPA 126

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +F+ +++     KI+ QDPRTS  GL L+LW+Q ++GD++   W+K+A    TVTK W+ 
Sbjct: 127 SFEAMLDMPDDVKIVIQDPRTSLSGLALVLWVQSVFGDDAGAAWEKLAPNILTVTKDWSA 186

Query: 210 SYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYV--AALFSEGHYLQIEVAAQLVRSKQPQ 267
           SYG F  GE+D VLSY+TSP +++  + +DD+   AA+F EGHY  +E   ++  + QP+
Sbjct: 187 SYGMFTDGEADMVLSYTTSPAYHM--FAEDDFTRQAAIFPEGHYFMVETVGKIAATDQPE 244

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYP--VVDISMPDVYQAIRIPQKSLRFNAEETTRYRN 325
           LA  FM +++S SFQ  +P  NW  P  +     P+ +  + +P K L ++  + T  + 
Sbjct: 245 LADAFMAYVMSQSFQSSIPAANWSLPSALPQDQWPEGWAQLPLPDKVLFYSEADATALQA 304

Query: 326 QWISSWQNAVSR 337
           + I +W+ A+S+
Sbjct: 305 EAIETWRAALSQ 316


>gi|300949919|ref|ZP_07163879.1| thiamine/thiamin pyrophosphate ABC transporter [Escherichia coli MS
           116-1]
 gi|300450701|gb|EFK14321.1| thiamine/thiamin pyrophosphate ABC transporter [Escherichia coli MS
           116-1]
          Length = 191

 Score =  255 bits (652), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 147/191 (76%)

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKG 206
           PP++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKG
Sbjct: 1   PPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKG 60

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQP 266
           W+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP
Sbjct: 61  WSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQP 120

Query: 267 QLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQ 326
           +LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E    R  
Sbjct: 121 ELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAAQRQA 180

Query: 327 WISSWQNAVSR 337
           WIS WQ AVSR
Sbjct: 181 WISEWQRAVSR 191


>gi|330863017|emb|CBX73149.1| thiamine-binding periplasmic protein [Yersinia enterocolitica
           W22703]
          Length = 225

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 145/193 (75%), Gaps = 1/193 (0%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KP LTVYTY+SF AD G GP IK+AFE +C+C+LK + L DGV+LLN+LRMEG+NS AD+
Sbjct: 21  KPTLTVYTYDSFAADWGPGPAIKKAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADV 80

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +LG DNNL+  A +TGLF  S ++ S+L LP KW ++ FVPYDYGY AF+YDK ++  PP
Sbjct: 81  ILGLDNNLVQAAEQTGLFVSSQVNTSKLILPEKWQNNTFVPYDYGYFAFVYDKNKLKNPP 140

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K+  EL++S + WK+IYQDPRTST GLGL+LW+QK      A +      KT TVTKGW+
Sbjct: 141 KSLQELVDSKEQWKVIYQDPRTSTPGLGLMLWMQKCMAIKPASM-AATGEKTVTVTKGWS 199

Query: 209 ESYGFFLKGESDF 221
           E+YG FLKGE  F
Sbjct: 200 EAYGLFLKGEGGF 212


>gi|52425581|ref|YP_088718.1| TbpA protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307633|gb|AAU38133.1| TbpA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 339

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 134/321 (41%), Positives = 197/321 (61%), Gaps = 14/321 (4%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGEN 83
           GL A   L +Y    F AD G  P++K  FER    C++ +        +LN+LR+EG+N
Sbjct: 25  GLSAVQPLHIYAEEYFAADWGPAPEVKAQFERAYPQCQVTIQSFDSRTTMLNRLRLEGKN 84

Query: 84  SAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQ 143
           + ADIVLG DN+ ++ A KTGLFA + +D S+L LP++W +  FVPY++   AFIYDK +
Sbjct: 85  TKADIVLGMDNHQLEAAEKTGLFAPAKVDFSRLSLPVEWKNTTFVPYEFSKYAFIYDKSK 144

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY-GDNSAQVWKKIATKTAT 202
           +T PP++  EL+   +  K+IYQDPRTS++G GLL+W+ KIY  +   + W+++   T T
Sbjct: 145 LTNPPESLKELVER-EDLKVIYQDPRTSSIGRGLLVWMNKIYPPEQVEKAWQQLQKHTLT 203

Query: 203 VTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVR 262
           V KGW+E+YG FLKGE D VLS +TSP ++LL   +++Y A  FSEG  LQI+ A ++  
Sbjct: 204 VGKGWSETYGTFLKGEGDLVLSNNTSPIYHLLTDQKENYAATEFSEGETLQIDFAGKIA- 262

Query: 263 SKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIR--IPQ----KSLRFN 316
            K    A EF+ F++ P  Q I+ T   M PVV+  +   Y A++  + Q     +L  +
Sbjct: 263 GKHNICADEFLAFLLKPEIQNIIITKGVMLPVVEGDLEPHYAALKNAVMQGKTIDTLSVS 322

Query: 317 AEETTRYRNQWISSWQNAVSR 337
           AE+       WI  WQ A+S+
Sbjct: 323 AEQI----KHWIEVWQRALSK 339


>gi|304414706|ref|ZP_07395735.1| periplasmic binding component of thiamine ABC transporter
           [Candidatus Regiella insecticola LSR1]
 gi|304283169|gb|EFL91579.1| periplasmic binding component of thiamine ABC transporter
           [Candidatus Regiella insecticola LSR1]
          Length = 259

 Score =  251 bits (642), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 144/187 (77%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P LTVYTY++F+AD G+G  IK++FE +C+C+LK + L+D ++L N+LRMEG+NS AD+V
Sbjct: 24  PTLTVYTYSAFIADGGSGAAIKKSFELECHCKLKWVALNDSISLFNRLRMEGKNSPADVV 83

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPK 149
           LG DNNL+ +A +TGLF  S ID   L LP  W + IF+PY+YGY AFIY K ++  PPK
Sbjct: 84  LGLDNNLLHIAEQTGLFTSSPIDTQALTLPENWHNKIFIPYNYGYFAFIYHKNKLKNPPK 143

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTE 209
           +  EL+ S+ PW+IIYQDPRTS  GLGLLLW+QK+YG  + Q W+++A KT TVT+ W+E
Sbjct: 144 SLQELVESSTPWRIIYQDPRTSNPGLGLLLWMQKVYGAQAPQAWQQLAKKTVTVTRSWSE 203

Query: 210 SYGFFLK 216
           +YG FLK
Sbjct: 204 AYGLFLK 210



 Score = 53.9 bits (128), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 34/49 (69%)

Query: 289 NWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +WMYP + I++P  + ++ +P K+L++ A+E  + R QWI +WQ AVS 
Sbjct: 211 DWMYPAIKIALPVDFTSLAVPSKALQYPAKEIAKNRLQWIQAWQTAVSH 259


>gi|302338210|ref|YP_003803416.1| thiamine ABC transporter periplasmic protein [Spirochaeta
           smaragdinae DSM 11293]
 gi|301635395|gb|ADK80822.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Spirochaeta smaragdinae DSM 11293]
          Length = 339

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 120/337 (35%), Positives = 189/337 (56%), Gaps = 2/337 (0%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MK++  +++ ++ +  + +       P    +TVYTY+SF+++ G GP+I + F  +   
Sbjct: 1   MKRYLPLLLAVIGVILIATIMVGRTKPETDGITVYTYDSFISEWGPGPEIAKQFTEQSGI 60

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF-AKSNIDASQLKLP 119
            +  +   D    L +L  E E   AD+ +G DNNL   A + G+F + ++ +  ++   
Sbjct: 61  TVNYVAPGDAGQTLQRLINEKEAPVADVAIGIDNNLFPKAEEEGIFLSYTSPELKKVDSS 120

Query: 120 IKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLL 179
           ++++DD+  PYDY   AFI+D +++  PP++F +L +     KII  DPRTST GLGLLL
Sbjct: 121 LRFEDDLLTPYDYSDFAFIWDSQKLENPPQSFADLTDPRFKEKIIIMDPRTSTPGLGLLL 180

Query: 180 WIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD 239
           W +KIYGD     WK  A    TV+  W   YG F  GE+  V+SY+TSP ++L   G +
Sbjct: 181 WSEKIYGDKLFDFWKAFAPNILTVSSSWDTGYGLFTSGEAPLVISYTTSPPYHLEYEGTE 240

Query: 240 DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-IS 298
            Y A +F EGHY+QIE A  +  +KQ + A+ F+ F+IS   Q ++P TNWMYPV +   
Sbjct: 241 RYKALIFPEGHYMQIEGAGVVAGTKQRKAAEAFIDFLISEDAQAVIPLTNWMYPVREGTP 300

Query: 299 MPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           +PD ++    P K L+ N        +  I  W  A+
Sbjct: 301 LPDSFRLAPKPDKQLQINPAPDGTTVDTLIELWTKAL 337


>gi|152978801|ref|YP_001344430.1| thiamine ABC transporter, periplasmic binding protein
           [Actinobacillus succinogenes 130Z]
 gi|150840524|gb|ABR74495.1| thiamine ABC transporter, periplasmic binding protein
           [Actinobacillus succinogenes 130Z]
          Length = 337

 Score =  230 bits (586), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 189/335 (56%), Gaps = 12/335 (3%)

Query: 11  IMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFER-KCNCELKLIGLSD 69
           I  +  V S+  ++   A   L VYT   F AD G G ++K  FE+    C L       
Sbjct: 7   IFSLLSVFSFSVINSAAANAPLQVYTEEFFGADWGPGAEVKALFEQVHPRCRLDYRVFDG 66

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVP 129
              +LN+LR+EG+ + AD+V+G DN   D A KTGLFAK+ ++ + L LP++W +  F+P
Sbjct: 67  RNTMLNRLRLEGKKTKADVVIGLDNFQFDAAEKTGLFAKTAVNLTALSLPVRWTNQTFIP 126

Query: 130 YDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS 189
           Y++G  AFIYDK ++  PP++  EL+   +  ++IYQDPRTS++G G + W+  +Y    
Sbjct: 127 YEFGQFAFIYDKNKLKNPPESLKELVER-QDLRVIYQDPRTSSMGRGFIGWMNVVYPPQR 185

Query: 190 -AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSE 248
             + W+ +A  T TV KGWTE+YG FLKGE+D V S++TSP ++LL   QD Y AA F +
Sbjct: 186 ITEAWRTLAKHTVTVGKGWTETYGAFLKGEADMVFSHNTSPLYHLLKDKQDRYAAARFGD 245

Query: 249 GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRI 308
           G+  Q +  A++   K    A EF+ F++S   Q+I+   N M  +  IS P      ++
Sbjct: 246 GNPYQFDTVAKIA-GKNHVCADEFIDFLLSAEAQKIIIPKNVM--LSSISAPIEPHFDQL 302

Query: 309 PQKSLRFNAEETT------RYRNQWISSWQNAVSR 337
             ++L  N  + T          QWI  WQ  +SR
Sbjct: 303 KAETLNANPTKQTLSVPTDATVKQWIEIWQTELSR 337


>gi|297183034|gb|ADI19180.1| ABC-type thiamine transport system, periplasmic component
           [uncultured delta proteobacterium HF0130_05G09]
          Length = 338

 Score =  225 bits (574), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 115/339 (33%), Positives = 194/339 (57%), Gaps = 13/339 (3%)

Query: 4   FARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
           F+   +G+++++  + +   D       LT+YTY+SF ++ G GP + + FE +C C+LK
Sbjct: 8   FSLWFIGMVLMSPALLWGQAD-------LTLYTYDSFNSEWGPGPVVFKRFEEECECKLK 60

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDASQLKLPI 120
           ++   D  ++LN+  +E  N  AD+VLG +N+ +D + + G+   +    +D     L I
Sbjct: 61  VVAPGDSGSMLNRAILEKNNPRADLVLGINNSELDKSFQYGIWEPYRSPKMDRVPKMLQI 120

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
             +  +  P+DYGY+AF+YD  +I +PP++ ++L       +I+ ++P+TS+ GL +L W
Sbjct: 121 DPEHRV-TPFDYGYIAFVYDSERIKEPPQSLEDLTAPRFLNRIVIENPKTSSPGLSMLHW 179

Query: 181 IQKIYGD-NSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD 239
              +YG+ N    WK++     T+T GW+ +YG F KGE   VLSY TSP ++L     +
Sbjct: 180 TISVYGEENYLDYWKRLKPNLLTITDGWSAAYGMFTKGEVPMVLSYVTSPAYHLEYEKTE 239

Query: 240 DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS- 298
            Y AA F  GHY Q+E+A  L  SK P+ A+EF+ FM+S  FQ  +P TNWM+PV+    
Sbjct: 240 RYRAAEFPNGHYRQVELAGILKGSKNPERAREFIDFMLSEGFQDAIPLTNWMFPVIQYQP 299

Query: 299 MPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +PD ++    P+      +       ++W+  W  ++SR
Sbjct: 300 LPDSFRVAPQPKTVAELASSRVRDQNSKWLKDWSRSMSR 338


>gi|297181163|gb|ADI17359.1| ABC-type thiamine transport system, periplasmic component
           [uncultured delta proteobacterium HF0070_30B07]
          Length = 324

 Score =  222 bits (566), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 111/311 (35%), Positives = 180/311 (57%), Gaps = 6/311 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LT+YTY+SF ++ G GP + + FE +C C++K++   D  ++LN+  +E  N  AD+VLG
Sbjct: 15  LTLYTYDSFNSEWGPGPVVFKRFEEECKCKIKVVAPGDSGSMLNRAILEKNNPRADLVLG 74

Query: 92  FDNNLIDLARKTGL---FAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
            +N+ +D + + G+   +    +D     L I  +  +  P+DYGY+AF+YD  +I +PP
Sbjct: 75  INNSELDKSFQYGIWEPYRSPKMDRVPKMLQIDPEHRV-TPFDYGYIAFVYDSERIQKPP 133

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD-NSAQVWKKIATKTATVTKGW 207
           ++ ++L       +I+ ++P+TS+ GL +L W   +YG+ N    WK++     T+T GW
Sbjct: 134 QSLEDLTAPRFRNRIVIENPKTSSPGLSMLHWTISVYGEENYLDYWKRLKPNLLTITDGW 193

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           + +YG F KGE   VLSY TSP ++L     + Y AA F  GHY Q+E A  L  SK P+
Sbjct: 194 SAAYGMFTKGEVPMVLSYVTSPAYHLEYEKTERYRAAEFPNGHYRQVEFAGILKGSKNPE 253

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVVDIS-MPDVYQAIRIPQKSLRFNAEETTRYRNQ 326
            A+EF+ FM+S  FQ  +P TNWM+PV+    +PD ++    P+              ++
Sbjct: 254 RAREFIDFMLSEGFQDAIPLTNWMFPVIQYQPLPDSFRVAPQPKTVAELAPSRVRDQNSK 313

Query: 327 WISSWQNAVSR 337
           W+  W  ++SR
Sbjct: 314 WLKDWSRSMSR 324


>gi|213422260|ref|ZP_03355326.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 150

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 91/147 (61%), Positives = 124/147 (84%)

Query: 163 IIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFV 222
           +IYQDPRTST GLGLLLW++K+YGDN+ Q W+K+A KT TVTKGW+E+YG FLKGESD V
Sbjct: 1   MIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLV 60

Query: 223 LSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQ 282
           LSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+LA++F++FM+SP+FQ
Sbjct: 61  LSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQ 120

Query: 283 RILPTTNWMYPVVDISMPDVYQAIRIP 309
             +PT NWMYPV D+++P  ++++  P
Sbjct: 121 NAIPTGNWMYPVADVALPAGFESLAKP 147


>gi|323165944|gb|EFZ51724.1| thiamine-binding periplasmic domain protein [Shigella sonnei 53G]
          Length = 160

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 91/143 (63%), Positives = 114/143 (79%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GPKIK+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPKIKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY  F+YDK ++  P
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFTFVYDKNKLKNP 137

Query: 148 PKNFDELINSTKPWKIIYQDPRT 170
           P++  EL+ S + W++IYQDPRT
Sbjct: 138 PQSLKELVESDQNWRVIYQDPRT 160


>gi|315231504|ref|YP_004071940.1| thiamin ABC transporter [Thermococcus barophilus MP]
 gi|315184532|gb|ADT84717.1| thiamin ABC transporter [Thermococcus barophilus MP]
          Length = 355

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/341 (35%), Positives = 195/341 (57%), Gaps = 15/341 (4%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MK  A +++ +M+I G +   + +       L VY Y+SFV+   A   I + FE+  N 
Sbjct: 1   MKNLA-LILALMVIVGGLGCISSNKEQTSKELVVYAYDSFVSWGLANATIPK-FEKMYNV 58

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDASQLK 117
           ++K+I + D   +LN+L +E +N  AD+V+G DNNLI  A + G+   +   NID    +
Sbjct: 59  KVKIITVGDAGEVLNRLILEKDNPRADVVIGIDNNLIAKAIEAGVLEPYKPKNIDVVPKE 118

Query: 118 LPIKWDDDIFV-PYDYGYLAFIYDKRQITQPPKNFDELINSTKP-WK--IIYQDPRTSTL 173
           L    D    V P+DYG++A +Y K +I+ PP++FD+L   TKP WK  +I +DPRTS+ 
Sbjct: 119 LIDALDPTYHVVPFDYGFIAVVYKKSEISNPPQSFDDL---TKPEWKKSLIVEDPRTSST 175

Query: 174 GLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFY 232
           G   LLW   +YGD      W+K+      +TKGW   +  + KGE+   +SY+T P + 
Sbjct: 176 GAAFLLWTIAVYGDPGWLYFWEKLKPNIYQITKGWDAGWEMWDKGEAPLFVSYATDPAYS 235

Query: 233 LLNYGQD-DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWM 291
               G++ D  A +F EG Y QIE    +  +K P LA++F++F++S  FQ+ +P TNWM
Sbjct: 236 AYESGKEPDIGAIIFKEGGYPQIEGIGLVKGAKHPDLAKKFIEFVLSEDFQKEIPLTNWM 295

Query: 292 YPV-VDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           +PV  ++ +PDV++    P K +  + +E  +  ++W+  W
Sbjct: 296 FPVNKNVQLPDVFKYAVKPDKLVSLDPKEIEQNYSRWLEEW 336


>gi|213021558|ref|ZP_03336005.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 151

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 115/148 (77%)

Query: 50  IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKS 109
           +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+VLG DNNL++ A +T LFAKS
Sbjct: 1   MKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKS 60

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
            +    +K+P  W +D FVP+DYGY AF+YDK ++  PPK+  EL+ S + W++IYQDPR
Sbjct: 61  GVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPR 120

Query: 170 TSTLGLGLLLWIQKIYGDNSAQVWKKIA 197
           TST GLGLLLW++K+YGDN+ Q W K  
Sbjct: 121 TSTPGLGLLLWMRKVYGDNAPQAWTKTG 148


>gi|42525662|ref|NP_970760.1| thiamine ABC transporter, thiamine-binding protein [Treponema
           denticola ATCC 35405]
 gi|41815673|gb|AAS10641.1| thiamine ABC transporter, thiamine-binding protein [Treponema
           denticola ATCC 35405]
          Length = 336

 Score =  198 bits (504), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 169/309 (54%), Gaps = 13/309 (4%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + VYT  SF AD G GPKI + F+ K   E++ +   +G+  LN++ +EG+ S AD+++G
Sbjct: 34  VVVYTTKSFAADYGPGPKIAELFKAKTGKEVEYVICKEGI--LNRVILEGKASTADVLIG 91

Query: 92  FDNNLIDLARKTGLF------AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
            DN+LI+ ARK  +       A   ID++ L      DD +  P+DYGY AF++D +   
Sbjct: 92  IDNHLIEKARKAKVLKAYKPTAADKIDSAVLIA----DDWLLTPFDYGYFAFMFDTKAKI 147

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
           + P +  ELI      KI+  DP +ST GLGL  W + ++GDN    WK +      +  
Sbjct: 148 KKPSSLKELIEPAYAKKIVILDPSSSTTGLGLAAWTRAVFGDNYLDFWKALKPNIFAMAP 207

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
            W+  YG+F  GE+   +SY++S   ++L    D +   +F EGH +QIE       +  
Sbjct: 208 KWSTGYGYFTAGEAPIAISYTSSLASHVLYDKTDRFQPLIFEEGHIIQIEGMGIAANAAN 267

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLRFNAEETTRYR 324
            + A+EF+ FM++   Q +LP T +MYPV+  +++P  Y+ +  P K LR  +E+ T   
Sbjct: 268 TKGAKEFIDFMLTEEAQSLLPETQFMYPVIKGLALPASYKDVPKPAKVLRIPSEDQTESV 327

Query: 325 NQWISSWQN 333
           N  I+  Q 
Sbjct: 328 NAVINVLQK 336


>gi|289808446|ref|ZP_06539075.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 151

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 116/151 (76%)

Query: 187 DNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF 246
           DN+ Q W+K+A KT TVTKGW+E+YG FLKGESD VLSY+TSP ++++   +D+Y AA F
Sbjct: 1   DNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANF 60

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI 306
           SEGHYLQ+EVAA+ V SKQP+LA++F++FM+SP+FQ  +PT NWMYPV D+++P  ++++
Sbjct: 61  SEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESL 120

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
             P  +L F  ++    R  WIS WQ AVSR
Sbjct: 121 AKPATTLEFTPQQVAAQRQAWISEWQRAVSR 151


>gi|145636530|ref|ZP_01792198.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae PittHH]
 gi|145270355|gb|EDK10290.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
           influenzae PittHH]
          Length = 227

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 97/229 (42%), Positives = 144/229 (62%), Gaps = 4/229 (1%)

Query: 111 IDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRT 170
           +D +QL LP KW +  F+P+D+G  AF+YDK ++  PPK+  EL+   +   +IYQDPRT
Sbjct: 1   MDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQNPPKSLKELVER-QDLSVIYQDPRT 59

Query: 171 STLGLGLLLWIQKIY-GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSP 229
           S++G GLL+W+  +Y  D     WK +   T TV KGW+++YG FLKGE+D VLSYSTSP
Sbjct: 60  SSVGRGLLVWMNAVYPADKIQSAWKNLDKHTVTVGKGWSDTYGAFLKGEADLVLSYSTSP 119

Query: 230 GFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTN 289
            ++ L   +D+Y A  FSEGH  Q+E+AA+ V +   Q A +FM F+ISP+ Q+ + T N
Sbjct: 120 LYHQLFEKKDNYAATDFSEGHITQVELAAR-VANHPNQCADDFMAFLISPTAQKHIVTAN 178

Query: 290 WMYPVVDISMPDVYQAIRIPQKS-LRFNAEETTRYRNQWISSWQNAVSR 337
            M PV+   +   + A+++ QK+    N          WIS+WQ  +++
Sbjct: 179 IMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQLKNWISTWQTTLTK 227


>gi|325475229|gb|EGC78414.1| thiamine ABC transporter [Treponema denticola F0402]
          Length = 336

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 168/309 (54%), Gaps = 13/309 (4%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + VYT  SF AD G GPKI + F+ K   E++ +   +GV  LN+  +EG+ S AD+++G
Sbjct: 34  VVVYTTKSFAADYGPGPKIAELFKAKTGKEVEYVICKEGV--LNRAILEGKASTADVLIG 91

Query: 92  FDNNLIDLARKTGLF------AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
            DN+LI+ ARK  +       A   ID++ L      DD +  P+DYG+ AF++D +   
Sbjct: 92  IDNHLIEKARKAKVLKAYKPTASDKIDSAVLIA----DDWLLTPFDYGFFAFMFDTKAKI 147

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
           + P +  EL +     KI+  DP +ST GLGL  W + ++GDN    WK +      +  
Sbjct: 148 KKPSSLKELTDPAYVKKIVILDPSSSTTGLGLAAWTRAVFGDNYLDFWKALKPNIFAMAP 207

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQ 265
            W+  YG+F  GE+   +SY++S   ++L    D +   +F EGH +QIE       +  
Sbjct: 208 KWSTGYGYFTAGEAPIAISYTSSLASHVLYDKTDRFQPLIFEEGHIIQIEGMGIAANAAN 267

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLRFNAEETTRYR 324
            + A+EF+ FM++   Q +LP T +MYPV+  +++P  Y+ +  P K LR  +E+ T   
Sbjct: 268 TKGAKEFIDFMLTEEAQSLLPETQFMYPVIKGLALPASYKDVPKPAKVLRIPSEDQTESV 327

Query: 325 NQWISSWQN 333
           N  I+  Q 
Sbjct: 328 NAVINVLQK 336


>gi|332298314|ref|YP_004440236.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Treponema brennaborense DSM 12168]
 gi|332181417|gb|AEE17105.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Treponema brennaborense DSM 12168]
          Length = 338

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 98/267 (36%), Positives = 148/267 (55%), Gaps = 5/267 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + VYTY+SF+++ G GP++ + FE K   +  +I   DG  +L++  +E +   AD+V+G
Sbjct: 33  VVVYTYDSFISEWGPGPELVKLFEAKTGLKCTMIDAGDGAQILSRAMLEKKAPQADVVIG 92

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKW---DDDIFVPYDYGYLAFIYDKRQITQPP 148
            DNN +  ARK  +        +   +P +    DD + +PYD+ Y A IYD       P
Sbjct: 93  IDNNQVQAARKAEVLVPYKPAHADTAVPAELRLSDDWLLIPYDWSYFAMIYDTASNVPAP 152

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
            +  +L       KII  DPRTST GLG + W   ++GD+    WK +     T+  GW+
Sbjct: 153 TSLADLTKPEYAKKIILMDPRTSTPGLGFVAWTAAVFGDSYLDYWKALKPNVLTMAPGWS 212

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD-YVAALFSEGHYLQIEVAAQLVRSKQPQ 267
             YG F  GE+  V+SY+TSP ++ + YG+   + A LF EGH +QIE AA +  +    
Sbjct: 213 TGYGLFTSGEAPLVISYTTSPAYH-VEYGEGARFQAVLFDEGHPIQIEAAAIVKGAPNKS 271

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPV 294
            A+ F+ F+IS   QR++P T WMYPV
Sbjct: 272 GAELFIDFLISEEAQRVIPLTQWMYPV 298


>gi|320537436|ref|ZP_08037385.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Treponema phagedenis F0421]
 gi|320145711|gb|EFW37378.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Treponema phagedenis F0421]
          Length = 339

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 163/293 (55%), Gaps = 4/293 (1%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TVY Y+SF A+ GAGP+I + F+ K    +K + L D   +L +  +E +N  AD+++
Sbjct: 33  TVTVYAYDSFTAEWGAGPEIAKRFKAKTGYTVKYVTLKDSGDVLARAILEKDNPKADVLI 92

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKW---DDDIFVPYDYGYLAFIYDKRQITQP 147
           G DN L   AR   +    + + S   +P ++   +D +  PYDYG+ + +YD +     
Sbjct: 93  GIDNYLASKARAADILEPYHPNVSDTVIPKEYVFEEDWLLSPYDYGFFSIMYDTKAKVSA 152

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGW 207
           P +  +L        ++  DPRTST GLG  +W +  +G++    W+++ +   T+T GW
Sbjct: 153 PNSLSDLTRPEYEKTLVIMDPRTSTPGLGFAVWTKAAFGESYLTFWEQLKSSIITMTPGW 212

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQ 267
           +  Y  F  GE+    SY+TS  +++     D + A +F EGH +QIE    +  +  PQ
Sbjct: 213 SAGYSLFTSGEAAMATSYTTSMAYHVAADKTDRFKALIFPEGHIMQIEGLGLVKGAANPQ 272

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEE 319
            A+ F+ FM+S   Q +LP T WM+P   ++ +P+ ++AI +P+K+L  +A+E
Sbjct: 273 GAKAFIDFMLSKEAQEVLPETQWMFPCSQEVQLPESFKAIPLPKKALTLSAKE 325


>gi|157364154|ref|YP_001470921.1| ABC transporter periplasmic-binding protein [Thermotoga lettingae
           TMO]
 gi|157314758|gb|ABV33857.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermotoga lettingae TMO]
          Length = 328

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 113/340 (33%), Positives = 179/340 (52%), Gaps = 20/340 (5%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MKKF  +V+ I++   V S            L +YTY+SF +  G   K+   FE++ N 
Sbjct: 1   MKKFL-LVLSIIVAVSVFSQE----------LVIYTYSSFAS--GIAQKVLPIFEKQNNV 47

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDASQLK 117
           ++KL+   D   +L +L +E +   AD+V+G D  L+  A   GL   F   NI  S +K
Sbjct: 48  KVKLLSFGDAGNVLARLILEKDQPKADVVIGLDQPLLKRAISEGLLIKFVPENI--SMIK 105

Query: 118 LPIKWDDDIF-VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLG 176
                D   + +P+DYG +A +Y+  +I  PPK+F EL++     K++ QDPRTS+ GL 
Sbjct: 106 NKELLDMRGYGIPFDYGAIALVYNTEKINNPPKSFKELLDERFKRKLVVQDPRTSSTGLS 165

Query: 177 LLLWIQKIYG-DNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLN 235
            +LW   ++G D     WK +     T+T GW E++     GE+D ++SY+T   +    
Sbjct: 166 FMLWTVAVFGEDGFLDYWKSLKNNILTITPGWDEAFSMLETGEADIMVSYATDGAYSYHE 225

Query: 236 YGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           YG   Y+  +  EG ++QIE AA +  SK  +LA++F++F++S  FQ  +P   WMYPVV
Sbjct: 226 YGSLKYLPVVMEEGAFVQIEYAAIVKGSKNIELAKKFIEFVLSKEFQSHVPLNQWMYPVV 285

Query: 296 DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           +I +P  Y+      K L F+     +    W+  W   +
Sbjct: 286 EIELPKAYKYAPKIDKVLPFDYSIFEQKGKDWLEKWAEVM 325


>gi|150021673|ref|YP_001307027.1| ABC transporter periplasmic-binding protein [Thermosipho
           melanesiensis BI429]
 gi|149794194|gb|ABR31642.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermosipho melanesiensis BI429]
          Length = 325

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 101/305 (33%), Positives = 172/305 (56%), Gaps = 5/305 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L VYTY+SFV+  G G ++   FE+   C++ L    D  ++L++L +E +N  AD+++G
Sbjct: 22  LVVYTYDSFVS--GIGYEVVPIFEKMYGCKVDLRSFGDAGSVLSRLILEKQNPKADVIIG 79

Query: 92  FDNNLIDLARKTGLFAK-SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
            D  L+  A K  L  K + I+ S LK P +  ++  VPYD+G +A +Y++  +  PPK+
Sbjct: 80  LDQALLFRAIKENLLEKYTPINKSLLKYP-ELLNEYGVPYDFGAIAIVYNRNTVKNPPKS 138

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
           F +L++     +I+ QDPRTS+ GL  LLW   +Y DN    WKK      T+T GW E+
Sbjct: 139 FSDLLSKKFKNRIVVQDPRTSSTGLSFLLWTIAVYKDNYLDFWKKFKENILTITPGWDEA 198

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           +     GE+D ++SY+T   +   NYG+  YV  +  +G  +QIE A+ +  +K  +LA+
Sbjct: 199 FEMLESGEADIMVSYATDGAYSYHNYGEIIYVPVILDDGACVQIEYASIVKGTKNMELAK 258

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
            F++F++   FQ  +P   WM PV +++ P+ ++ +    K L+   +   + + + +  
Sbjct: 259 RFLEFILMEDFQEKVPLNQWMLPVTEVNTPEAFKYVPQINKILKLEPKIYEK-QEEILKE 317

Query: 331 WQNAV 335
           W   V
Sbjct: 318 WSKEV 322


>gi|160901499|ref|YP_001567080.1| ABC transporter periplasmic-binding protein [Petrotoga mobilis
           SJ95]
 gi|160359143|gb|ABX30757.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Petrotoga mobilis SJ95]
          Length = 325

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 177/336 (52%), Gaps = 19/336 (5%)

Query: 1   MKKFARIV-VGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCN 59
           MK+F  +V + +++ + V S            LTVY Y SF   E     + Q FE    
Sbjct: 1   MKRFFALVGIIVILFSAVFS----------EELTVYVYESFSWIEQG---MLQKFEEMNE 47

Query: 60  CELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDASQL 116
           CE+K++ L D   +L +L +E +N  AD+V+G D +L   A +  L   +   NI+    
Sbjct: 48  CEVKVVKLGDAGNVLTRLVLEKKNPRADVVIGLDQSLAAKAVEEDLLIPYKPKNIENITD 107

Query: 117 KLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLG 176
           K  I   +   +PYDYG +A IYD  +I +  ++F++L        +I QDPR S+ G  
Sbjct: 108 KALIFDPEYYVIPYDYGAIAIIYDPERIEEKLESFEDLTKYKN--SLIIQDPRASSTGQA 165

Query: 177 LLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNY 236
            LLW   +YGD   + W+++     TV+  W +S+  F  GE+  ++SY+T   +    Y
Sbjct: 166 FLLWTIAVYGDEWKEFWERLKPAILTVSPSWDDSFAKFEIGEAPMMVSYATDSAYSQYYY 225

Query: 237 GQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD 296
           G   Y   +  EG Y+QIE A  +  +    LAQ+F++F+++  FQ+ +P   WM+PV+D
Sbjct: 226 GSSKYKVFIPKEGAYVQIEGAGIVKGTDNLDLAQKFIEFLLTEDFQKEIPLNQWMFPVID 285

Query: 297 ISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQ 332
           + +P+VYQ   +P+K L   A+E +    QW+  W+
Sbjct: 286 VELPEVYQYAVVPEKILTIPAQEISNNLEQWLKEWE 321


>gi|217076199|ref|YP_002333915.1| ABC-type thiamine transport system, periplasmic component
           [Thermosipho africanus TCF52B]
 gi|217036052|gb|ACJ74574.1| ABC-type thiamine transport system, periplasmic component
           [Thermosipho africanus TCF52B]
          Length = 325

 Score =  188 bits (478), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 99/305 (32%), Positives = 169/305 (55%), Gaps = 5/305 (1%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L VYTY+SFV+  G G +I   FE+   C+++L+   D   +L++L +E  N  AD+++G
Sbjct: 22  LVVYTYDSFVS--GIGKEIVPIFEKMYGCKVELLSFGDAGTVLSRLMLEKNNPKADVIVG 79

Query: 92  FDNNLIDLARKTGLFAKSNID-ASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKN 150
            D  L+  A +  L  K   +  S LK P  +++    PYD+G +A +Y+K +I  PPK+
Sbjct: 80  LDQALLIRAIENDLVQKFKPENLSLLKYPELYNE-YGTPYDFGAIAIVYNKEKIKNPPKS 138

Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTES 210
           F++L+      KI+ QDPRTS+ GL  LLW    + +     W K      T+T GW E+
Sbjct: 139 FNDLLKDEFRGKIVVQDPRTSSTGLSFLLWTIAAFNEKYLDFWSKFKDNLLTITPGWDEA 198

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           +     GE+D ++SY+T   +    YG   YV  +  EG ++Q+E A+ +  +K  +LA+
Sbjct: 199 FEMLESGEADIMVSYATDGAYSYYYYGDVKYVPVILDEGAFVQVEYASLVKNAKNEELAK 258

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           +F++F++S  FQ  +P   WM PV ++++P+ ++ +   +K L    E+    + + +  
Sbjct: 259 KFIEFLLSDDFQEKVPLNQWMLPVTNVNLPEAFKYVPEIKKVLEIK-EDIYMNQERILKE 317

Query: 331 WQNAV 335
           W   V
Sbjct: 318 WAKEV 322


>gi|330836905|ref|YP_004411546.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Spirochaeta coccoides DSM 17374]
 gi|329748808|gb|AEC02164.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Spirochaeta coccoides DSM 17374]
          Length = 348

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/322 (34%), Positives = 177/322 (54%), Gaps = 7/322 (2%)

Query: 22  TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEG 81
           T  G  ++  LTVY Y+SF+ D GAGP +   FE +   ++ L+   D + +LNK   E 
Sbjct: 28  TPSGTDSRTTLTVYAYDSFLGDWGAGPVVIPPFEERTGIKVNLVSPGDALEVLNKAISER 87

Query: 82  ENSAADIVLGFDNNLIDLARKTGLFAKSNIDA-SQLKLPIKWDD-DIFVPYDYGYLAFIY 139
           E+  ADIVLG  +++   A  + LF      A + +   +++D  +  +P++YG  AF+ 
Sbjct: 88  ESPRADIVLGISDHMSAQALASDLFEVYESTALTHVPDFVRFDKTNRLLPFEYGNFAFMI 147

Query: 140 DKRQIT--QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKI 196
           D  +I+  Q P++  +L       KII  DPRTS++GLGLL+W  +I+G D     W+ +
Sbjct: 148 DTEKISLDQAPRSLRDLTEPRFKDKIILIDPRTSSVGLGLLIWSIQIFGEDGYLGWWQDV 207

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
           A    T+  GW+ +YG F +GE+  V+SYSTSP +++LN     Y A +F EGH    E 
Sbjct: 208 ARNALTIADGWSSAYGLFTEGEAPLVISYSTSPVYHVLNENSTRYRALIFDEGHSATYEG 267

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRF 315
              L  SK  + A++F+ ++++ + Q  L   N MYP   D+ + DVY     P K+L  
Sbjct: 268 IGILKSSKNKEAARQFVDYLLTDA-QEQLAIINSMYPTNEDVELSDVYDWAPKPNKTLSL 326

Query: 316 NAEETTRYRNQWISSWQNAVSR 337
             +   +  ++W++ W  AV+R
Sbjct: 327 APQAIEKNLDRWLTEWTEAVTR 348


>gi|323166119|gb|EFZ51898.1| thiamine-binding periplasmic domain protein [Shigella sonnei 53G]
          Length = 148

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 108/147 (73%)

Query: 191 QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGH 250
           Q W+K+A KT TVTKGW+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGH
Sbjct: 2   QAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGH 61

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ 310
           YLQ+EVAA+   SKQP+LAQ+F+QFM+ P+FQ  +PT NWMYPV +++ P  ++ +  P 
Sbjct: 62  YLQVEVAARTAASKQPELAQKFLQFMVYPAFQNAIPTGNWMYPVANVTQPAGFEQLTKPA 121

Query: 311 KSLRFNAEETTRYRNQWISSWQNAVSR 337
            +L F   E    R  WIS WQ AVSR
Sbjct: 122 TTLEFTPAEVAAQRQAWISEWQRAVSR 148


>gi|212224112|ref|YP_002307348.1| thiamin-binding periplasmic protein precursor [Thermococcus
           onnurineus NA1]
 gi|212009069|gb|ACJ16451.1| thiamin-binding periplasmic protein precursor [Thermococcus
           onnurineus NA1]
          Length = 380

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 167/309 (54%), Gaps = 8/309 (2%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+  LTVY+Y+S    E    +I   FE K   ++ L+ + D   +LN+L +E ++  AD
Sbjct: 25  AQEELTVYSYDSI---EWWMKEIVPIFEEKYGVKVNLVLIGDAGEVLNRLILEKDSPQAD 81

Query: 88  IVLGFDNNLIDLARKTGL---FAKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQ 143
           +V+G DN+ +  A   G+   +   N D     +  K+D    + PYDYGY+A  Y K  
Sbjct: 82  VVVGIDNSYLAKAIDAGVLEPYKPENADVIPDWIIEKFDPTFHLTPYDYGYIAINYRKDM 141

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATV 203
           +  PP + ++LI      K+I +DPRTS+ G+  LLW   +YGD+    W+K+      +
Sbjct: 142 VQNPPTSLEDLIKPEWKGKLIIEDPRTSSPGMAFLLWTIAVYGDDWLYYWEKLKENDVQI 201

Query: 204 TKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRS 263
            +GW+ ++G F KGE   VLSY+TSP   +      +  A  F EG+YLQIE A  +  +
Sbjct: 202 VEGWSAAWGAFTKGEYPLVLSYATSPAATVYYENNTNIGAVAFKEGNYLQIEGAGIVKGA 261

Query: 264 KQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAEETTR 322
           K P+LA++F++F+IS   Q  LP   WMYPV  ++ +P+V+Q      K +  +  E  +
Sbjct: 262 KHPELAKKFIEFLISEEAQEKLPVNQWMYPVNKNVQLPEVFQYAVEVDKPVTVDPAEIEK 321

Query: 323 YRNQWISSW 331
               W+  W
Sbjct: 322 NYEAWLKQW 330


>gi|12018071|gb|AAG45399.1|AF307053_14 putative solute binding lipoprotein [Thermococcus litoralis]
          Length = 357

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 190/347 (54%), Gaps = 24/347 (6%)

Query: 1   MKKFARIVVGIMMIT---GVISYC---TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAF 54
           MK+FA +++G+++I    G I+     T   +  +  L +Y+Y+SF   E    ++   F
Sbjct: 1   MKRFA-VILGLLLIATTLGCITQSQTSTESTVKEEQKLVIYSYDSF---EYLASEVIPKF 56

Query: 55  ERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNI 111
           E K   +++L  + D   +LN+L +E +N  AD+V+G DN+L+  A + G+   +   NI
Sbjct: 57  EEKYGVKVELQLIGDAGEVLNRLILEKDNPRADLVIGIDNSLLAKAIEAGILEPYKPENI 116

Query: 112 DASQLKLPIKWDDDIF--VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
           +     L     D  F   PYDYGY+A  Y +  +  PPK+ ++L       K++ +DPR
Sbjct: 117 NLVPENLIF---DPTFHLTPYDYGYIAINYREDMVQNPPKSLEDLTKPEWKGKLVIEDPR 173

Query: 170 TSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           TS+ G   LLW   +YGD+     W+K+      + KGWTE++  F+ GE   VLSY+TS
Sbjct: 174 TSSPGAAFLLWTIAVYGDDGYLYYWEKLKENDVHIVKGWTEAWTAFMNGEFPLVLSYATS 233

Query: 229 PGFYLLNYGQDDYVAAL-FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
           P   +  Y    YV A+ F EG+Y+QIE A  +  +K  +LA++F++FM++  FQ  +PT
Sbjct: 234 PAATVY-YDNITYVKAIAFEEGNYMQIEGAGIVKGAKNKELAKKFIEFMLTEDFQSAIPT 292

Query: 288 TNWMYPV-VDISMPDVYQAIRIPQ--KSLRFNAEETTRYRNQWISSW 331
             WMYPV  ++ +P+V++    P+  K +  + E       +WI  W
Sbjct: 293 NQWMYPVNPNVELPEVFKYALQPEEIKPVTLDPEYVKENFERWIKEW 339


>gi|18978123|ref|NP_579480.1| putative solute binding lipoprotein [Pyrococcus furiosus DSM 3638]
 gi|12018055|gb|AAG45384.1|AF307052_16 putative solute binding lipoprotein [Pyrococcus furiosus]
 gi|18893923|gb|AAL81875.1| putative solute binding lipoprotein [Pyrococcus furiosus DSM 3638]
          Length = 357

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 190/347 (54%), Gaps = 24/347 (6%)

Query: 1   MKKFARIVVGIMMIT---GVISYC---TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAF 54
           MK+FA +++G+++I    G I+     T   +  +  L +Y+Y+SF   E    ++   F
Sbjct: 1   MKRFA-VILGLLLIATTLGCITQSQTSTESTVKEEQKLVIYSYDSF---EYLASEVIPKF 56

Query: 55  ERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNI 111
           E K   +++L  + D   +LN+L +E +N  AD+V+G DN+L+  A + G+   +   NI
Sbjct: 57  EEKYGVKVELQLIGDAGEVLNRLILEKDNPRADLVIGIDNSLLAKAIEAGVLEPYKPENI 116

Query: 112 DASQLKLPIKWDDDIF--VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
           +     L     D  F   PYDYGY+A  Y +  +  PPK+ ++L       K++ +DPR
Sbjct: 117 NLVPENLIF---DPTFHLTPYDYGYIAINYREDMVQNPPKSLEDLTKPEWKGKLVIEDPR 173

Query: 170 TSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           TS+ G   LLW   +YGD+     W+K+      + KGWTE++  F+ GE   VLSY+TS
Sbjct: 174 TSSPGAAFLLWTIAVYGDDEYLYYWEKLKENDVHIVKGWTEAWTAFMNGEFPLVLSYATS 233

Query: 229 PGFYLLNYGQDDYVAAL-FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
           P   +  Y    YV A+ F EG+Y+QIE A  +  +K  +LA++F++FM++  FQ  +PT
Sbjct: 234 PAATVY-YDNITYVKAIAFEEGNYMQIEGAGIVKGAKNKELAKKFIEFMLTEDFQSAIPT 292

Query: 288 TNWMYPV-VDISMPDVYQAIRIPQ--KSLRFNAEETTRYRNQWISSW 331
             WMYPV  ++ +P+V++    P+  K +  + E       +WI  W
Sbjct: 293 NQWMYPVNPNVELPEVFKYALQPEEIKPVTLDPEYVKENFERWIKEW 339


>gi|14521007|ref|NP_126482.1| thiamine-binding periplasmic protein precursor [Pyrococcus abyssi
           GE5]
 gi|5458224|emb|CAB49713.1| Thiamine-binding periplasmic protein precursor [Pyrococcus abyssi
           GE5]
          Length = 352

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 183/344 (53%), Gaps = 12/344 (3%)

Query: 1   MKKFARIVVGIMMIT---GVISYCT-LDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFER 56
           MK+  + +V I+++    G I   T  +       LTVY Y+S    E    ++   FE+
Sbjct: 1   MKRMKKAIVPILIVLLALGCIGGKTETETKVENKELTVYAYDSL---EYWLKEVIPEFEK 57

Query: 57  KCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDA 113
           + N ++ L+ +     L+N+L +E +N  AD+V+G DN  +  A +  +   +   N D 
Sbjct: 58  EYNAKVNLVLVGSTGELVNRLILEKDNPKADVVVGIDNTFLAKAIEADVLEPYKPKNADV 117

Query: 114 SQLKLPIKWDDDI-FVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTST 172
               +   +D +    P+DYG+LAF Y    + +PPK+ ++L       KII +DPRTS+
Sbjct: 118 IPEWIIKSFDPEFRLTPFDYGFLAFNYRTDLVKEPPKSLEDLTKPEWRGKIIIEDPRTSS 177

Query: 173 LGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFY 232
            GL  +LW   +Y D   + W K+      + KGW+ ++G F +GE   VLSY+TSP   
Sbjct: 178 PGLAFMLWTIAVYKDKWLEYWAKLRDNEIQIVKGWSAAWGAFSEGEYPVVLSYATSPAAT 237

Query: 233 LLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMY 292
           +    + +  A  F EG++LQIE A  +  +K  +LA++F++F+IS   Q  LPTT WMY
Sbjct: 238 VYYDNKTNVRAIEFKEGNFLQIEGAGIVKGTKNKELAEKFIEFLISEKAQEKLPTTQWMY 297

Query: 293 PV-VDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           PV  ++ +P+VY+     +K +  + +E     N+W+  W+  V
Sbjct: 298 PVNKNVKLPEVYKYALKVEKPVTIDPKEVQENLNKWLKQWEEVV 341


>gi|18977890|ref|NP_579247.1| thiamin-binding periplasmic protein precursor [Pyrococcus furiosus
           DSM 3638]
 gi|18893652|gb|AAL81642.1| thiamin-binding periplasmic protein precursor [Pyrococcus furiosus
           DSM 3638]
          Length = 346

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/336 (33%), Positives = 179/336 (53%), Gaps = 10/336 (2%)

Query: 6   RIVVGIMMITGVI-SYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKL 64
           +IV GI+++  ++ S C       + VLTVY Y+S    E    ++   FE + N ++ L
Sbjct: 3   KIVTGILLVLVLMASGCITSPGEQEKVLTVYAYDSL---EYWLKEVIPEFEEEYNVKVNL 59

Query: 65  IGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK---SNIDASQLKLPIK 121
           + +     L+N+L +E +N  AD+V+G DN  +  A K G+  K    N+D     +  K
Sbjct: 60  VLVGSTGELVNRLIIEKDNPKADVVVGIDNTFMSKAIKAGVLEKYKPRNVDVIPQWIIEK 119

Query: 122 WDDDIFV-PYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
           +D + ++ P+DYGY+AF Y    I   PK+ D+L       KII +DPRTS+ GL  +LW
Sbjct: 120 FDPEFYLTPFDYGYIAFNYRTDLIQDYPKSLDDLTKPEWKGKIIIEDPRTSSPGLAFMLW 179

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
              +Y D     W K+  +   + KGW+ ++  F KGE   VLSY+TSP   +      +
Sbjct: 180 TIAVYKDQWLDYWAKL-RENVQIVKGWSAAWEAFSKGEYPIVLSYATSPAASVYYENNTN 238

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISM 299
             A  F EG++LQIE    +  +K  +LA++F++F+IS   Q  LPTT WMYPV  ++ +
Sbjct: 239 IRAIEFEEGNFLQIEGVGIVKGTKNRELAEKFVEFLISEKAQEKLPTTQWMYPVNKNVKL 298

Query: 300 PDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           P+VY+     +K +  +        ++W+  W   V
Sbjct: 299 PEVYKYALEVKKPVTIDPALVAENLDKWLKQWTEVV 334


>gi|257457839|ref|ZP_05622998.1| thiamine-binding periplasmic protein [Treponema vincentii ATCC
           35580]
 gi|257444552|gb|EEV19636.1| thiamine-binding periplasmic protein [Treponema vincentii ATCC
           35580]
          Length = 339

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 160/306 (52%), Gaps = 4/306 (1%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+ ++ VYTY+SF ++ G G +I + F+ +    +  +   D  ++L+K   E +N  AD
Sbjct: 30  AEKIVVVYTYDSFASEWGPGAEIAKRFKEQTGYTVNYVICEDSGSVLSKAMAEKKNPRAD 89

Query: 88  IVLGFDNNLIDLARKTGL---FAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQI 144
           ++LG +  L+D  R  G+   +   N+D    +  I  DD +  PYD+GY A +YD +  
Sbjct: 90  VLLGINAFLVDKTRSAGVLEPYTSPNLDKVVPQHVIMTDDQLLTPYDWGYFAVMYDTQSK 149

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVT 204
              P++ ++L        ++  DPRTS  GLG   W + +YG++    WK++     T++
Sbjct: 150 VPAPQSLEDLTKPEYAKSLVIMDPRTSAPGLGFAAWTKAVYGNDYLSYWKRLMPSILTMS 209

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSK 264
             W+  YG F  GE+   +SY+TS  +++     D Y A +F EG+ + +E    +  + 
Sbjct: 210 HSWSAGYGLFTAGEAPLAVSYTTSMAYHIRYDKTDRYQALVFDEGNMIALEGMGVVKNAP 269

Query: 265 QPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAEETTRY 323
               AQ F+ FM++   Q +LP T WMYP    + +P+ ++ + +P+KSL  +  E    
Sbjct: 270 HRAAAQAFIDFMLTEKAQEVLPETQWMYPANTAVPLPESFKTVPMPKKSLTISGTEAEAA 329

Query: 324 RNQWIS 329
            +  IS
Sbjct: 330 VDAIIS 335


>gi|254172727|ref|ZP_04879402.1| ABC-type thiamine transport system, periplasmic component
           [Thermococcus sp. AM4]
 gi|214033656|gb|EEB74483.1| ABC-type thiamine transport system, periplasmic component
           [Thermococcus sp. AM4]
          Length = 356

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 106/339 (31%), Positives = 183/339 (53%), Gaps = 13/339 (3%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCE 61
           K  A I++  +++ G+    + +    K  LTVY Y+SF   +         FE++ N +
Sbjct: 4   KTLAGIILVAVLVFGLGCIGSKNEEKPKETLTVYAYDSF---QSVAKVTIPKFEKEYNVK 60

Query: 62  LKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDASQLKL 118
           + L+ L D   +LN+L +E ++  AD+V+G DN+L   A K G+   +   NID    +L
Sbjct: 61  VNLVTLGDAGKVLNRLILEKDHPRADVVIGIDNSLAAKAIKAGVLEVYKPKNIDLVPEEL 120

Query: 119 PIKWDDDIF--VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLG 176
            +K  D  +  +PYDYG +A +Y K ++  PP+ F++L+       +I +DPRTS+ G+ 
Sbjct: 121 -VKGLDPTYHLIPYDYGAIAIVYKKDEVKNPPRTFEDLLKPEWRKSLIVEDPRTSSTGMA 179

Query: 177 LLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGF--YL 233
            LLW    YGD      W+K+  +   +T+GW   +  + KGE+   +SY+T P +  Y 
Sbjct: 180 FLLWTIAAYGDPGWLYYWEKLKPQIYQITEGWDAGWEMWDKGEAPLFVSYATDPAYSAYY 239

Query: 234 LNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYP 293
            N  + +  A L +   Y+QIE    +  +K  +LA++F++FM++  FQ  +P  NWM+P
Sbjct: 240 SNGTEPNIGAILLNGTAYVQIEGVGIVKGTKHRELAEKFIEFMLTNQFQNEIPLHNWMFP 299

Query: 294 VV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
              + ++PDV++    P+K L  + EE     ++W+  W
Sbjct: 300 ASKNATLPDVFKYAVKPEKILNPSPEEIKANHDRWVREW 338


>gi|242398360|ref|YP_002993784.1| Maltooligosaccharide ABC transporter, sugar binding component
           [Thermococcus sibiricus MM 739]
 gi|242264753|gb|ACS89435.1| Maltooligosaccharide ABC transporter, sugar binding component
           [Thermococcus sibiricus MM 739]
          Length = 357

 Score =  179 bits (455), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 181/349 (51%), Gaps = 31/349 (8%)

Query: 1   MKKFARIVVGIMMIT--GVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKC 58
           MKK A I+  ++M T  G ++  T      +  L +Y+Y+SF   E    ++   FE K 
Sbjct: 4   MKKLAIILSLVLMATALGCLNQQTQTTQTEEQKLIIYSYDSF---EYLASEVIPKFEEKY 60

Query: 59  NCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLA-----------RKTGLFA 107
             +++L  + D   +LN+L +E +N  AD+V+G DN+L+  A               LF 
Sbjct: 61  GVKVELQLIGDAGEVLNRLILEKDNPRADLVIGIDNSLLAKAIEAEVLEPYKPENINLFP 120

Query: 108 KSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQD 167
           +S I  S   L          PYDYGY++  Y +  +  PPK+ ++L       K++ +D
Sbjct: 121 ESLIFDSTFHL---------TPYDYGYISINYREDMVQNPPKSLEDLTKPEWRGKLVIED 171

Query: 168 PRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYS 226
           PRTS+ G   LLW   +YGD      W+K+      + KGWTE++  F+ GE   VLSY+
Sbjct: 172 PRTSSPGAAFLLWTIAVYGDEGYLYYWQKLKENDVHIVKGWTEAWTAFMNGEFPLVLSYA 231

Query: 227 TSPGFYLLNYGQDDYVAAL-FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRIL 285
           TSP   +  Y    YV A+ F EG+Y+QIE A  +  +K  +LA++F++FM++  FQ  +
Sbjct: 232 TSPAATVY-YDNITYVKAIAFEEGNYMQIEGAGIIKGAKNKELAKKFIEFMLTEEFQDAI 290

Query: 286 PTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAEETTRYRN--QWISSW 331
           PT  WMYPV  +I +P+V++    P +      E T    N  +WI  W
Sbjct: 291 PTNQWMYPVNPNIKLPEVFEYAVQPNEIKPLTLEPTYIKENFERWIKEW 339


>gi|14591156|ref|NP_143232.1| thiamin-binding periplasmic protein precursor [Pyrococcus
           horikoshii OT3]
 gi|3257772|dbj|BAA30455.1| 347aa long hypothetical thiamin-binding periplasmic protein
           precursor [Pyrococcus horikoshii OT3]
          Length = 347

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 114/344 (33%), Positives = 181/344 (52%), Gaps = 26/344 (7%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           +++ GI+MI  +++ C       +  LTVY Y+S    E    ++   FE++ N ++ L+
Sbjct: 6   KVIAGIVMIL-LVAGCIGGKGEEEKTLTVYAYDSL---EYWLKEVIPEFEKEYNVKVNLV 61

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAKSNIDASQLKLPIKW 122
            +     L+N+L +E +N  AD+V+G DN  +  A   G+   +   NID     L  K+
Sbjct: 62  LVGSTGELVNRLILEKDNPQADVVVGIDNTFLAKALSAGVLDTYKPRNIDELYPWLVEKF 121

Query: 123 DDDI-FVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           D     +P+DYG+LAF Y    + +PPK+ D+L+N     KII +DPRTS+ GL  + W 
Sbjct: 122 DPTYHLIPFDYGFLAFNYRTDMVKEPPKSLDDLLNEKWKGKIIIEDPRTSSPGLAFMFWT 181

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
             +Y D   + W K+      + KGW+ ++  F KGE   VLSY TSP   +    + + 
Sbjct: 182 IAVYKDKWLEYWAKLKD-NVQIVKGWSAAWEAFSKGEFPVVLSYVTSPAATVYYDNKTNV 240

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMP 300
            A +F EG+YLQIE    +  SK  +LA+ F++F+IS   Q  LPTT WM+P   ++ +P
Sbjct: 241 RAIIFREGNYLQIEGVGIIKGSKNRKLAERFVEFLISQKAQEKLPTTQWMFPANKNVKLP 300

Query: 301 DVY---------QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           +VY         +A+ +  K ++ N E       +WI  W   V
Sbjct: 301 EVYKYNPKVDFSKAVYLDPKLIQENYE-------KWIREWTAVV 337


>gi|240103763|ref|YP_002960072.1| ABC-type thiamine transport system, periplasmic component (sfuA)
           [Thermococcus gammatolerans EJ3]
 gi|239911317|gb|ACS34208.1| ABC-type thiamine transport system, periplasmic component (sfuA)
           [Thermococcus gammatolerans EJ3]
          Length = 373

 Score =  178 bits (452), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 169/309 (54%), Gaps = 13/309 (4%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTVY Y+SF   +         FE++ N ++KLI L D   +LN+L +E ++  AD+V+G
Sbjct: 51  LTVYAYDSF---QSVAKVTIPKFEKEYNVKVKLITLGDAGKVLNRLILEKDHPRADVVIG 107

Query: 92  FDNNLIDLARKTGL---FAKSNIDASQLKLPIKWDDDIF--VPYDYGYLAFIYDKRQITQ 146
            DN+L   A + G+   +   NID     L +K  D  +  +PYDYG +A +Y K ++  
Sbjct: 108 IDNSLAAKAIEAGVLEVYKPKNIDLVPEDL-VKGLDPTYHLIPYDYGPIAIVYKKDKVKN 166

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTK 205
           PPK F++L+       +I +DPRTS+ G+  LLW    YGD      W+K+  +   +T+
Sbjct: 167 PPKTFEDLLKPEWKKSLIVEDPRTSSTGMSFLLWTIGAYGDPGWLYYWEKLKPQIYQITE 226

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGF--YLLNYGQDDYVAALFSEGHYLQIEVAAQLVRS 263
           GW   +  + KGE+   +SY+T P +  Y  N  + D    L +   Y+QIE    +  +
Sbjct: 227 GWDAGWEMWDKGEAPLFVSYATDPAYSAYYNNGTEPDIGVILLNGTAYVQIEGVGIVKGT 286

Query: 264 KQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTR 322
           K  +LA++F++FM++  FQ  +P  NWM+P   + ++PDV++    P+K +  + EE   
Sbjct: 287 KHRELAEKFIEFMLTNKFQNEIPLHNWMFPASKNATLPDVFKYAVKPEKIINPDPEEIKA 346

Query: 323 YRNQWISSW 331
             N+W+  W
Sbjct: 347 NHNRWVREW 355


>gi|297518353|ref|ZP_06936739.1| thiamine transporter substrate binding subunit [Escherichia coli
           OP50]
          Length = 120

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 99/120 (82%)

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKG 206
           PP++  EL+ S + W++IYQDPRTST GLGLLLW+QK+YGD++ Q W+K+A KT TVTKG
Sbjct: 1   PPQSLKELVESDQNWRVIYQDPRTSTPGLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKG 60

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQP 266
           W+E+YG FLKGESD VLSY+TSP +++L   +D+Y AA FSEGHYLQ+EVAA+   SKQP
Sbjct: 61  WSEAYGLFLKGESDLVLSYTTSPAYHILEEKKDNYAAANFSEGHYLQVEVAARTAASKQP 120


>gi|57640692|ref|YP_183170.1| ABC-type thiamine transport system, periplasmic component
           [Thermococcus kodakarensis KOD1]
 gi|57159016|dbj|BAD84946.1| ABC-type thiamine transport system, periplasmic component
           [Thermococcus kodakarensis KOD1]
          Length = 380

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 106/335 (31%), Positives = 177/335 (52%), Gaps = 15/335 (4%)

Query: 9   VGIMMITGVIS---YCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           +G + + GVI    + +   + A+  LTVY+Y+S    E    +I   FE+K N +++L+
Sbjct: 4   MGELFVLGVILASLFASSSPVSAEETLTVYSYDSI---EPWMKEIIPIFEQKYNVKVRLV 60

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLP---IKW 122
              D   +L++L ME +N  AD+V+G DN+ +  A K G+      + ++  +P   IK 
Sbjct: 61  LFGDAGEVLSRLIMEKDNPQADVVIGIDNSYLQKAIKEGILIPYKPENAKY-IPDWIIKN 119

Query: 123 DDDIF--VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
            D  F   PYDYG +A +Y K ++  PPK F+EL       K+I ++P TS+ G+  LLW
Sbjct: 120 FDPEFHLTPYDYGAIAIVYKKNEVPNPPKTFEELTKPEWKGKLIVENPLTSSTGMAFLLW 179

Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240
              +YGD     W+ +      V KGW+  +  + KG++   +SY+T P +   NY    
Sbjct: 180 TIAVYGDKWPYYWEALRENDVIVVKGWSAGWEMWDKGQAPLFVSYATDPAYSACNYNDTS 239

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISM 299
             A   S   Y+QIE A  +  +K  +LA+ F+ F+IS   Q  LP   WMYPV  ++ +
Sbjct: 240 IGAVFLSNTAYVQIEGAGIVNGTKHLELAKAFVNFLISKEAQEKLPLNQWMYPVNSEVEL 299

Query: 300 PDVYQ-AIRIPQ-KSLRFNAEETTRYRNQWISSWQ 332
           P+ +  A+ + + K +   A+E  +  ++W+  W+
Sbjct: 300 PECFSYALDVGKAKVVSIPADELAKNTDKWLKEWR 334


>gi|154249008|ref|YP_001409833.1| ABC transporter periplasmic-binding protein [Fervidobacterium
           nodosum Rt17-B1]
 gi|154152944|gb|ABS60176.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Fervidobacterium nodosum Rt17-B1]
          Length = 325

 Score =  172 bits (435), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 97/336 (28%), Positives = 175/336 (52%), Gaps = 14/336 (4%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           MKKF  +V+ ++++  ++             L +YT +SF    G G  I   FE+   C
Sbjct: 1   MKKF--LVISLLLVVSLVIIAA--------ELVIYTSDSFAG--GIGKVIAPKFEKVYKC 48

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120
           ++K+I       +L ++  E  +  AD+V+G +   +  A K G+  K     S+  +  
Sbjct: 49  KVKMISFGSMGDVLARIIAEKNSPKADVVIGLNPQQLQKAIKEGVLEKYRPVNSKNIVYK 108

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180
               D    YDYG LA IY+  +I  PP++F +L+      KI+  DPRTS+ GL  L+W
Sbjct: 109 SLVTDYGTVYDYGALAMIYNVEKIKNPPRSFKDLLKPEYKGKIVLIDPRTSSTGLTFLMW 168

Query: 181 IQKIYG-DNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD 239
               +G D++ + WK++       T GW+ ++     GE+D ++SY+T   + +  YG  
Sbjct: 169 TIAAFGEDDAMEYWKQLKNNVLMFTSGWSAAFKMIETGEADIIVSYATDGAYSMYKYGSI 228

Query: 240 DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISM 299
            Y+  +F EG Y+  E A+ +  +K   LA+ F++F+++P FQ+ +P   WM PV+++ +
Sbjct: 229 KYMPVIFEEGAYVLEEYASIVKGAKNLALARTFLEFILTPDFQKEVPLNQWMMPVINVEL 288

Query: 300 PDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           P+V++ +   +K L+   +   R  ++ +  W+ AV
Sbjct: 289 PEVFKYVPTFKKILKVKPDVNDRI-DEVLKKWEKAV 323


>gi|300949917|ref|ZP_07163878.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Escherichia coli MS 116-1]
 gi|300450711|gb|EFK14331.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Escherichia coli MS 116-1]
          Length = 131

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/114 (67%), Positives = 93/114 (81%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK 141
           +VLG DNNL+D A KTGLFAKS + A  + +P  W++D FVP+DYGY AF+YDK
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAADAVNVPGGWNNDTFVPFDYGYFAFVYDK 131


>gi|213421934|ref|ZP_03355000.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
          Length = 139

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 76/121 (62%), Positives = 95/121 (78%)

Query: 29  KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD+
Sbjct: 19  KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKADV 78

Query: 89  VLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           VLG DNNL++ A +T LFAKS +    +K+P  W +D FVP+DYGY AF+YDK ++  PP
Sbjct: 79  VLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPP 138

Query: 149 K 149
           K
Sbjct: 139 K 139


>gi|325971736|ref|YP_004247927.1| ABC transporter periplasmic protein [Spirochaeta sp. Buddy]
 gi|324026974|gb|ADY13733.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Spirochaeta sp. Buddy]
          Length = 341

 Score =  168 bits (426), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 104/345 (30%), Positives = 176/345 (51%), Gaps = 12/345 (3%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKPV--LTVYTYNSFVADEGAGPKIKQAFERKC 58
           M K   + V + ++T  +S+      PAK    L VY Y++F +D G GP I + FE++ 
Sbjct: 1   MNKHQYVCVLVAILT--LSFPVF-AQPAKESNELVVYAYDAFCSDWGPGPAIVEEFEKQY 57

Query: 59  NCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA-SQLK 117
             E+ L+   D V ++ K+  E  N  AD+V+G  +++        L  +    A S + 
Sbjct: 58  GIEVNLVSAGDAVEMMTKVISEANNPWADVVVGITDDMAQKVYDANLLERYASPALSDIP 117

Query: 118 LPIKWDDDI-FVPYDYGYLAFIYDKRQITQP--PKNFDELINSTKPWKIIYQDPRTSTLG 174
             + +D     +P+DYG  AF+ D   +     P +   L+      K+I  DPRTS++G
Sbjct: 118 SFLHFDSAYRLLPFDYGNFAFVVDTEHMKAEDIPTSLASLVEPKYKGKVILIDPRTSSVG 177

Query: 175 LGLLLWIQKIYGDNSAQVWKKIATKTA-TVTKGWTESYGFFLKGESDFVLSYSTSPGFYL 233
           LGLLLW  +++G+     W K   + A T+T GW+ +YG F +GE+  V+SY+TSP +++
Sbjct: 178 LGLLLWTIEVFGEKDYLGWWKAMKENALTITDGWSSAYGLFTEGEAPLVISYTTSPVYHV 237

Query: 234 LNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYP 293
                  Y   +F+EGH   IE    L  S++ + A++F+ ++++ + Q  +   N MYP
Sbjct: 238 TYDETTRYQTTIFTEGHSTTIEGVGILASSRKKEQARKFIDYLLTDA-QLPIALANSMYP 296

Query: 294 V-VDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
                 +P  +     PQKSL    E   +  ++W++ W   +SR
Sbjct: 297 TNSKAELPKAFDYAPKPQKSLAMETEILAKNLDRWLTEWTQVMSR 341


>gi|213026431|ref|ZP_03340878.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
          Length = 133

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 96/127 (75%)

Query: 211 YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ 270
           +G FLKGESD VLSY+TSP ++++   +D+Y AA FSEGHYLQ+EVAA+ V SKQP+LA+
Sbjct: 7   HGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEGHYLQVEVAARTVASKQPELAE 66

Query: 271 EFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISS 330
           +F++FM+SP+FQ  +PT NWMYPV D+++P  ++++  P  +L F  ++    R  WIS 
Sbjct: 67  KFLKFMVSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWISE 126

Query: 331 WQNAVSR 337
           WQ AVSR
Sbjct: 127 WQRAVSR 133


>gi|42522187|ref|NP_967567.1| thiamine ABC transporter [Bdellovibrio bacteriovorus HD100]
 gi|39574718|emb|CAE78560.1| thiamine ABC transporter [Bdellovibrio bacteriovorus HD100]
          Length = 346

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/307 (30%), Positives = 160/307 (52%), Gaps = 11/307 (3%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
           P + V+ Y SF    G GP +K  FE+ C C+++ I  SD   LL +L++EGE+  AD+V
Sbjct: 33  PTVRVFGYASFTGRWGPGPALKDLFEKSCKCKVEFIEGSDSGILLQRLKIEGESLGADVV 92

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKL--PIK--WDDDIFVPYDYGYLAFIYDKRQIT 145
           +G D    DL++     +   +   QL +   +K    +  FVPYD+G L F+  K ++ 
Sbjct: 93  VGLDQ--FDLSKAVSEQSWRKLSLGQLDVYDAVKPALANSFFVPYDWGALTFVARKNELM 150

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATVT 204
           + P + D+L+      KI  QDPRTS+ G+  L W+ +  G D   +  +K+ ++  + +
Sbjct: 151 RMPASLDDLLAPELAKKIALQDPRTSSPGMQFLYWVIRSKGEDEGFRYLQKLMSQVHSFS 210

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSK 264
             W+ SYG F   ++  V SY TSP ++ +   + DYVA  F+E   +Q E        +
Sbjct: 211 PTWSTSYGLFTNKQTKLVYSYVTSPLYHEVEEKKKDYVALPFNEDLPVQFEFVGIPEFCR 270

Query: 265 QPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLR----FNAEET 320
              LA++F+  M+S   Q+I+   N+M+PV+   M +   A  +  K+++     ++ E 
Sbjct: 271 HCDLAEQFVNLMLSNEGQKIIMEKNYMFPVMKGVMENTSFAPLMNVKTMQQVEILSSTEV 330

Query: 321 TRYRNQW 327
            R   +W
Sbjct: 331 DRLLRRW 337


>gi|15639138|ref|NP_218584.1| thiamine ABC transporter, thiamine-binding periplasmic protein,
           putative [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189025378|ref|YP_001933150.1| thiamine ABC transporter, thiamine-binding periplasmic protein
           [Treponema pallidum subsp. pallidum SS14]
 gi|3322409|gb|AAC65133.1| thiamine ABC transporter, thiamine-binding periplasmic protein,
           putative [Treponema pallidum subsp. pallidum str.
           Nichols]
 gi|189017953|gb|ACD70571.1| possible thiamine ABC transporter, thiamine-binding periplasmic
           protein [Treponema pallidum subsp. pallidum SS14]
 gi|291059560|gb|ADD72295.1| thiamine ABC transporter, thiamine-binding protein [Treponema
           pallidum subsp. pallidum str. Chicago]
          Length = 335

 Score =  147 bits (372), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 85/295 (28%), Positives = 146/295 (49%), Gaps = 7/295 (2%)

Query: 30  PVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV-ALLNKLRMEGENSA--A 86
           P L +Y Y+SF ++ G GP++ + F  K    ++ +   D   A+   +R +   S+  A
Sbjct: 28  PSLVIYVYDSFASEWGPGPELARRFYAKTGYSVQYVVFEDVTRAIHRAIRDQHTPSSRGA 87

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD-DDIFVPYDYGYLAFIYDKRQIT 145
           D+++G D   + LAR+  LF+     A  L   ++ D  ++ VPYD+GY+AF+++     
Sbjct: 88  DLIIGVDQYTLPLAREADLFSPYQ-PALPLPHALRIDPHNLAVPYDWGYVAFMFNTDAAL 146

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKI-ATKTATVT 204
             P+   +L N      I   DP T+ LG   + W     G      W  +       + 
Sbjct: 147 PEPQRLSDLANPVYAKSIALADPHTNVLGTIFIGWAHTSLGAAWPAFWNTLYRANLLALA 206

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSK 264
             W+ +YG F  GE+  VLSY+TS  ++L +     +   LF EGH + IE  + + R+K
Sbjct: 207 PSWSAAYGLFTAGEAALVLSYTTSAAYHLHHDNHTRFKPLLFPEGHPMHIEGISLVKRTK 266

Query: 265 QPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAE 318
             ++A +F+ F++S   Q +LP T WMYP   D+ +P  + A+  P   +  + +
Sbjct: 267 HARVATQFIDFLLSTEAQELLPLTQWMYPANPDVPLPAAFSAVPQPAACVSLSPQ 321


>gi|253583849|ref|ZP_04861047.1| ABC transporter periplasmic-binding protein [Fusobacterium varium
           ATCC 27725]
 gi|251834421|gb|EES62984.1| ABC transporter periplasmic-binding protein [Fusobacterium varium
           ATCC 27725]
          Length = 324

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 153/272 (56%), Gaps = 14/272 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK----- 108
           F+ K   ++K I + DG  L+++L++E +N  ADIV+G  +   ++A+K  L        
Sbjct: 40  FKEKTGVDIKFISI-DG--LVSRLKLEEKNPKADIVIGLTSLSTEIAKKENLITPYIPKN 96

Query: 109 -SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQD 167
            SNI +S   +     +    P+DYG LA  YD ++I  PPKN  EL    K  +++ ++
Sbjct: 97  ISNIKSSDFLMD---KEGYATPFDYGLLAINYDTKKIPVPPKNLAELGKLEK--QLLVEN 151

Query: 168 PRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYST 227
           P TS+ G   LLW   +YG+N    W  +     T   GW+E++  F  GE+  ++ Y+T
Sbjct: 152 PATSSTGEEALLWSIALYGENWKNFWNVLKPAIYTAEPGWSEAFAKFTAGEAPMMVGYAT 211

Query: 228 SPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
           S  F+  +  Q  + + L  +G ++ +E A+ + + +  + A++FM++++S  FQ ++P 
Sbjct: 212 SNLFFSQDEEQSRFSSFLLEDGTFMYLEGASLVNKKETKEGAKKFMEYVLSEDFQNLVPQ 271

Query: 288 TNWMYPVVDISMPDVYQAIRIPQKSLRFNAEE 319
            N+M+PV +IS+ + ++ + + +K+++ + E+
Sbjct: 272 KNYMFPVTEISLTEEFKFVPVAEKTVKLSDEQ 303


>gi|310779152|ref|YP_003967485.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Ilyobacter polytropus DSM 2926]
 gi|309748475|gb|ADO83137.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Ilyobacter polytropus DSM 2926]
          Length = 321

 Score =  139 bits (350), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 77/284 (27%), Positives = 148/284 (52%), Gaps = 15/284 (5%)

Query: 50  IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK- 108
           I   F+ +   E+K + ++    L+ ++++E  N  AD+VLG   +  ++A+  GL AK 
Sbjct: 37  IASKFKEETGVEIKFVSIN---GLVPRMKLEKNNPRADVVLGLTPSSAEMAKNEGLTAKY 93

Query: 109 -----SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKI 163
                 NI   +  +  +W      P+DYG LA  YD + +  PPK+F+E+    K  + 
Sbjct: 94  RPKSYKNISKEEFIMDEEW---YVTPFDYGALAINYDAQMLKNPPKSFEEISKMEK--QF 148

Query: 164 IYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVL 223
           + +DPR+ T G   +LW   +YGD   + WK +     TVT  W E++  F   E+  + 
Sbjct: 149 LVEDPRSFT-GQEFMLWTIAVYGDQWKEFWKNLKPSILTVTPSWDEAFAKFTAKEAPMMA 207

Query: 224 SYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQR 283
            Y++S  ++  +  Q+ Y + +  EG Y+ +E AA + + K  + +++FM +++   FQ 
Sbjct: 208 GYASSSVYFYQDGNQNKYKSFIPEEGGYVYLEGAALVSKKKIKKGSKKFMDYILEKDFQE 267

Query: 284 ILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW 327
           +    N+M+PV ++ +P+ Y+ + +P+K +  + ++       W
Sbjct: 268 LTAKKNYMFPVTNVKLPEEYKYVPVPKKVVTISGKDAVANLETW 311


>gi|257469426|ref|ZP_05633518.1| ABC transporter periplasmic-binding protein [Fusobacterium ulcerans
           ATCC 49185]
 gi|317063671|ref|ZP_07928156.1| ABC transporter periplasmic-binding protein [Fusobacterium ulcerans
           ATCC 49185]
 gi|313689347|gb|EFS26182.1| ABC transporter periplasmic-binding protein [Fusobacterium ulcerans
           ATCC 49185]
          Length = 324

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 80/289 (27%), Positives = 159/289 (55%), Gaps = 23/289 (7%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA------ 107
           F+ K   ++K I + DG  L+++L++E +N  AD+V+G  +   ++A+K  L        
Sbjct: 40  FKEKTGVDIKFISI-DG--LVSRLKLEEKNPKADVVIGLTSLSTEIAKKENLITPYIPKN 96

Query: 108 KSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQ 166
            SNI ++   +    D + +V P+DYG LA  YD ++I  PPKN  EL    K  +++ +
Sbjct: 97  TSNIKSNDFIM----DKEGYVTPFDYGLLAINYDTKKIPVPPKNLTELGKLEK--QLLVE 150

Query: 167 DPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYS 226
           +P TS+ G   LLW   +YG +    W  +     T   GW+E++  F  GE+  ++ Y+
Sbjct: 151 NPATSSTGEEALLWSIALYGKDWKDFWTALKPAIYTAEPGWSEAFAKFTAGEAPMMVGYA 210

Query: 227 TSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILP 286
           TS  F+  +  Q  + + L  +G ++ +E A+ + + +  + A++FM++++S  FQ ++P
Sbjct: 211 TSNLFFSQDEEQSRFSSFLLEDGTFMYLEGASLVNKKETKEGAKKFMEYILSEEFQSLVP 270

Query: 287 TTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETT-------RYRNQWI 328
             N+M+PV++  + + ++ +   +K+++ + E+         RY+++ I
Sbjct: 271 KKNYMFPVIETPLTEEFKFVPTTEKTVKLSDEQVKDLVNNLDRYKSELI 319


>gi|237737209|ref|ZP_04567690.1| ABC transporter periplasmic-binding protein [Fusobacterium
           mortiferum ATCC 9817]
 gi|229421071|gb|EEO36118.1| ABC transporter periplasmic-binding protein [Fusobacterium
           mortiferum ATCC 9817]
          Length = 323

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 158/294 (53%), Gaps = 21/294 (7%)

Query: 52  QAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL---FAK 108
           + F+++    +K + + DG+  + +L++E +   ADIV+G      ++A++ GL   +  
Sbjct: 39  KVFQKETGDTIKFVSI-DGI--VGRLKLEKKRPKADIVVGLTELTTEMAKREGLILPYVP 95

Query: 109 SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDP 168
            NI   + K   K   D  +P DYG LA  Y+K +I+ PPKN  EL    K  +++ ++P
Sbjct: 96  QNIGNIKNK-NFKMSSDYVIPMDYGVLAINYNKEKISVPPKNLKELEKFNK--QLMVENP 152

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           + S  G   L W   +YG+N  + WK++     +V  GW+E++  F  GE+  ++ Y+TS
Sbjct: 153 KVSITGEEALQWSIALYGENWLEFWKELKPAIYSVEPGWSEAFAKFTAGEAPMMIGYATS 212

Query: 229 PGFYLLNYGQDD--YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILP 286
             F+    G+D   Y + L  +G ++  E  + + + +    A++FM+ ++S  FQ+I+ 
Sbjct: 213 NLFFT---GEDSSKYDSFLLEDGSFIYQEGVSLVNKKEVKAGAKKFMERVLSDDFQKIMS 269

Query: 287 TTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEET-------TRYRNQWISSWQN 333
             N+M+PV ++ + D ++++ +P+KS++   E+          Y+ Q I   +N
Sbjct: 270 EENYMFPVTNVEVSDGFKSVPLPEKSVKLTREQIDNLIENLNNYKTQLIEVLKN 323


>gi|307298714|ref|ZP_07578517.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306915879|gb|EFN46263.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 325

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 163/332 (49%), Gaps = 22/332 (6%)

Query: 12  MMITGVISYCTLDGLPAKPVLTVYTYNSF--VADEGAGPKIKQAFERKCNCELKLIGLSD 69
           ++++ +I + +L  + A   LTVY+Y+S   +A+E  G   +Q      + E + +G  D
Sbjct: 5   LLLSLMIFFLSLSAVSA---LTVYSYDSLEPLAEESFGKFTEQT---GIDVEFRAVG--D 56

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK------SNIDASQLKLPIKWD 123
             +LL+ +  E E    D+V+G DN L   A +  +F          I ++ L L  +W 
Sbjct: 57  SGSLLSLIISEREKFDGDVVIGIDNLLSRRAFEEDIFLSYRPMGFERIISNDLLLDEEWR 116

Query: 124 DDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
                PYD+G +A I +  QI +      +L        +I QDPRTS+ GL  L W   
Sbjct: 117 ---LTPYDFGSIALICNGSQIEESISTLWDLTKPEFERSVIIQDPRTSSTGLSFLAWTYL 173

Query: 184 IYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
           ++G+   + W+ I     TV+  W +++  F  GE+  ++SY+T   +    YG+  Y  
Sbjct: 174 LFGERFEEFWRAITPSILTVSLSWDDAFQKFESGEAPIMVSYATDGAYSKHYYGESIYST 233

Query: 244 ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVY 303
            +     Y+Q+E A  +  +   + A+ FM F++S  FQ  +P   WM+PV+++ MP  +
Sbjct: 234 VIPEGKGYVQVEGAGIIKWTDNLEEAKLFMDFILSEDFQSHIPLNQWMFPVIEVEMPPAF 293

Query: 304 QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
                P+K L+ +A+      ++ I +W+  +
Sbjct: 294 DYAVKPEKILKLSADVDL---SKLIETWEEVI 322


>gi|297517915|ref|ZP_06936301.1| thiamine transporter substrate binding subunit [Escherichia coli
           OP50]
          Length = 103

 Score =  135 bits (341), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 62/86 (72%), Positives = 72/86 (83%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           AKPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+LRMEG+NS AD
Sbjct: 18  AKPVLTVYTYDSFAADWGPGPVVKKAFEADCNCELKLVALEDGVSLLNRLRMEGKNSKAD 77

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDA 113
           +VLG DNNL+D A KTGLFAKS + A
Sbjct: 78  VVLGLDNNLLDAASKTGLFAKSGVAA 103


>gi|257463216|ref|ZP_05627615.1| ABC transporter periplasmic-binding protein [Fusobacterium sp. D12]
          Length = 291

 Score =  135 bits (340), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 144/267 (53%), Gaps = 8/267 (2%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSN-ID 112
           FE+     +K + L DGV  + +L +E  N  ADIV+G     I++A+K G+  K    +
Sbjct: 9   FEKMTGDTIKYVSL-DGV--VQRLTLEKINPKADIVVGLTPVDIEVAKKHGVIQKYKPQN 65

Query: 113 ASQLKLPIKWDDDIF-VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTS 171
             ++K  I++D + + VPYDYG LA  YDK +I  PPKN + L    K  +++ ++P TS
Sbjct: 66  VEKIKKEIQYDKEYYAVPYDYGMLAINYDKTKIKNPPKNLEALGRMKK--QLLIENPNTS 123

Query: 172 TLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGF 231
             G  +L W   +YG N  + W  I      V  GW E++  F  GE+  ++ Y+TS  +
Sbjct: 124 NTGAEILQWSLALYGKNWKKFWTTIQPAIYNVEPGWEEAFAKFTAGEAPMMVGYATSDIW 183

Query: 232 YLLNYGQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNW 290
           +  +  Q D  A+ + E G+Y  +E AA + + +    A++FM+ ++   FQ +    N+
Sbjct: 184 FAQDDSQKDRYASFYLEDGNYQYVESAALVAKKEVKAGAKKFMEAVLGEEFQTMTAAKNY 243

Query: 291 MYPVVDISMPDVYQAIRIPQKSLRFNA 317
           M+PV  +++   + ++   +K ++F A
Sbjct: 244 MFPVTAVTLGKEFDSVPRTEKKVQFMA 270


>gi|317060804|ref|ZP_07925289.1| ABC transporter periplasmic-binding protein [Fusobacterium sp. D12]
 gi|313686480|gb|EFS23315.1| ABC transporter periplasmic-binding protein [Fusobacterium sp. D12]
          Length = 308

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/276 (30%), Positives = 146/276 (52%), Gaps = 8/276 (2%)

Query: 45  GAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTG 104
           G   K    FE+     +K + L DGV  + +L +E  N  ADIV+G     I++A+K G
Sbjct: 17  GLEKKYGPVFEKMTGDTIKYVSL-DGV--VQRLTLEKINPKADIVVGLTPVDIEVAKKHG 73

Query: 105 LFAKSN-IDASQLKLPIKWDDDIF-VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWK 162
           +  K    +  ++K  I++D + + VPYDYG LA  YDK +I  PPKN + L    K  +
Sbjct: 74  VIQKYKPQNVEKIKKEIQYDKEYYAVPYDYGMLAINYDKTKIKNPPKNLEALGRMKK--Q 131

Query: 163 IIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFV 222
           ++ ++P TS  G  +L W   +YG N  + W  I      V  GW E++  F  GE+  +
Sbjct: 132 LLIENPNTSNTGAEILQWSLALYGKNWKKFWTTIQPAIYNVEPGWEEAFAKFTAGEAPMM 191

Query: 223 LSYSTSPGFYLLNYGQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + Y+TS  ++  +  Q D  A+ + E G+Y  +E AA + + +    A++FM+ ++   F
Sbjct: 192 VGYATSDIWFAQDDSQKDRYASFYLEDGNYQYVESAALVAKKEVKAGAKKFMEAVLGEEF 251

Query: 282 QRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNA 317
           Q +    N+M+PV  +++   + ++   +K ++F A
Sbjct: 252 QTMTAAKNYMFPVTAVTLGKEFDSVPRTEKKVQFMA 287


>gi|239618513|ref|YP_002941835.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Kosmotoga olearia TBF 19.5.1]
 gi|239507344|gb|ACR80831.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Kosmotoga olearia TBF 19.5.1]
          Length = 328

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 147/293 (50%), Gaps = 19/293 (6%)

Query: 32  LTVYTYNSFVA-DEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           L VYTY+S +     A PK    FE     E+ +    D  A+L+K+  E E S  D+V+
Sbjct: 23  LVVYTYDSLLPLAREAFPK----FEELTGIEVVVRTYGDAGAVLSKVIAEREKSDVDVVI 78

Query: 91  GFDNNLIDLARKTGLF-------AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQ 143
           G DN L   A +  +F       A S +D S +  P +W      PYDYG +A IYD  +
Sbjct: 79  GIDNLLAKRAFEEDIFLSYKPKNADSIVDKSLIFDP-QWR---LTPYDYGAIAIIYDHAE 134

Query: 144 ITQ-PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS--AQVWKKIATKT 200
             +   ++ D+L        +I QDPRTS+ GL  ++W   ++ ++    + W+ +    
Sbjct: 135 YGKLDIESLDQLTEKRFRRSLIIQDPRTSSTGLSFVMWTYLLHQEDEDFVEFWRNLKDSI 194

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            T+T GW +++  F  GE+  ++SY+T   +    YG+  Y A +     Y+QIE A   
Sbjct: 195 LTITFGWDDAFEKFEAGEAPMMVSYATDGAYSYHYYGKVYYGAIIPGGKGYVQIEGAGIC 254

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
             +   + AQ+F+ F+ISP  Q  +P   WM+PV++I +P+ +     P + L
Sbjct: 255 KWTDNLEAAQKFIDFLISPECQNSIPLNQWMFPVIEIDLPEAFNYAVKPTELL 307


>gi|257452642|ref|ZP_05617941.1| ABC transporter periplasmic-binding protein [Fusobacterium sp.
           3_1_5R]
 gi|317059181|ref|ZP_07923666.1| ABC transporter periplasmic-binding protein [Fusobacterium sp.
           3_1_5R]
 gi|313684857|gb|EFS21692.1| ABC transporter periplasmic-binding protein [Fusobacterium sp.
           3_1_5R]
          Length = 322

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 149/292 (51%), Gaps = 17/292 (5%)

Query: 47  GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF 106
           G K    FE+     +K + + DGV  + +L +E  N  ADIV+G     I++A+K  + 
Sbjct: 33  GKKYAPIFEKVTGDTIKYVSI-DGV--VQRLTLEKVNPKADIVVGLTPVDIEVAKKHNVI 89

Query: 107 AK---SNIDASQLKLPIKWDDDIF-VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWK 162
            K    NI    +K  IK+D + +  PYDYG LA  YDK +I  PPK   EL    K  +
Sbjct: 90  QKYKPKNI--GMIKKDIKFDKEFYATPYDYGMLAINYDKTKIKNPPKTLAELGKMKK--Q 145

Query: 163 IIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFV 222
           ++ ++P TS  G  +L W   +YG N  + W  I      V  GW E++  F  GE+  +
Sbjct: 146 LLIENPNTSNTGAEILQWSLALYGKNWKKFWMTIQPAVYNVEPGWEEAFAKFTAGEAPMM 205

Query: 223 LSYSTSPGFYLLNYGQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           L Y+TS  ++  +  Q +  A+ + E G+Y  IE AA + + +  + A++FM+ ++   F
Sbjct: 206 LGYATSDMWFAQDNTQKEKYASFYVEDGNYQYIESAALVKKKEVKEGAKKFMEAVLGEEF 265

Query: 282 QRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF-----NAEETTRYRNQWI 328
           Q +    N+M+PV  +++   + A+    K ++F       E  ++Y+ + I
Sbjct: 266 QNMTAAKNYMFPVTSVNLGKEFDAVPRTDKKVQFVPNKEVVEHLSKYKKEAI 317


>gi|257466499|ref|ZP_05630810.1| ABC transporter periplasmic-binding protein [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|315917656|ref|ZP_07913896.1| ABC transporter periplasmic-binding protein [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|313691531|gb|EFS28366.1| ABC transporter periplasmic-binding protein [Fusobacterium
           gonidiaformans ATCC 25563]
          Length = 322

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/292 (30%), Positives = 148/292 (50%), Gaps = 17/292 (5%)

Query: 47  GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF 106
           G K    FE+     +K + + DGV  + +L +E  N  ADIV+G     I++A+K  + 
Sbjct: 33  GKKYAPIFEKVTGDTIKYVSI-DGV--VQRLTLEKVNPKADIVVGLTPVDIEVAKKHNVI 89

Query: 107 AK---SNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQITQPPKNFDELINSTKPWK 162
            K    NI    +K  IK+D + +  PYDYG LA  YDK +I  PPK   EL    K  +
Sbjct: 90  QKYKPKNI--GMIKKDIKFDKEFYATPYDYGMLAINYDKTKIKNPPKTLAELGKMKK--Q 145

Query: 163 IIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFV 222
           ++ ++P TS  G  +L W   +YG N  + W  I      V  GW E++  F  GE+  +
Sbjct: 146 LLIENPNTSNTGAEILQWSLALYGKNWKKFWTTIQPAVYNVEPGWEEAFAKFTAGEAPMM 205

Query: 223 LSYSTSPGFYLLNYGQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           L Y+TS  ++  +  Q +  A+ + E G+Y  IE AA + + +  + A++FM+ ++   F
Sbjct: 206 LGYATSDMWFAQDDTQKEKYASFYVEDGNYQYIESAALVKKKEVKEGAKKFMEAVLGEEF 265

Query: 282 QRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRF-----NAEETTRYRNQWI 328
           Q +    N+M+PV  + +   + A+    K ++F       E  ++Y+ + I
Sbjct: 266 QNMTAAKNYMFPVTSVPLGKEFDAVPRTDKKVQFVPNKEVVEHLSKYKKEAI 317


>gi|315655307|ref|ZP_07908207.1| thiamine ABC superfamily ATP binding cassette transporter
           substrate-binding protein [Mobiluncus curtisii ATCC
           51333]
 gi|315490247|gb|EFU79872.1| thiamine ABC superfamily ATP binding cassette transporter
           substrate-binding protein [Mobiluncus curtisii ATCC
           51333]
          Length = 368

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 91/317 (28%), Positives = 143/317 (45%), Gaps = 22/317 (6%)

Query: 31  VLTVYTYNSF-VADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
            +T+ TY+SF ++DE A      AF  K   +LK++   DGV L NKL +  +    D V
Sbjct: 53  TVTLVTYDSFPLSDETAA-----AFTDKTGYKLKVVKNGDGVELTNKLILTKDAPLGDAV 107

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQIT 145
            GFDNN    A   G  A      +     ++ D    VP D G +   YD    +++  
Sbjct: 108 FGFDNNTAQAAVDAGALADFTGKLAPSVQKLRGDSKQLVPVDRGEVCVNYDVSYFQKKGQ 167

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVT 204
           QPP  FD+L         + +DPRTST GL  LL   K  G+N     WK +        
Sbjct: 168 QPPATFDDLTKPEYKNLTVVEDPRTSTPGLAFLLSTIKAKGENGWMDYWKSLKANGVKSV 227

Query: 205 KGWTESYGF-FLKGESD-------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
             W +++   F  G +D        ++SY++SP + + + G    +  + +   Y Q+E 
Sbjct: 228 GSWDDAFNVDFTAGSNDNGSAAYPIMVSYASSPAWAVSDDGSVSTIGNVPAT-CYQQVEY 286

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLR 314
           A  L  +K P  A   +QF+   + Q+ L   N+MYPV+D + +P+       P  ++  
Sbjct: 287 AGVLKGAKNPAGAAALVQFLTEETAQKDLTENNYMYPVLDSVQLPEPLAKFGAPSGQAAV 346

Query: 315 FNAEETTRYRNQWISSW 331
               +  + R  W+ SW
Sbjct: 347 LKESDVVKNREAWVRSW 363


>gi|304389533|ref|ZP_07371496.1| ABC superfamily ATP binding cassette transporter substrate-binding
           protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315656779|ref|ZP_07909666.1| ABC superfamily ATP binding cassette transporter substrate-binding
           protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]
 gi|304327343|gb|EFL94578.1| ABC superfamily ATP binding cassette transporter substrate-binding
           protein [Mobiluncus curtisii subsp. curtisii ATCC 35241]
 gi|315492734|gb|EFU82338.1| ABC superfamily ATP binding cassette transporter substrate-binding
           protein [Mobiluncus curtisii subsp. holmesii ATCC 35242]
          Length = 368

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 91/317 (28%), Positives = 143/317 (45%), Gaps = 22/317 (6%)

Query: 31  VLTVYTYNSF-VADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
            +T+ TY+SF ++DE A      AF  K   +LK++   DGV L NKL +  +    D V
Sbjct: 53  TVTLVTYDSFPLSDETAA-----AFTDKTGYKLKVVKNGDGVELTNKLILTKDAPLGDAV 107

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQIT 145
            GFDNN    A   G  A      +     ++ D    VP D G +   YD    +++  
Sbjct: 108 FGFDNNTAQAAVDAGALADFTGKLAPSVQKLRGDSKQLVPVDRGEVCVNYDVSYFQKKGQ 167

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVT 204
           QPP  FD+L         + +DPRTST GL  LL   K  G+N     WK +        
Sbjct: 168 QPPATFDDLTKPEYKNLTVVEDPRTSTPGLAFLLSTIKAKGENGWMDYWKSLKANGVKSA 227

Query: 205 KGWTESYGF-FLKGESD-------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
             W +++   F  G +D        ++SY++SP + + + G    +  + +   Y Q+E 
Sbjct: 228 GSWDDAFNVDFTAGSNDNGSAAYPIMVSYASSPAWAVSDDGSVSTIGNVPAT-CYQQVEY 286

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLR 314
           A  L  +K P  A   +QF+   + Q+ L   N+MYPV+D + +P+       P  ++  
Sbjct: 287 AGVLKGAKNPAGAAALVQFLTEETAQKDLTENNYMYPVLDSVQLPEPLAKFGAPSGQAAV 346

Query: 315 FNAEETTRYRNQWISSW 331
               +  + R  W+ SW
Sbjct: 347 LKEADVVKNREAWVRSW 363


>gi|34498619|ref|NP_902834.1| thiamin-binding periplasmic protein [Chromobacterium violaceum ATCC
           12472]
 gi|34104473|gb|AAQ60831.1| thiamin-binding periplasmic protein [Chromobacterium violaceum ATCC
           12472]
          Length = 338

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 150/320 (46%), Gaps = 26/320 (8%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L V  ++SF  D+     +  AFE++   ++ +I   D   ++NKL +   +  AD+V G
Sbjct: 24  LRVLAHSSFSVDK----PLLAAFEKQTGAKVSIIKAGDAGEMVNKLILTKGSPIADVVFG 79

Query: 92  FDNNLIDLARKTGLFAKSNID---ASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP- 147
            DN+LI  A + G  A    +     ++ LP           DYGY+   YDK    +  
Sbjct: 80  IDNSLIGKAEQAGALAPLPAELAKGGKVGLPGA------AAVDYGYVTLNYDKAWFAKNK 133

Query: 148 ---PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATV 203
              PK  ++L        ++ ++P TS+ GL  L       G++ A  +W K+      V
Sbjct: 134 LPLPKTLNDLALPAYKNLLVVENPATSSPGLAFLSATIHALGEDKAFALWGKLRDNGLKV 193

Query: 204 TKGWTESY-GFFLK--GESDFVLSYSTSPG---FYLLNYGQDDYVAALFSEGH-YLQIEV 256
           +KGWTE+Y   F K  G    V+SY+TSP    FY  +   D     L   G  + Q+E 
Sbjct: 194 SKGWTEAYYTDFSKNGGGRPIVVSYATSPAAEVFYSKDKPADAPTGNLLLPGTVFRQVEG 253

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLRF 315
           AA +   K+P+LAQ+F+ F+ S + Q+ +PT  WMYP +D I +  VY+ +  P      
Sbjct: 254 AALVKGGKEPKLAQQFIAFLRSDAVQKDIPTRMWMYPAMDNIPLDPVYKHVEQPAAHDTP 313

Query: 316 NAEETTRYRNQWISSWQNAV 335
           ++      +  W+  W   V
Sbjct: 314 DSATLAAKQRAWVGRWTRVV 333


>gi|298346762|ref|YP_003719449.1| ABC transporter substrate-binding protein [Mobiluncus curtisii ATCC
           43063]
 gi|298236823|gb|ADI67955.1| ABC superfamily ATP binding cassette transporter substrate-binding
           protein [Mobiluncus curtisii ATCC 43063]
          Length = 347

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 91/317 (28%), Positives = 143/317 (45%), Gaps = 22/317 (6%)

Query: 31  VLTVYTYNSF-VADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
            +T+ TY+SF ++DE A      AF  K   +LK++   DGV L NKL +  +    D V
Sbjct: 32  TVTLVTYDSFPLSDETAA-----AFTDKTGYKLKVVKNGDGVELTNKLILTKDAPLGDAV 86

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQIT 145
            GFDNN    A   G  A      +     ++ D    VP D G +   YD    +++  
Sbjct: 87  FGFDNNTAQAAVDAGALADFTGKLAPSVQKLRGDSKQLVPVDRGEVCVNYDVSYFQKKGQ 146

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVT 204
           QPP  FD+L         + +DPRTST GL  LL   K  G+N     WK +        
Sbjct: 147 QPPATFDDLTKPEYKNLTVVEDPRTSTPGLAFLLSTIKAKGENGWMDYWKSLKANGVKSV 206

Query: 205 KGWTESYGF-FLKGESD-------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
             W +++   F  G +D        ++SY++SP + + + G    +  + +   Y Q+E 
Sbjct: 207 GSWDDAFNVDFTAGSNDNGSAAYPIMVSYASSPAWAVSDDGSVSTIGNVPAT-CYQQVEY 265

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLR 314
           A  L  +K P  A   +QF+   + Q+ L   N+MYPV+D + +P+       P  ++  
Sbjct: 266 AGVLKGAKNPAGAAALVQFLTEETAQKDLTENNYMYPVLDSVQLPEPLAKFGAPSGQAAV 325

Query: 315 FNAEETTRYRNQWISSW 331
               +  + R  W+ SW
Sbjct: 326 LKEADVVKNREAWVRSW 342


>gi|269976369|ref|ZP_06183361.1| solute binding lipoprotein [Mobiluncus mulieris 28-1]
 gi|269935440|gb|EEZ91982.1| solute binding lipoprotein [Mobiluncus mulieris 28-1]
          Length = 373

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 147/320 (45%), Gaps = 20/320 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +T+  Y+SF   E    +   AF++K   +LK++   DGV L NK+ +  +    D V G
Sbjct: 59  VTLVAYDSFPLSE----ETIAAFKKKTGYDLKVVKSGDGVELTNKIILTKDAPLGDAVFG 114

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQITQP 147
            DNN    A K G  A      +      +  +   VP D G +   YD    + +  +P
Sbjct: 115 MDNNTAQAAVKAGALADFTGQLAPSVTKARGAEKQLVPIDQGEVCVNYDIKYFQDKGLKP 174

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKG 206
           P  FD+L         + Q P+TST GL  +L   K  G+NS Q  WK +      VT  
Sbjct: 175 PATFDDLAAPAYQNLTVVQSPQTSTPGLAFMLATIKAKGENSWQNYWKALKANGVKVTDS 234

Query: 207 WTESYG--FFLKGESD------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           W  ++   F   G  +       ++SY++SP  + +N   D     +  +  Y Q+E AA
Sbjct: 235 WDTAFNADFTAGGNKNKSAAYPIMVSYASSPA-WAVNEAGDATTIGIVPDTCYRQVEYAA 293

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLRFN 316
            L  +K P+ A   ++F+   + Q+ L   N+MYPV+D +S+P+       P  K++  +
Sbjct: 294 VLQNAKNPEGAAALVKFLTEETAQKDLVENNYMYPVLDSVSLPEPLAKFGAPSGKAVSLD 353

Query: 317 AEETTRYRNQWISSWQNAVS 336
            ++ +  R  W+ +W   +S
Sbjct: 354 DKQVSEKREAWVRAWTEIMS 373


>gi|320449518|ref|YP_004201614.1| ABC transporter [Thermus scotoductus SA-01]
 gi|320149687|gb|ADW21065.1| ABC transporter [Thermus scotoductus SA-01]
          Length = 344

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 150/316 (47%), Gaps = 16/316 (5%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +TV T++SF  D+G    +   FER+   +L+ +   D    LN+  +      AD++ G
Sbjct: 19  ITVLTHSSFSLDKG----LIARFERETGLKLRFLKGGDAGETLNRAILTKGAPIADVIYG 74

Query: 92  FDNNLIDLARKTG-LFAKSNIDASQLKLPIKWDDDI-FVPYDYGYLAFIYDKRQIT-QP- 147
           FDN  +  A +   L    + +   LK  +  D     +P DYG+++  YD+     +P 
Sbjct: 75  FDNTFLSRALEADILLPYRSPEIQNLKATLLLDPTFRALPVDYGWVSLNYDRAYFKDRPL 134

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATVTKG 206
           PK+  +L        ++ Q+P TS+ GL  L+     +G D     W K+      V KG
Sbjct: 135 PKSPADLARPEYGRLLVVQNPATSSPGLAFLMATVARFGEDGYLDFWAKLRDGGVRVAKG 194

Query: 207 WTESY--GFFL-KGESDFVLSYSTSPG---FYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
           W+E+Y   F L KG+   V+SY+TSP    +Y     Q+     LF E  + Q+E    L
Sbjct: 195 WSEAYYTHFTLYKGDRPLVVSYTTSPAAEVYYSEGKYQEPPTGNLFPELAFFQVEFVGIL 254

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAEE 319
             +K  + A++ + +++S   Q  LPT  WMYP   D  +P+V++    P  S+R +   
Sbjct: 255 KGTKNLEGARKVVDWLLSKPVQENLPTEMWMYPARRDARLPEVFRFAPEPLGSVRMDPRA 314

Query: 320 TTRYRNQWISSWQNAV 335
             + R +WI  W   V
Sbjct: 315 MAQNRERWIEEWTKVV 330


>gi|261365052|ref|ZP_05977935.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria mucosa ATCC 25996]
 gi|288566652|gb|EFC88212.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria mucosa ATCC 25996]
          Length = 333

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 87/298 (29%), Positives = 144/298 (48%), Gaps = 19/298 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FEKANDAKVSVIKAGSGNEMLNKLILSKANPIADAVYGLDNANIGKAREAGILAAAQPKS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+     +    +YGY+   YDK+   Q     PK   +L        ++   P 
Sbjct: 101 A----PVSAGMPVIAAVNYGYVTLNYDKKWFEQKKLPLPKTLQDLTRPEYKNLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  L+      G+  A + W ++      V KGW+E+Y   F   G +   V+SY
Sbjct: 157 TSSPGLAFLMANIGGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFTQNGGAYPLVVSY 216

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           + SP   + +Y +  Y       LF +G  + Q+E AA L  +KQP+LA + +Q++ S  
Sbjct: 217 AASPAAEV-HYSKGKYSVPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSGE 275

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q+ LPT  W+YP V +  +P V++  + P+++   +  +    + QW+S W   V R
Sbjct: 276 VQKALPTEMWVYPAVKNTPLPKVFEFAQAPKQTDSPSRNDIDTKQKQWVSRWTKTVLR 333


>gi|306818662|ref|ZP_07452384.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Mobiluncus mulieris ATCC
           35239]
 gi|304648348|gb|EFM45651.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Mobiluncus mulieris ATCC
           35239]
          Length = 509

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 146/320 (45%), Gaps = 20/320 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +T+  Y+SF   E    +   AF++K   +LK++   DGV L NK+ +  +    D V G
Sbjct: 195 VTLVAYDSFPLSE----ETIAAFKKKTGYDLKVVKSGDGVELTNKIILTKDAPLGDAVFG 250

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQITQP 147
            DNN    A K G  A      +      +  +   VP D G +   YD    + +  +P
Sbjct: 251 MDNNTAQAAVKAGALADFTGQLAPSVTKARGAEKQLVPIDQGEVCVNYDIKYFQDKGLKP 310

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKG 206
           P  FD+L         + Q P+TST GL  +L   K  G+NS Q  WK +      VT  
Sbjct: 311 PATFDDLAAPAYQNLTVVQSPQTSTPGLAFMLATIKAKGENSWQNYWKALKANGVKVTDS 370

Query: 207 WTESYG--FFLKGESD------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           W  ++   F   G  +       ++SY++SP  + +N   D        +  Y Q+E AA
Sbjct: 371 WDTAFNADFTAGGNKNKSAAYPIMVSYASSPA-WAVNEAGDATTIGNVPDTCYRQVEYAA 429

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLRFN 316
            L  +K P+ A   ++F+   + Q+ L   N+MYPV+D +S+P+       P  K++  +
Sbjct: 430 VLQNAKNPEGAAALVKFLTEETAQKDLVENNYMYPVLDSVSLPEPLAKFGAPSGKAVSLD 489

Query: 317 AEETTRYRNQWISSWQNAVS 336
            ++ +  R  W+ +W   +S
Sbjct: 490 DKQVSEKREAWVRAWTEIMS 509


>gi|320333496|ref|YP_004170207.1| ABC transporter periplasmic-binding protein, thiB subfamily
           [Deinococcus maricopensis DSM 21211]
 gi|319754785|gb|ADV66542.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Deinococcus maricopensis DSM 21211]
          Length = 336

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 147/295 (49%), Gaps = 23/295 (7%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTV T++SF  D+    K+  AFE +   +++ I   D   LLNKL +      AD+V G
Sbjct: 20  LTVITHDSFDVDK----KLVAAFEARTGSKVRFIKGGDAGELLNKLILTRGAPLADVVYG 75

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKW---DDDIFVPYDYGYLAFIYDKRQITQP- 147
            DN+L+  AR  GL  ++    +  K+P ++   D  +    DYGY+A  YDK    Q  
Sbjct: 76  LDNSLLPRARSAGLL-EAYKSPALAKVPAQFRLDDAGLLNTVDYGYVALNYDKAYFEQNK 134

Query: 148 ---PKNFDELINSTKPWKIIYQDPRTSTLGLGLLL-WIQKIYGDNSAQVWKKIATKTATV 203
              PK+ ++L         + + P TS+ GL  LL  +  +  D + Q W++       V
Sbjct: 135 LALPKSLEDLAKPEYARLTVVESPATSSTGLAFLLSTVNHLGQDRAMQWWREARANGLRV 194

Query: 204 TKGWTESY-GFFLK--GESDFVLSYSTSPGFYLLNYGQDDYVAA-----LFSEGHYLQIE 255
           T+GW+++Y   F +  G+   VLSY++SP   +  Y +    A+     L     +LQ+E
Sbjct: 195 TRGWSDAYYKDFSRNGGKYPIVLSYASSPAAEV-AYSEKPLTASPTANLLLPGSTFLQLE 253

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIP 309
               L  +KQ  LA++F+ FM+S   Q   PT  W+YP V  + + DV++  + P
Sbjct: 254 GVGVLKGTKQRALARQFVDFMLSGGVQADFPTRMWVYPAVSGVKLADVWKYAQKP 308


>gi|224826422|ref|ZP_03699524.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Lutiella nitroferrum 2002]
 gi|224601523|gb|EEG07704.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Lutiella nitroferrum 2002]
          Length = 336

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 95/318 (29%), Positives = 146/318 (45%), Gaps = 22/318 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L V T++SF   +    ++   FE++   ++ +I   D   ++NKL +   N  AD+V G
Sbjct: 22  LRVLTHSSFALSK----ELLAGFEQQSGVKVVVIKAGDAGEMVNKLILTRANPIADVVYG 77

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK----RQITQP 147
            DN L+  A++ G+   +   AS     +K      V  DYGY+   YDK    RQ    
Sbjct: 78  IDNTLLGKAQQAGVLEPT---ASPAGAAVKQTLPGMVSVDYGYVTLNYDKAWFARQKLAL 134

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTKG 206
           P + DEL        ++ ++P TS+ GL  LL   K  G+  A  W  K+      V KG
Sbjct: 135 PTSLDELTRPAYKNLVVVENPATSSPGLAFLLATVKGLGEEPAFAWWGKLRDNGVKVAKG 194

Query: 207 WTESY-GFFLK--GESDFVLSYSTSPGFYLLNYGQDDYVAA-----LFSEGHYLQIEVAA 258
           W+E+Y   F K  G    V+SY+TSP   +  Y ++    A     L   G + Q+E  A
Sbjct: 195 WSEAYYTDFSKNGGSRPIVVSYATSPAAEVF-YSKEKLAEAPTGNLLLKGGVFQQVEGVA 253

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNA 317
            +    Q Q AQ+F+ F+ S + Q  LPT  WMYPV+  + +  V+   + P      ++
Sbjct: 254 LVKGGGQKQAAQQFVDFLRSGAVQADLPTQMWMYPVLPGVKLNPVFALAQQPTAHDTPDS 313

Query: 318 EETTRYRNQWISSWQNAV 335
                    W+S W   V
Sbjct: 314 RAIAAKSAGWVSRWTRVV 331


>gi|307701040|ref|ZP_07638065.1| ABC transporter, periplasmic binding protein, ThiB family protein
           [Mobiluncus mulieris FB024-16]
 gi|307614035|gb|EFN93279.1| ABC transporter, periplasmic binding protein, ThiB family protein
           [Mobiluncus mulieris FB024-16]
          Length = 373

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 146/320 (45%), Gaps = 20/320 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +T+  Y+SF   E    +   AF++K   +LK++   DGV L NK+ +  +    D V G
Sbjct: 59  VTLVAYDSFPLSE----ETIAAFKKKTGYDLKVVKSGDGVELTNKIILTKDAPLGDAVFG 114

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQITQP 147
            DNN    A K G  A      +      +  +   VP D G +   YD    + +  +P
Sbjct: 115 MDNNTAQAAVKAGALADFTGQLAPSVTKARGAEKQLVPIDQGEVCVNYDIKYFQDKGLKP 174

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKG 206
           P  FD+L         + Q P+TST GL  +L   K  G+NS Q  WK +      VT  
Sbjct: 175 PATFDDLAAPAYQNLTVVQSPQTSTPGLAFMLATIKAKGENSWQNYWKALKANGVKVTDS 234

Query: 207 WTESYG--FFLKGESD------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           W  ++   F   G  +       ++SY++SP  + +N   D        +  Y Q+E AA
Sbjct: 235 WDTAFNADFTAGGNKNKSAAYPIMVSYASSPA-WAVNEAGDATTIGNVPDTCYRQVEYAA 293

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLRFN 316
            L  +K P+ A   ++F+   + Q+ L   N+MYPV+D +S+P+       P  K++  +
Sbjct: 294 VLQNAKNPEGAAALVKFLTEETAQKDLVENNYMYPVLDSVSLPEPLAKFGAPSGKAVSLD 353

Query: 317 AEETTRYRNQWISSWQNAVS 336
            ++ +  R  W+ +W   +S
Sbjct: 354 DKQVSEKREAWVRAWTEIMS 373


>gi|227875347|ref|ZP_03993489.1| solute binding lipoprotein [Mobiluncus mulieris ATCC 35243]
 gi|227844252|gb|EEJ54419.1| solute binding lipoprotein [Mobiluncus mulieris ATCC 35243]
          Length = 429

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 89/320 (27%), Positives = 146/320 (45%), Gaps = 20/320 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +T+  Y+SF   E    +   AF++K   +LK++   DGV L NK+ +  +    D V G
Sbjct: 115 VTLVAYDSFPLSE----ETIAAFKKKTGYDLKVVKSGDGVELTNKIILTKDAPLGDAVFG 170

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD----KRQITQP 147
            DNN    A K G  A      +      +  +   VP D G +   YD    + +  +P
Sbjct: 171 MDNNTAQAAVKAGALADFTGQLAPSVTKARGAEKQLVPIDQGEVCVNYDIKYFQDKGLKP 230

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKG 206
           P  FD+L         + Q P+TST GL  +L   K  G+NS Q  WK +      VT  
Sbjct: 231 PATFDDLAAPAYQNLTVVQSPQTSTPGLAFMLATIKAKGENSWQNYWKALKANGVKVTDS 290

Query: 207 WTESYG--FFLKGESD------FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           W  ++   F   G  +       ++SY++SP  + +N   D        +  Y Q+E AA
Sbjct: 291 WDTAFNADFTAGGNKNKSAAYPIMVSYASSPA-WAVNEAGDATTIGNVPDTCYRQVEYAA 349

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ-KSLRFN 316
            L  +K P+ A   ++F+   + Q+ L   N+MYPV+D +S+P+       P  K++  +
Sbjct: 350 VLQNAKNPEGAAALVKFLTEETAQKDLVENNYMYPVLDSVSLPEPLAKFGAPSGKAVSLD 409

Query: 317 AEETTRYRNQWISSWQNAVS 336
            ++ +  R  W+ +W   +S
Sbjct: 410 DKQVSEKREAWVRAWTEIMS 429


>gi|297565333|ref|YP_003684305.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Meiothermus silvanus DSM 9946]
 gi|296849782|gb|ADH62797.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Meiothermus silvanus DSM 9946]
          Length = 361

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 87/318 (27%), Positives = 144/318 (45%), Gaps = 17/318 (5%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTV T+ SF  D+G    +   FE++    L+ +   D    LN+  +      AD++ 
Sbjct: 34  TLTVLTHESFSLDKG----LIARFEKESGIRLRFLKAGDAGETLNRAILTKAAPVADVLY 89

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF--VPYDYGYLAFIYDKRQIT-QP 147
           GFDN+L+  A   G+             P    D  +  +P D+GY+A  YDK     +P
Sbjct: 90  GFDNSLLSKALAAGILEPYPSPQRSTLRPELLLDPTYRALPVDFGYVALNYDKAYFKDKP 149

Query: 148 -PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATVTK 205
            P+   +L        ++ ++P TS+ GL  LL      G D     W+ +      V K
Sbjct: 150 LPQTLADLARPEFAKLLVVENPATSSPGLAFLLATVATLGQDGYLDFWEGLRKGGVRVEK 209

Query: 206 GWTESYGFFLK---GESDFVLSYSTSPG---FYLLNYGQDDYVAALFSEGH-YLQIEVAA 258
           GW+E+Y        G+   V+SY+TSP    FY      +     L   G  +LQIE   
Sbjct: 210 GWSEAYNVAFSKNGGDRPLVVSYATSPAAELFYSEKKLAEPPTGNLLLPGSSFLQIEFVG 269

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNA 317
            L  SK P  A++F+ +++S   Q  +PT  W+YP   D ++P+V++   +P++  +   
Sbjct: 270 ILKGSKHPAAARKFVDWLLSKPVQENIPTQMWVYPARKDAALPEVFKWAEVPKEPAKLPP 329

Query: 318 EETTRYRNQWISSWQNAV 335
           ++  +   +W+  W   V
Sbjct: 330 QQIAQGAERWVREWTEVV 347


>gi|255065320|ref|ZP_05317175.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria sicca ATCC 29256]
 gi|255050145|gb|EET45609.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria sicca ATCC 29256]
          Length = 333

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 142/298 (47%), Gaps = 19/298 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FEKANDAKVSVIKAGSGNEMLNKLILSKANPIADAVYGLDNANIGKAREAGILAAAQPKS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+     +    +YGY+   YDK+   Q     PK   +L        ++   P 
Sbjct: 101 A----PVSAGMPVIAAVNYGYVTLNYDKKWFEQKKLPLPKTLQDLTRPEYKNLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  L+      G+  A + W ++      V KGW+E+Y   F   G +   V+SY
Sbjct: 157 TSSPGLAFLMANIGGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFTQNGGAYPLVVSY 216

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           + SP   + +Y +  Y       LF +G  + Q+E AA L  +KQP+LA + +Q++ S  
Sbjct: 217 AASPAAEV-HYSKGKYSVPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSGE 275

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q+ LPT  W+YP V +  +P V++  + P+ +   +  +    + QW+  W   V R
Sbjct: 276 VQKALPTEMWVYPAVKNTPLPKVFEFAQAPKHTDSPSRNDIDTKQKQWVGRWTKTVLR 333


>gi|319638725|ref|ZP_07993484.1| ABC transporter [Neisseria mucosa C102]
 gi|317399966|gb|EFV80628.1| ABC transporter [Neisseria mucosa C102]
          Length = 333

 Score =  119 bits (297), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 90/298 (30%), Positives = 143/298 (47%), Gaps = 19/298 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  A+  G+ A S   +
Sbjct: 41  FEKANDAKVSVIKAGSGNEMLNKLILSKANPIADAVYGLDNANIGKAKAAGILAASQPKS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           + +   +   D + V  DY Y+A  YDK+   Q     P+   +L        ++   P 
Sbjct: 101 APVTASL--PDALAV--DYAYVAINYDKKWFEQKKLPLPQTLQDLTKPEYKNLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  LL      G+  A + W ++      V KGW+E+Y   F   G +   V+SY
Sbjct: 157 TSSPGLSFLLANIGGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFTQNGGAYPLVVSY 216

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           +TSP   + +Y +  Y       LF +G  + Q+E AA L  +KQP+LA + + ++ S  
Sbjct: 217 ATSPAAEV-HYSKGKYSTPPTGNLFLKGGTFRQVEGAAVLKGAKQPELAAKLVSWLQSGD 275

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q+ LP   W+YP V +  +P V++  + P+ S   N  +    + QW+S W   V R
Sbjct: 276 VQKALPAEMWVYPAVKNTPLPKVFEFAQTPKHSDSPNRADINTKQKQWVSRWSKTVLR 333


>gi|294671373|ref|ZP_06736223.1| hypothetical protein NEIELOOT_03081 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291306921|gb|EFE48164.1| hypothetical protein NEIELOOT_03081 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 334

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 86/293 (29%), Positives = 143/293 (48%), Gaps = 19/293 (6%)

Query: 53  AFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNID 112
           AFER  + ++ +I    G  L+NKL +      AD V G DN  +  A++ G+ A +   
Sbjct: 41  AFERANDAKVSVIKAGSGNELVNKLVLSRAQPIADAVYGLDNTTVLKAKEGGILAAAQPP 100

Query: 113 ASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDP 168
           ++ +   +     +    D GY+A  YDK    +     P++ ++L        +   +P
Sbjct: 101 SAAVTAALPHAAAV----DTGYIAVNYDKAWFAKNKLPLPQSLEDLAKPQYKDLLAMPNP 156

Query: 169 RTSTLGLGLLLW-IQKIYGDNSAQVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLS 224
             S+ GLG LL  IQ +    +   W K+      VTK W+E+Y   F   G S   V+ 
Sbjct: 157 GLSSTGLGFLLANIQGMGEKQAFDWWAKMRANGVKVTKDWSEAYYTEFSRNGGSRPLVVG 216

Query: 225 YSTSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISP 279
           Y++SP   + +YG+  +       LF +G  + Q+E AA L  +KQP LA + +Q++ S 
Sbjct: 217 YASSPAAEV-HYGKGKFDTPPTGVLFLKGGVFRQVEGAAVLNGAKQPALAAKLVQYLQSA 275

Query: 280 SFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
             Q+ +PT  W+YP V +  +PDV++  R PQ S   +     + + +W+S W
Sbjct: 276 PVQKAVPTEMWVYPAVKNTPLPDVFKHARAPQHSDNPSEAAIAKNQRRWVSQW 328


>gi|261379661|ref|ZP_05984234.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria subflava NJ9703]
 gi|284798147|gb|EFC53494.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria subflava NJ9703]
          Length = 333

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 142/298 (47%), Gaps = 19/298 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  A+  G+ A S   +
Sbjct: 41  FEKANDAKVSVIKAGSGNEMLNKLILSKANPIADAVYGLDNANIGKAKAAGILAASQPKS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           + +   +   D + V  DY Y+A  YDK+   Q     P+   +L        ++   P 
Sbjct: 101 APVTASL--PDALAV--DYAYVAINYDKKWFEQKKLPLPQTLQDLTKPEYKNLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ G   LL      G+  A + W ++      V KGW+E+Y   F   G +   V+SY
Sbjct: 157 TSSPGFSFLLANIGGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFTQNGGAYPLVVSY 216

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           +TSP   + +Y +  Y       LF +G  + Q+E AA L  +KQP+LA + + ++ S  
Sbjct: 217 ATSPAAEV-HYSKGKYSTPPTGNLFLKGGTFRQVEGAAVLKGTKQPELAAKLVSWLQSGE 275

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q+ LP   W+YP V +  +P V++  + P+ S   N  +    + QW+S W   V R
Sbjct: 276 VQKALPAEMWVYPAVKNTPLPKVFEFAQTPKHSDSPNRADINTKQKQWVSRWSKTVLR 333


>gi|328949758|ref|YP_004367093.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450082|gb|AEB10983.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Marinithermus hydrothermalis DSM 14884]
          Length = 347

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 145/319 (45%), Gaps = 17/319 (5%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LTV T++SF  DE     + Q F+ +   +++ I   D    LNK  +      AD++ G
Sbjct: 21  LTVLTHSSFSLDEA----LIQQFQEETGIQVRFIEGGDAGETLNKAILSKGAPIADVIYG 76

Query: 92  FDNNLIDLARKTGLFAK-SNIDASQLKLPIKWDDDIF-VPYDYGYLAFIYDKRQITQ-P- 147
           FDN  +  A + G+     + +   LK     D     +P D+GY+A  YDK      P 
Sbjct: 77  FDNTFLSRALEAGILEPYVSPEIRNLKSEFLLDPTFHAIPTDFGYVALNYDKAAFDALPL 136

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATVTKG 206
           P+ F++L       +++ ++P TS+ GL  L+     +G D     W  +      V +G
Sbjct: 137 PQRFEDLTRPEYASRLVVENPATSSPGLAFLIATVAAFGEDGYLDFWAGLRDGGVKVAQG 196

Query: 207 WTESYGFFLK---GESDFVLSYSTSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQ 259
           W+E+Y        G+   V+SY+TSP     F    Y        L  +  +LQ+E    
Sbjct: 197 WSEAYFSAFTPYGGDRPLVVSYTTSPAAEVYFSEGRYTTPPTGNLLLPKSSFLQVEFIGI 256

Query: 260 LVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAE 318
           L  +K  + A+ F+ + +S   Q  +PT  ++YPV  D  +P+ ++   +P +  R + E
Sbjct: 257 LKGTKNREAAERFIDWFLSKPVQENIPTEMFVYPVRRDAELPEFFRWADVPLEPARVDPE 316

Query: 319 ETTRYRNQWISSWQNAVSR 337
              + R +WI  W   V R
Sbjct: 317 VIAQNRERWIREWTQVVLR 335


>gi|229822287|ref|YP_002883813.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Beutenbergia cavernae DSM 12333]
 gi|229568200|gb|ACQ82051.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Beutenbergia cavernae DSM 12333]
          Length = 366

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 150/329 (45%), Gaps = 23/329 (6%)

Query: 22  TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEG 81
           T DG  A  V+ + T++SF   +     ++ AFE      ++LI   DG AL+N+L +  
Sbjct: 44  TTDGGSA--VVRLVTHDSFAISD----DVRAAFEESSGYTIELINPGDGGALVNQLILTK 97

Query: 82  ENSAADIVLGFDNNLIDLARKTGLFAK---SNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           ++   D V G DN     A   G+FA+   S++ AS     I   +D+  P D G +   
Sbjct: 98  DSPLGDAVYGVDNTFASRAIDEGVFAEYVPSDVPASAEPYRIDGAEDLLTPVDVGDVCLN 157

Query: 139 YDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVW 193
            D    T+     P  F++L+        +  +P TS+ GL  LL     +G++     W
Sbjct: 158 VDHAWFTERGLAEPAGFEDLLKPEYRDLTVVTNPATSSPGLAFLLATVGAFGEDGWLDYW 217

Query: 194 KKIATKTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSE 248
            ++     +V  GW ++Y     G    G    VLSYS+SP F + + G     A L  +
Sbjct: 218 AQLRDNGLSVVDGWEDAYYVDFSGAGGGGPRPIVLSYSSSPAFTVGDDGGSTTGALL--D 275

Query: 249 GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVY-QAI 306
             + Q+E A  +  ++ P+ AQ  + F++S  FQ  LP   ++YPV D + +P  + +  
Sbjct: 276 TCFRQVEYAGVIAGAENPEGAQALVDFLLSEDFQADLPEQMYVYPVDDAVELPAEWVEFA 335

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQNAV 335
            +  +       +   +R+ WI  W + V
Sbjct: 336 PLAPEPFEVAPADIAEHRDSWIEQWTDTV 364


>gi|218294710|ref|ZP_03495564.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermus aquaticus Y51MC23]
 gi|218244618|gb|EED11142.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermus aquaticus Y51MC23]
          Length = 344

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 147/319 (46%), Gaps = 22/319 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +TV T++SF  D+     +   FER+   +L+ +   D    LN+  +      AD++ G
Sbjct: 19  ITVLTHSSFSLDKA----LIARFERETGLKLRFLKGGDAGETLNRAILTKGAPIADVIYG 74

Query: 92  FDNNLIDLARKTG-LFAKSNIDASQLKLPIKWDDDI-FVPYDYGYLAFIYDK-----RQI 144
           FDN  +  A +   L    + +   LK  +  D     +P DYG+++  YD+     R +
Sbjct: 75  FDNTFLSRALEADILLPYRSPEIRNLKATLLLDPTFRALPVDYGWVSLNYDRAYFKGRSL 134

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATV 203
            Q P++   L        ++ Q+P TS+ GL  L+     +G D     W  +      V
Sbjct: 135 PQAPRD---LARPEYARLLVVQNPATSSPGLAFLMATVARFGEDGYLDFWAALRDGGVRV 191

Query: 204 TKGWTESY--GFFL-KGESDFVLSYSTSPG---FYLLNYGQDDYVAALFSEGHYLQIEVA 257
            KGW+E+Y   F L KG+   V+SY+TSP    +Y     Q+     LF E  + Q+E  
Sbjct: 192 AKGWSEAYYTHFTLYKGDRPLVVSYTTSPAAEVYYSEGKYQEPPTGNLFPELSFFQVEFV 251

Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFN 316
             L  +K  + A++ + + +S   Q  LPT  WMYP   D  +P+V++    P  S+R +
Sbjct: 252 GILKGTKNLEGAKKVVDWFLSRPVQENLPTEMWMYPARRDAQLPEVFRFAPEPVGSVRLD 311

Query: 317 AEETTRYRNQWISSWQNAV 335
                + R +WI  W   V
Sbjct: 312 PVVMAKNRERWIEEWTKVV 330


>gi|241760677|ref|ZP_04758769.1| thiamin-binding periplasmic protein [Neisseria flavescens SK114]
 gi|241318858|gb|EER55384.1| thiamin-binding periplasmic protein [Neisseria flavescens SK114]
          Length = 333

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 89/298 (29%), Positives = 142/298 (47%), Gaps = 19/298 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  A+  G+ A +   +
Sbjct: 41  FEKANDAKVSVIKAGSGNEMLNKLILSKANPIADAVYGLDNANIGKAKAAGILAANQPKS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           + +   +   D + V  DY Y+A  YDK+   Q     P+   +L        ++   P 
Sbjct: 101 APVTASL--PDALAV--DYAYVAINYDKKWFEQKKLPLPQTLQDLTKPEYKNLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  LL      G+  A + W ++      V KGW+E+Y   F   G S   V+SY
Sbjct: 157 TSSPGLSFLLANIGGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFTQNGGSYPLVVSY 216

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           +TSP   + +Y +  Y       LF +G  + Q+E AA L  +KQP+LA + + ++ S  
Sbjct: 217 ATSPAAEV-HYSKGKYSTPPTGNLFLKGSTFRQVEGAAVLKGAKQPELAAKLVSWLQSGE 275

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q+ LP   W+YP   +  +P V++  + P+ S   N  +    + QW+S W   V R
Sbjct: 276 VQQALPAEMWVYPAAKNTPLPKVFEFAQTPKHSDSPNRADINTKQKQWVSRWSKTVLR 333


>gi|313679334|ref|YP_004057073.1| ABC transporter periplasmic protein [Oceanithermus profundus DSM
           14977]
 gi|313152049|gb|ADR35900.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Oceanithermus profundus DSM 14977]
          Length = 347

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 89/328 (27%), Positives = 154/328 (46%), Gaps = 21/328 (6%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
           GL     LTV T++SF   +     +  +FE++   +L+ I   D    LNK  +     
Sbjct: 14  GLALAETLTVLTHSSFALSK----DVIASFEQQTGIKLRFIEGGDAGETLNKAILSKGAP 69

Query: 85  AADIVLGFDNNLIDLARKTGL---FAKSNIDASQLKLPIKWDDDI-FVPYDYGYLAFIYD 140
            AD++ G DN  +  A + G+   ++   I A Q +  +  D  +  +P DYGY+A  YD
Sbjct: 70  IADVIYGIDNTFLSRALEAGILERYSTPQIGAVQSRFLL--DPTLTALPVDYGYVALNYD 127

Query: 141 KRQIT-QP-PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIA 197
           K     +P P ++++L        ++ ++P TS+ GL  LL      G D   + W+ + 
Sbjct: 128 KEYFKDRPLPGSWEDLAKPEYAKLLVVENPATSSPGLAFLLATVASLGEDGYLKFWEALR 187

Query: 198 TKTATVTKGWTESY-GFFLK--GESDFVLSYSTSPG----FYLLNYGQDDYVAALFSEGH 250
                V  GW+E+Y   F +  G+   V+SY+TSP     F    Y +      L+    
Sbjct: 188 DGGVKVAPGWSEAYFAHFTRYGGDRPLVVSYTTSPAAEVYFSEGAYREPPTGNLLWPGAS 247

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIP 309
           +LQ+E    L  +K    A++F+ +++S   Q  +P   W++PV  D ++PDV++    P
Sbjct: 248 FLQVEFVGILKGTKHRAAAEKFVDWLLSKPVQEDIPLNMWVWPVRRDAALPDVFKFAERP 307

Query: 310 QKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +    + +   + R +WI  W+  V R
Sbjct: 308 LEPAELSPDAIAKNRERWIGEWEAVVVR 335


>gi|291436988|ref|ZP_06576378.1| ABC transporter substrate-binding protein [Streptomyces ghanaensis
           ATCC 14672]
 gi|291339883|gb|EFE66839.1| ABC transporter substrate-binding protein [Streptomyces ghanaensis
           ATCC 14672]
          Length = 378

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 164/361 (45%), Gaps = 34/361 (9%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAK-----PVLTVYTYNSFVADEGAGPKIKQAFER 56
           KK   + VG+ ++T  ++ C   G   +       +T+ ++NS+ A E    ++  AFE+
Sbjct: 23  KKVTILAVGLGLVT--VTACGSSGGDDRSGGGSKTVTLVSHNSWAASE----EVVAAFEK 76

Query: 57  KCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNI-DASQ 115
           +   +LK++   D    +NK  +  +N   D+  G DN L+  A   GLF    + DA  
Sbjct: 77  ESGYKLKVLKDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYEVKDADS 136

Query: 116 LKLPIKWD--DDIFVPYDYGYLAFIYDK-----RQITQPPKNFDELINSTKPWKIIYQDP 168
           +    + D  +    P D G +   YDK     R++T PP+ FD+L        ++ ++ 
Sbjct: 137 ILSEYRVDGGEHRVTPVDTGDVCVNYDKEWFAERKLT-PPRTFDDLTEPEYKNLLVVENA 195

Query: 169 RTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY---------GFFLKGE 218
            TS+ GLG LL     YGD+     WKK+      V  GW ++Y         G   K +
Sbjct: 196 STSSPGLGFLLGTVAEYGDDGWTDYWKKLKANGVKVADGWEQAYNEEFSGSAGGKKAKAD 255

Query: 219 SDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFM 276
              V+SY++SP   ++  +   D     +  +  + Q+E A  L  +K P+  +  + F+
Sbjct: 256 RPLVVSYASSPPAEVIYADPRPDTAPTGVAEDTCFRQVEYAGLLSNAKNPEGGKALLDFL 315

Query: 277 ISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNA-EETTRYRNQWISSWQNA 334
           +   FQ  +P   ++YPV  D  +P  +       K  R  A  +   +R+QW+ SW + 
Sbjct: 316 VGQRFQEDMPLNMFVYPVREDARVPAEFTEFGPQAKDPRTMAPAKIADHRDQWVKSWTSL 375

Query: 335 V 335
           V
Sbjct: 376 V 376


>gi|239928665|ref|ZP_04685618.1| solute binding lipoprotein [Streptomyces ghanaensis ATCC 14672]
          Length = 360

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 164/361 (45%), Gaps = 34/361 (9%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAK-----PVLTVYTYNSFVADEGAGPKIKQAFER 56
           KK   + VG+ ++T  ++ C   G   +       +T+ ++NS+ A E    ++  AFE+
Sbjct: 5   KKVTILAVGLGLVT--VTACGSSGGDDRSGGGSKTVTLVSHNSWAASE----EVVAAFEK 58

Query: 57  KCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNI-DASQ 115
           +   +LK++   D    +NK  +  +N   D+  G DN L+  A   GLF    + DA  
Sbjct: 59  ESGYKLKVLKDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYEVKDADS 118

Query: 116 LKLPIKWD--DDIFVPYDYGYLAFIYDK-----RQITQPPKNFDELINSTKPWKIIYQDP 168
           +    + D  +    P D G +   YDK     R++T PP+ FD+L        ++ ++ 
Sbjct: 119 ILSEYRVDGGEHRVTPVDTGDVCVNYDKEWFAERKLT-PPRTFDDLTEPEYKNLLVVENA 177

Query: 169 RTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY---------GFFLKGE 218
            TS+ GLG LL     YGD+     WKK+      V  GW ++Y         G   K +
Sbjct: 178 STSSPGLGFLLGTVAEYGDDGWTDYWKKLKANGVKVADGWEQAYNEEFSGSAGGKKAKAD 237

Query: 219 SDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFM 276
              V+SY++SP   ++  +   D     +  +  + Q+E A  L  +K P+  +  + F+
Sbjct: 238 RPLVVSYASSPPAEVIYADPRPDTAPTGVAEDTCFRQVEYAGLLSNAKNPEGGKALLDFL 297

Query: 277 ISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNA-EETTRYRNQWISSWQNA 334
           +   FQ  +P   ++YPV  D  +P  +       K  R  A  +   +R+QW+ SW + 
Sbjct: 298 VGQRFQEDMPLNMFVYPVREDARVPAEFTEFGPQAKDPRTMAPAKIADHRDQWVKSWTSL 357

Query: 335 V 335
           V
Sbjct: 358 V 358


>gi|151337014|gb|ABS00950.1| ABC transporter [Thermus aquaticus]
          Length = 344

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 90/319 (28%), Positives = 147/319 (46%), Gaps = 22/319 (6%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +TV T++SF  D+     +   FER+   +L+ +   D    LN+  +      AD++ G
Sbjct: 19  ITVLTHSSFSLDKA----LIARFERETGLKLRFLKGGDAGETLNRAILTKGAPIADVIYG 74

Query: 92  FDNNLIDLARKTG-LFAKSNIDASQLKLPIKWDDDI-FVPYDYGYLAFIYDK-----RQI 144
           FDN  +  A +   L    + +   LK  +  D     +P DYG+++  YD+     R +
Sbjct: 75  FDNTFLSRALEADILLPYRSPEIRNLKATLLLDPTFRALPVDYGWVSLNYDRAYFKDRPL 134

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATV 203
            Q P++   L        ++ Q+P TS+ GL  L+     +G D     W  +      V
Sbjct: 135 PQAPRD---LARPEYARLLVVQNPATSSPGLSFLMATVARFGEDGYLDFWAALRDGGVRV 191

Query: 204 TKGWTESY--GFFL-KGESDFVLSYSTSPG---FYLLNYGQDDYVAALFSEGHYLQIEVA 257
            KGW+E+Y   F L KG+   V+SY+TSP    +Y     Q+     LF E  + Q+E  
Sbjct: 192 AKGWSEAYYTHFTLYKGDRPLVVSYTTSPAAEVYYSEGKYQEPPTGNLFPELSFFQVEFV 251

Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFN 316
             L  +K  + A++ + + +S   Q  LPT  WMYP   D  +P+V++    P  S+R +
Sbjct: 252 GILKGTKNLEGAKKVVDWFLSRPVQENLPTEMWMYPARRDAKLPEVFRFAPEPVGSVRLD 311

Query: 317 AEETTRYRNQWISSWQNAV 335
                + R +WI  W   V
Sbjct: 312 PVVMAKNRERWIEEWTKVV 330


>gi|298370529|ref|ZP_06981845.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281989|gb|EFI23478.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria sp. oral taxon 014 str. F0314]
          Length = 334

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 86/296 (29%), Positives = 143/296 (48%), Gaps = 19/296 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  AR+ G+ A+   ++
Sbjct: 42  FEKANDAKVSVITAGSGNEMLNKLILSKANPIADAVYGLDNANIGKARQAGILAERQPES 101

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+     + +  DY Y+A  YDK    +     PK   +L        ++  +P 
Sbjct: 102 A----PVSASMPVALAVDYAYVALNYDKEWFEKHKLPLPKTMQDLAKPEYKDLLVVPNPA 157

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  LL      G+ +A + W ++      V  GW+E+Y   F   G +   V+SY
Sbjct: 158 TSSTGLTFLLANIGGMGEEAAFKWWAQMRQNGVKVANGWSEAYYTDFTRNGGAYPLVVSY 217

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           +TSP   + ++ +  +       LF +G  + Q+E AA L  +KQP LA + +Q++ S  
Sbjct: 218 ATSPAAEV-HFSKGKFSVPPTGNLFLKGGVFRQVEGAAVLKGAKQPVLAAKLVQWLQSGE 276

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
            Q+ LPT  W+YP V +  +P V++  + PQ +      +    + QW+S W   V
Sbjct: 277 VQKALPTEMWVYPAVKNTPLPKVFEFAQAPQHNDSPGRADIDAKQKQWLSRWTRTV 332


>gi|225076810|ref|ZP_03720009.1| hypothetical protein NEIFLAOT_01861 [Neisseria flavescens
           NRL30031/H210]
 gi|224951849|gb|EEG33058.1| hypothetical protein NEIFLAOT_01861 [Neisseria flavescens
           NRL30031/H210]
          Length = 333

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 88/298 (29%), Positives = 142/298 (47%), Gaps = 19/298 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+  + ++ +I    G  +LNKL +   N  AD V G DN  I  A+  G+ A +   +
Sbjct: 41  FEKANDAKVSVIKAGSGNEMLNKLILSKANPIADAVYGLDNANIGKAKAAGILAANQPKS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           + +   +   D + V  DY Y+A  YDK+   Q     P+   +L        ++   P 
Sbjct: 101 APVTASL--PDALAV--DYAYVAINYDKKWFEQKKLPLPQTLQDLTKPEYKNLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  LL      G+  A + W ++      V KGW+E+Y   F   G +   V+SY
Sbjct: 157 TSSPGLSFLLANIGGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFTQNGGAYPLVVSY 216

Query: 226 STSPGFYLLNYGQDDY----VAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           +TSP   + +Y +  Y       LF +G  + Q+E AA L  +KQP+LA + + ++ S  
Sbjct: 217 ATSPAAEV-HYSKGKYSMPPTGNLFLKGGTFRQVEGAAVLKGAKQPELAAKLVSWLQSGE 275

Query: 281 FQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q+ LP   W+YP   +  +P V++  + P+ S   N  +    + QW+S W   V R
Sbjct: 276 VQKALPAEMWVYPAAKNTPLPKVFEFAQTPKHSDSPNRADINTKQKQWVSRWSKTVLR 333


>gi|332968402|gb|EGK07469.1| thiamine transport system substrate-binding protein [Kingella
           kingae ATCC 23330]
          Length = 365

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/296 (28%), Positives = 140/296 (47%), Gaps = 18/296 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRM-EGENSAADIVLGFDNNLIDLARKTGLFAKSNID 112
           FE   + ++ ++ + DG  +LN+L +   E   AD V G DNN +  A+  G+ AK    
Sbjct: 72  FESANDAKVIILKMGDGNEMLNRLILTRNEGGVADAVFGLDNNTVSKAQAAGILAKQQPA 131

Query: 113 ASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDP 168
           +    + ++      +  DYG++   YDK+         PK+  +L        +   +P
Sbjct: 132 SRNTVVKLQ----TALAVDYGFVTLNYDKKWFADKKLPLPKSLADLAQPAYKDLLAVPNP 187

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTKGWTESY--GFFLKGESD-FVLS 224
            TST GL  LL   +  G+  A  W  K+      +T+GW+++Y   F L G S   ++ 
Sbjct: 188 ATSTPGLAFLLANIRALGEEGAFAWWTKMRGNGVKITQGWSDAYYKEFTLNGGSRPIMVG 247

Query: 225 YSTSPG---FYLLNYGQDDYVAALF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           Y++SP    FY     Q   +  LF + G YLQIE AA L  +KQP LA + +Q + S  
Sbjct: 248 YASSPAAEVFYSEGKLQQPNMGNLFLNGGSYLQIEGAAVLNHAKQPALAAKLVQHLQSDV 307

Query: 281 FQRILPTTNWMYPVVDISMPD-VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
            Q+ +  + W+YP V  + PD + Q   +P +     A +  + +  W++ W   V
Sbjct: 308 AQQSVFRSMWVYPAVQGTKPDAMMQHATVPHRPALLPATQVAQKQKDWVARWTRTV 363


>gi|15805294|ref|NP_293985.1| ABC transporter periplasmic substrate-binding protein [Deinococcus
           radiodurans R1]
 gi|6457935|gb|AAF09847.1|AE001887_7 ABC transporter, periplasmic substrate-binding protein,
           solute-binding family 1 [Deinococcus radiodurans R1]
          Length = 343

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 89/282 (31%), Positives = 134/282 (47%), Gaps = 25/282 (8%)

Query: 34  VYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD 93
           V T++SF  D+    K+   FE +   +++ +   D   LLN+L +      AD+V G D
Sbjct: 24  VITHDSFDVDK----KLVAQFEAQNKAKVRFVKGGDAGELLNRLILTRRAPIADVVYGLD 79

Query: 94  NNLIDLARKTGLFAKSNIDASQLKLPIKW---DDDIFVPYDYGYLAFIYDKRQITQP--- 147
           N+L+  A++  L       A   K+P  +   D  +    DYGY+A  YD+    +    
Sbjct: 80  NSLLARAQQMNLLQPYRSPALG-KVPAGYRLDDAGLLNTVDYGYVALNYDRAYFQKAGLA 138

Query: 148 -PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTK 205
            PK+ D+L         +   P TS+ GL  LL     YG+  A Q WK        V +
Sbjct: 139 LPKSLDDLKKPEYARLTVVSSPATSSPGLAFLLATVNHYGEAGAWQWWKTARAGGLKVVR 198

Query: 206 GWTESY-GFFLK--GESDFVLSYSTSPG---FYLLNY------GQDDYVAALFSEGHYLQ 253
           GW+++Y   F +  G+   VLSY++SP    FY  NY       Q      L     +LQ
Sbjct: 199 GWSDAYYKDFTRAGGKYPIVLSYASSPAAEVFYADNYDPAKLPAQAPTANLLLPGSTWLQ 258

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           +E    L  +KQP LA++F+ FM+SP+ Q  +PT  W+YP V
Sbjct: 259 LEGVGVLKGAKQPALARKFVDFMLSPAVQADIPTRMWIYPAV 300


>gi|291294854|ref|YP_003506252.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Meiothermus ruber DSM 1279]
 gi|290469813|gb|ADD27232.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Meiothermus ruber DSM 1279]
          Length = 360

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/321 (26%), Positives = 148/321 (46%), Gaps = 21/321 (6%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            LTV T++S+  D+     +   FER+    ++ +   D   +LNK  +      AD++ 
Sbjct: 32  TLTVLTHDSWSLDKN----LVARFERESGIRVRFLKGGDAGEMLNKAILSKGAPIADVIY 87

Query: 91  GFDNNLIDLARKTGLFAK-SNIDASQLKLPIKWDDDI-FVPYDYGYLAFIYDKRQITQPP 148
           GFDN ++  A +  +     + + + L+  ++ D      P D+GY+A  YD+      P
Sbjct: 88  GFDNTMLSRALEADILQPYRSPELANLRPELRIDQTFRATPVDFGYVALNYDRDFFKDKP 147

Query: 149 --KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATVTK 205
             + F +L        ++ Q+P TS+ GL  LL     +G D     W+ +      V  
Sbjct: 148 LPQRFADLALPEFAGLLVVQNPATSSPGLAFLLATVAAFGEDGYLDFWENLRKNGVRVVS 207

Query: 206 GWTESY-GFFLK--GESDFVLSYSTSPGFYLLNYGQ------DDYVAALF-SEGHYLQIE 255
           GW+E+Y   F +  G+   V+SYSTSP   L  Y +      +   A LF     + Q+E
Sbjct: 208 GWSEAYYTHFTRAGGDRPLVVSYSTSPAAELY-YSEAQPKPTEPPTANLFLPRSSFFQVE 266

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLR 314
               L  ++  + AQ F+ +++S   Q  +PT  W+YP   D  +P+V++  ++P +  R
Sbjct: 267 YVGILKGTRNLRAAQRFVDWLVSKPVQENIPTQMWVYPARQDARLPEVFRFAQVPPEPAR 326

Query: 315 FNAEETTRYRNQWISSWQNAV 335
              ++    R +WI  W   V
Sbjct: 327 LTPQQIANNRERWIREWTQVV 347


>gi|256784927|ref|ZP_05523358.1| solute binding lipoprotein [Streptomyces lividans TK24]
          Length = 378

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 91/362 (25%), Positives = 159/362 (43%), Gaps = 33/362 (9%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKP-------VLTVYTYNSFVADEGAGPKIKQAF 54
           KK   + VG+ M+ G ++ C                 +T+ +++S+   +     +  AF
Sbjct: 20  KKAGVLAVGLGMV-GTLAACGSSDDGGDGSGSGGSRTVTLVSHDSWAVSK----DVIAAF 74

Query: 55  ERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDAS 114
           E+    ++K++   D    +NK  +  +N   D+  G DN L+  A   GLF       S
Sbjct: 75  EKNSGYKVKVLEDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYEAKGS 134

Query: 115 QLKLP---IKWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQD 167
            L LP      D     P D G +   YDK    +    PP+  D+L+       ++ ++
Sbjct: 135 DLVLPEYRADRDKHRVTPVDTGDICVNYDKAYFREHGLTPPRTLDDLVKPEYKDLLVTEN 194

Query: 168 PRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTESY---------GFFLKG 217
             +S+ GLG LL     YGD   +  WKK+ +    V   W ++Y         G   KG
Sbjct: 195 AGSSSPGLGFLLGTAAKYGDGGWEGYWKKLKSNGVKVVDSWEQAYNEEFSGSAGGKKAKG 254

Query: 218 ESDFVLSYSTSPGFYLLNYG-QDDYVAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQF 275
           +   V+SY++SP   ++    Q D      ++G  + Q+E A  L  +K P+  +  + F
Sbjct: 255 DRPLVVSYASSPPVEVVYADPQPDTAPTGVADGTCFRQVEYAGLLSNAKNPEGGKALLDF 314

Query: 276 MISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLR-FNAEETTRYRNQWISSWQN 333
           ++S SFQ  +P   ++YPV +   +P+V+       K  +  +  +    R+QW+ SW +
Sbjct: 315 LLSKSFQEDMPLNMFVYPVREGAQVPEVFSKFGPRAKDPQTLDPAKIADNRDQWVKSWTS 374

Query: 334 AV 335
            V
Sbjct: 375 LV 376


>gi|240013193|ref|ZP_04720106.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae DGI18]
 gi|240015634|ref|ZP_04722174.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae FA6140]
 gi|240120265|ref|ZP_04733227.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae PID24-1]
          Length = 333

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 136/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +  +N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRDNPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSVNYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANIGGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ SP  
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSPEV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPAHTTAPAQRDIDANQRGWVSRW 327


>gi|269793761|ref|YP_003313216.1| ThiB subfamily ABC transporter periplasmic binding protein
           [Sanguibacter keddieii DSM 10542]
 gi|269095946|gb|ACZ20382.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Sanguibacter keddieii DSM 10542]
          Length = 367

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 136/319 (42%), Gaps = 20/319 (6%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            + V  ++SF    G   + K AFE +    L +I   DG AL NKL +  E+   D+  
Sbjct: 53  TVDVVVHDSF----GITDEAKAAFEEESGFTLNVITTGDGGALANKLVLTKESPLGDVAF 108

Query: 91  GFDNNLIDLARKTGLFAKSNIDA---SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ- 146
           G DN+    A   G+F      A       L +  D     P DYG +    D     + 
Sbjct: 109 GIDNSFASRAVDEGVFEPYTSPALPDGAGDLAVD-DTGTLTPVDYGDVCLNVDTGWFDEA 167

Query: 147 ---PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTAT 202
               P+  ++L +       +  +P TST GL  L      +G D     W  +      
Sbjct: 168 GIDAPETLEDLADPQYADLTVVTNPATSTPGLSFLFATIGHFGTDGYLDYWSSLTDNGLK 227

Query: 203 VTKGWTESY--GFFLKGESD--FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAA 258
           V  GW ++Y   F   GE D   VLSY++SP + + + G     AAL  +  + Q+E A 
Sbjct: 228 VVDGWEDAYYTDFSASGEGDRPVVLSYASSPAYTVSDDGTSSTTAALL-DTCFRQVEYAG 286

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIR-IPQKSLRFN 316
            L     P+ AQ F+ F++   FQ  +P T +++PV  D ++P  ++    +P   +  +
Sbjct: 287 VLANGDNPEGAQAFVDFLLGDQFQSDIPETMYVFPVSPDATIPAEWETFAPVPTSPIALD 346

Query: 317 AEETTRYRNQWISSWQNAV 335
             E +  R+ WI  W   V
Sbjct: 347 PAEISANRDTWIKDWTAQV 365


>gi|261379163|ref|ZP_05983736.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria cinerea ATCC 14685]
 gi|269144349|gb|EEZ70767.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria cinerea ATCC 14685]
          Length = 333

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER+ N ++ +I   +   +LNKL +   N  AD V G DN  I  AR+ G+ A    D 
Sbjct: 41  FERENNAKVSVIQAGNANEMLNKLILSRANPIADAVYGLDNANIGKAREMGVLA----DE 96

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
               LP+       +  DYGY+   YDK+   +     PK   +L        ++   P 
Sbjct: 97  QPKSLPVSVGLPSVLAVDYGYVTLNYDKKWFAEKKLPLPKTLQDLTRPEYKKLLVTPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GL  L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLSFLMANIGGMGEAGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSGEV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           QR +P+  W+YP V +  +P+V++  + P  +   +  +    +  W+  W
Sbjct: 277 QRAVPSEMWVYPAVKNTPLPEVFRFAQAPTHTDSPSRADINAKQRGWVGRW 327


>gi|194099665|ref|YP_002002800.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae NCCP11945]
 gi|239999857|ref|ZP_04719781.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae 35/02]
 gi|240114040|ref|ZP_04728530.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae MS11]
 gi|240127270|ref|ZP_04739931.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae SK-93-1035]
 gi|268595668|ref|ZP_06129835.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|268600104|ref|ZP_06134271.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|268685633|ref|ZP_06152495.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|193934955|gb|ACF30779.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           gonorrhoeae NCCP11945]
 gi|268549057|gb|EEZ44475.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae 35/02]
 gi|268584235|gb|EEZ48911.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae MS11]
 gi|268625917|gb|EEZ58317.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae
           SK-93-1035]
 gi|317165149|gb|ADV08690.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 333

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 135/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSVNYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANIGGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ SP  
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSPEV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPAHTTAPAQRDIDANQRGWVSRW 327


>gi|289768820|ref|ZP_06528198.1| solute binding lipoprotein [Streptomyces lividans TK24]
 gi|289699019|gb|EFD66448.1| solute binding lipoprotein [Streptomyces lividans TK24]
          Length = 354

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 82/304 (26%), Positives = 137/304 (45%), Gaps = 21/304 (6%)

Query: 53  AFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNID 112
           AFE+    ++K++   D    +NK  +  +N   D+  G DN L+  A   GLF      
Sbjct: 49  AFEKNSGYKVKVLEDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYEAK 108

Query: 113 ASQLKLP---IKWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIY 165
            S L LP      D     P D G +   YDK    +    PP+  D+L+       ++ 
Sbjct: 109 GSDLVLPEYRADRDKHRVTPVDTGDICVNYDKAYFREHGLTPPRTLDDLVKPEYKDLLVT 168

Query: 166 QDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTESY---------GFFL 215
           ++  +S+ GLG LL     YGD   +  WKK+ +    V   W ++Y         G   
Sbjct: 169 ENAGSSSPGLGFLLGTAAKYGDGGWEGYWKKLKSNGVKVVDSWEQAYNEEFSGSAGGKKA 228

Query: 216 KGESDFVLSYSTSPGFYLLNYG-QDDYVAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFM 273
           KG+   V+SY++SP   ++    Q D      ++G  + Q+E A  L  +K P+  +  +
Sbjct: 229 KGDRPLVVSYASSPPVEVVYADPQPDTAPTGVADGTCFRQVEYAGLLSNAKNPEGGKALL 288

Query: 274 QFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLR-FNAEETTRYRNQWISSW 331
            F++S SFQ  +P   ++YPV +   +P+V+       K  +  +  +    R+QW+ SW
Sbjct: 289 DFLLSKSFQEDMPLNMFVYPVREGAQVPEVFSKFGPRAKDPQTLDPAKIADNRDQWVKSW 348

Query: 332 QNAV 335
            + V
Sbjct: 349 TSLV 352


>gi|226356561|ref|YP_002786301.1| Thiamine ABC transporter periplasmic protein [Deinococcus deserti
           VCD115]
 gi|226318551|gb|ACO46547.1| putative Thiamine ABC transporter, periplasmic component
           [Deinococcus deserti VCD115]
          Length = 342

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 106/352 (30%), Positives = 161/352 (45%), Gaps = 34/352 (9%)

Query: 6   RIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI 65
           +I+   +++ G  S        A+  LTV T++SF  D+    K+   FE      ++ +
Sbjct: 3   KILCSALLMLGAAS--------AQSTLTVITHDSFSVDK----KLIAQFEAANKARVRFV 50

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF-AKSNIDASQLKLPIKWDD 124
              D   LL++L +      AD+V G DN+L+  AR  G+  A  +   S +    + DD
Sbjct: 51  KGGDAGELLSRLILTRRAPVADVVYGLDNSLLARARTAGILEAYKSPAQSAVAARYRLDD 110

Query: 125 -DIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPRTSTLGLGLLL 179
             +  P DYGY+A  YD+    +     P++ D+L         +   P TS+ GL  LL
Sbjct: 111 AGLLNPVDYGYVALNYDRAYFQKAGLALPESLDDLKKPEYARLTVVSSPATSSPGLAFLL 170

Query: 180 WIQKIYGDNSAQVWKKIATKTAT-VTKGWTESY-GFFLK--GESDFVLSYSTSP------ 229
                YG+  A  W K A      VT+GW++SY   F +  G+   VLSY++SP      
Sbjct: 171 ATVNHYGEAGAWAWWKAARAGGMKVTRGWSDSYYKEFSRNGGKYPIVLSYASSPAAEVFY 230

Query: 230 --GFYLLNYGQDDYVAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILP 286
             GF           A LF  G  YLQIE    L  +KQ  LA++F+ FM+S   Q  +P
Sbjct: 231 ADGFDPKKLPAQSPTANLFLPGSTYLQIEGVGILKGTKQAALARKFVDFMLSAPVQADIP 290

Query: 287 TTNWMYPVVDISMPD-VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           T  W+YP V  +  D VY+  + P   ++  A   T    + + +W   V R
Sbjct: 291 TRMWVYPAVSGTKLDPVYRFAQQPD--VKAVAPSVTANPQRLVDAWITQVLR 340


>gi|289806020|ref|ZP_06536649.1| thiamine-binding periplasmic protein precursor [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 81

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 46/78 (58%), Positives = 62/78 (79%)

Query: 116 LKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGL 175
           +K+P  W +D FVP+DYGY AF+YDK ++  PPK+  EL+ S + W++IYQDPRTST GL
Sbjct: 4   VKVPGGWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTPGL 63

Query: 176 GLLLWIQKIYGDNSAQVW 193
           GLLLW++K+YGDN+ Q W
Sbjct: 64  GLLLWMRKVYGDNAPQAW 81


>gi|313667372|ref|YP_004047656.1| solute-binding periplasmic protein [Neisseria lactamica ST-640]
 gi|313004834|emb|CBN86259.1| putative solute-binding periplasmic protein [Neisseria lactamica
           020-06]
          Length = 333

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 82/291 (28%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPGS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSGEV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           QR +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QRAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|256831562|ref|YP_003160289.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Jonesia denitrificans DSM 20603]
 gi|256685093|gb|ACV07986.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Jonesia denitrificans DSM 20603]
          Length = 363

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 139/318 (43%), Gaps = 24/318 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV  ++SF   E    + +  FE+    +L ++   DG AL+N L +  +   AD V 
Sbjct: 49  TVTVVVHDSFQMSE----EQQADFEKTSGYDLTIVTNGDGGALVNSLILTKDAPIADAVF 104

Query: 91  GFDNNLIDLARKTGLFAKSNID-ASQ----LKLPIKWDDDIFVPYDYGYLAFIYD----K 141
           G DN          +FA    + ASQ    L LP    DD     D+G +    D    +
Sbjct: 105 GVDNTFASRGISEEVFAPYTSEVASQTSRDLALP---GDDTLTAIDFGDVCLNVDPTWFE 161

Query: 142 RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKIATKT 200
                 P   D+L +       +  +P TS+ GL  L      YG D     W ++    
Sbjct: 162 NHSLDVPATLDDLADPAYRNLTVVTNPATSSPGLSFLFATIGKYGEDGYLDYWTQLKDNG 221

Query: 201 ATVTKGWTESY--GFFLKGESD--FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
             +  GW ++Y   F   G+ D    LSY++SP F + + G     +AL  +  + Q+E 
Sbjct: 222 LKIVDGWEDAYYVDFTATGDGDRPIALSYASSPAFTVTDDGSATTTSALL-DTCFRQVEY 280

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVY-QAIRIPQKSLR 314
           A  L  +  P+ AQ F+ +++S  +Q  +P   +MYPV D + +PD + Q   +P   + 
Sbjct: 281 AGVLHGAANPEGAQAFIDYLLSEDYQTTIPDAMYMYPVADTVELPDAWAQFAPVPTTPIS 340

Query: 315 FNAEETTRYRNQWISSWQ 332
            + +   R R+ WI  W 
Sbjct: 341 LDPDTIARMRDTWIKDWS 358


>gi|325135256|gb|EGC57879.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M13399]
          Length = 333

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|15675981|ref|NP_273107.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           meningitidis MC58]
 gi|7225261|gb|AAF40512.1| ABC transporter, periplasmic solute-binding protein [Neisseria
           meningitidis MC58]
 gi|316983612|gb|EFV62594.1| ABC transporter periplasmic binding , thiB subfamily protein
           [Neisseria meningitidis H44/76]
 gi|325199272|gb|ADY94727.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis H44/76]
          Length = 333

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 135/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+ SA + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEESAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|319409563|emb|CBY89854.1| thiamine-binding periplasmic protein [Neisseria meningitidis WUE
           2594]
 gi|325129199|gb|EGC52044.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis N1568]
 gi|325131185|gb|EGC53901.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis OX99.30304]
          Length = 333

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|21223997|ref|NP_629776.1| solute binding lipoprotein [Streptomyces coelicolor A3(2)]
 gi|3319740|emb|CAA19906.1| putative solute binding lipoprotein [Streptomyces coelicolor A3(2)]
          Length = 373

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 137/304 (45%), Gaps = 21/304 (6%)

Query: 53  AFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNID 112
           AFE+    ++K++   D    +NK  +  +N   D+  G DN L+  A   GLF      
Sbjct: 68  AFEKNSGYKVKVLEDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYEAK 127

Query: 113 ASQLKLP---IKWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIY 165
            S L LP      +     P D G +   YDK    +    PP+  D+L+       ++ 
Sbjct: 128 GSDLVLPEYRADREKHRVTPVDTGDICVNYDKAYFREHGLTPPRTLDDLVKPEYKDLLVT 187

Query: 166 QDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTESY---------GFFL 215
           ++  +S+ GLG LL     YGD   +  WKK+ +    V   W ++Y         G   
Sbjct: 188 ENAGSSSPGLGFLLGTAAKYGDEGWEGYWKKLKSNGVKVVDSWEQAYNEEFSGSAGGKKA 247

Query: 216 KGESDFVLSYSTSPGFYLLNYG-QDDYVAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFM 273
           KG+   V+SY++SP   ++    Q D      ++G  + Q+E A  L  +K P+  +  +
Sbjct: 248 KGDRPLVVSYASSPPVEVVYADPQPDTAPTGVADGTCFRQVEYAGLLSNAKNPEGGKALL 307

Query: 274 QFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLR-FNAEETTRYRNQWISSW 331
            F++S SFQ  +P   ++YPV +   +P+V+       K  +  +  +    R+QW+ SW
Sbjct: 308 DFLLSKSFQEDMPLNMFVYPVREGAQVPEVFSKFGPRAKDPQTLDPAKIADNRDQWVKSW 367

Query: 332 QNAV 335
            + V
Sbjct: 368 TSLV 371


>gi|46199758|ref|YP_005425.1| thiamine-binding protein [Thermus thermophilus HB27]
 gi|46197385|gb|AAS81798.1| thiamine-binding protein [Thermus thermophilus HB27]
          Length = 344

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 151/334 (45%), Gaps = 19/334 (5%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           I   +++ TL GL  +  L V T++SF  D+     +   F+ +    L+ +   D    
Sbjct: 4   ILAALAFLTL-GLAQE--LVVLTHSSFSLDKA----LIARFQEETGIRLRFLKGGDAGET 56

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTG-LFAKSNIDASQLKLPIKWDDDI-FVPYD 131
           LNK  +      AD++ GFDN  +  A +   L    + +   L+  +  D     +P D
Sbjct: 57  LNKAILSKGAPIADVLYGFDNTFLSRALEADILLPYVSPEIRNLRSELLLDPSFRAIPVD 116

Query: 132 YGYLAFIYDKRQITQP--PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DN 188
           YG+++  YD+        P+  ++L        ++ ++P TS+ GL  L+     +G D 
Sbjct: 117 YGFVSLNYDRAYFRGKALPQRPEDLARPEHARLLVVENPATSSPGLAFLMATVARFGEDG 176

Query: 189 SAQVWKKIATKTATVTKGWTESY--GFFLKG-ESDFVLSYSTSPG---FYLLNYGQDDYV 242
               W ++      V KGW+E+Y   F L G +   V+SY+TSP    +Y     ++   
Sbjct: 177 YLDFWARLRDGGVRVAKGWSEAYYTHFTLHGGDRPLVVSYTTSPAAEVYYSEGKYKEPPT 236

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPD 301
             LF E  + Q+E    L  +K  + A+ F+ +++S   Q  +PT  W+YP   D  +P+
Sbjct: 237 GNLFPELAFFQVEFVGILKGTKNLEAARRFVDWLLSRPVQENIPTEMWVYPARRDARLPE 296

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           V++    P  ++R +       R +WI  W   V
Sbjct: 297 VFRFTPPPAGAVRLDPARMAANRERWIEEWTRVV 330


>gi|297202672|ref|ZP_06920069.1| ABC transporter substrate-binding protein [Streptomyces sviceus
           ATCC 29083]
 gi|197713247|gb|EDY57281.1| ABC transporter substrate-binding protein [Streptomyces sviceus
           ATCC 29083]
          Length = 358

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 94/359 (26%), Positives = 162/359 (45%), Gaps = 31/359 (8%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKP----VLTVYTYNSFVADEGAGPKIKQAFERK 57
           KKF  +VVG+ ++T  +S C      +K      +T+ +++S+   +     +   FE+K
Sbjct: 4   KKFCAVVVGLGLVT--LSACGSSSDDSKSSGSKTVTLVSHDSWAVSK----SVLADFEKK 57

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNID-ASQL 116
              ++K++   D    +NK  +  +N   D+  G DN L+  A   GLF       A ++
Sbjct: 58  SGYQVKVLEDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQSYEAKGADRI 117

Query: 117 KLPIKWDDDIF--VPYDYGYLAFIYDK----RQITQPPKNFDELINSTKPWKIIYQDPRT 170
           K   + D D     P D G +   YDK        QPP ++D+L+       ++ ++   
Sbjct: 118 KAEYRVDQDKHRVTPIDSGDICVNYDKAWFAEHKLQPPTSYDDLVKPAYKNLLVTENASI 177

Query: 171 STLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTESY---------GFFLKGESD 220
           S+ GLG LL     YGD+  Q  WKK+      V  GW ++Y         G   K +  
Sbjct: 178 SSPGLGFLLGSAAKYGDDGWQGYWKKLKANGVKVVDGWEQAYNEEFSGSAGGKKAKADRP 237

Query: 221 FVLSYSTSPGFYLLNYGQDDYVAAL-FSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMIS 278
            V+SY++SP   ++        A    ++G  + QIE A  L  +K  +  + F+ F+++
Sbjct: 238 LVVSYASSPPAEVIYADPKPKTAPTGVAQGTCFRQIEYAGLLSNAKNTKGGKAFLDFLLT 297

Query: 279 PSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKSLR-FNAEETTRYRNQWISSWQNAV 335
             FQ+ +P   ++YPVVD   +P  +       K     + E+    R+ W+ SW + V
Sbjct: 298 KEFQQDMPLNMFVYPVVDGAPVPAEFTEYGPQAKDPETMDPEKIADNRDDWVKSWTSLV 356


>gi|296140745|ref|YP_003647988.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Tsukamurella paurometabola DSM 20162]
 gi|296028879|gb|ADG79649.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Tsukamurella paurometabola DSM 20162]
          Length = 353

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 85/358 (23%), Positives = 147/358 (41%), Gaps = 26/358 (7%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP--------VLTVYTYNSFVADEGAGPKIKQ 52
           MK  ARI + +   T  +S C  D  P+ P         +T+ T++SF   +     +  
Sbjct: 1   MKNLARIGLVLTAATLALSACATDTAPSAPSGAPAATGTVTLVTHDSFSLPD----DVTA 56

Query: 53  AFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNID 112
            F R+   ELK + L DG  L  KL +   N   D+  G DN       + G+F      
Sbjct: 57  EFTRQTGLELKTVALGDGGELATKLALTPGNPPGDVAFGVDNTYAARPARAGVFDDYTSP 116

Query: 113 ASQLKLPIKWDDDI--FVPYDYGYLAFIYDKR----QITQPPKNFDELINSTKPWKIIYQ 166
           A+         D I      D+G +    D R    +    P  + +L +       + +
Sbjct: 117 AAANGAADYALDGIGGLTAIDFGDVCVNIDTRYFQDKGLPEPATYRDLADPKYRGLTVVE 176

Query: 167 DPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY-----GFFLKGESDF 221
            P T++ G+  L       GD     W  +     +V   W+ +Y     G   +G    
Sbjct: 177 HPETASPGMAFLAGTVAALGDGWKDYWTALRGNDVSVVPNWSTAYSTDFSGSSGRGPRPI 236

Query: 222 VLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           V+SY++SP   +   G      AL  +  + Q+E A  L  +K P+ A++ + F+++P  
Sbjct: 237 VVSYASSPVAEVGKDGAPPPTKALL-DTCFRQVEYAGVLRGTKNPEGARKLIDFLLTPRA 295

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIR-IPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           Q  +P   ++YPV  ++ +P  +Q    +PQ+     A+     R+ W+  W+  + R
Sbjct: 296 QGAIPDAMYVYPVTREVPLPASWQKFAPVPQRPATLPADRIADERDGWVRDWRQIMGR 353


>gi|261401525|ref|ZP_05987650.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria lactamica ATCC 23970]
 gi|269208432|gb|EEZ74887.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria lactamica ATCC 23970]
          Length = 333

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPGS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|309379868|emb|CBX21644.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 333

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPGS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSGEV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|254392090|ref|ZP_05007279.1| solute binding lipoprotein [Streptomyces clavuligerus ATCC 27064]
 gi|294815392|ref|ZP_06774035.1| ABC transporter substrate-binding protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|326443744|ref|ZP_08218478.1| putative ABC transporter substrate-binding protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|197705766|gb|EDY51578.1| solute binding lipoprotein [Streptomyces clavuligerus ATCC 27064]
 gi|294327991|gb|EFG09634.1| ABC transporter substrate-binding protein [Streptomyces
           clavuligerus ATCC 27064]
          Length = 370

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 142/329 (43%), Gaps = 27/329 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ T+ SF   E    K+ + F R     +K++   D    LNK  +   +   D+  
Sbjct: 47  TVTLVTHESFAVSE----KVLKEFTRSTGYTVKVLKSGDAGEALNKEILTKGSPQGDVFF 102

Query: 91  GFDNNLIDLARKTGLFAK---SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ- 146
           G DN L+  A   G+F       +D     + +        P D G +   YDK+     
Sbjct: 103 GVDNTLLSRALDNGIFTSYEAKGLDQVGDAVELDRGRHRVTPVDTGDICVNYDKKYFADK 162

Query: 147 ---PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTAT 202
              PP+ FD+LI       ++ ++  TS+ GLG LL     YG+   Q  WK +      
Sbjct: 163 KLAPPRTFDDLIKPEYKNLLVVENAATSSPGLGFLLGTVARYGEKGWQEYWKDLKENGVK 222

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYG-QDDYVAALFSEGH-Y 251
           V  GW+E+Y         G   KGE   V+SY++SP   +L    Q        ++G  +
Sbjct: 223 VVDGWSEAYNEEFSGSAGGRKAKGERPLVVSYASSPPVEVLYADPQPAEAPTGVADGTCF 282

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQA--IRI 308
            QIE A  L  +K     +  + FM+S +FQ  LP   ++ PV+D   +P+++ A   RI
Sbjct: 283 RQIEFAGLLNGAKNEAGGKALLDFMVSKTFQEDLPLKMFVNPVLDGAKLPEIFTAHGTRI 342

Query: 309 PQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            Q     +       R QWI +W + V R
Sbjct: 343 EQPPT-VDPGTIADNREQWIQTWSSTVLR 370


>gi|325203173|gb|ADY98626.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M01-240355]
          Length = 333

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|55981777|ref|YP_145074.1| ABC transporter periplasmic substrate-binding protein [Thermus
           thermophilus HB8]
 gi|55773190|dbj|BAD71631.1| ABC transporter, periplasmic substrate-binding protein [Thermus
           thermophilus HB8]
          Length = 344

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 151/334 (45%), Gaps = 19/334 (5%)

Query: 14  ITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVAL 73
           I   +++ TL GL  +  L V T++SF  D+     +   F+ +    L+ +   D    
Sbjct: 4   ILAALAFLTL-GLAQE--LVVLTHSSFSLDKA----LIARFQEETGIRLRFLKGGDAGET 56

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTG-LFAKSNIDASQLKLPIKWDDDI-FVPYD 131
           LNK  +      AD++ GFDN  +  A +   L    + +   L+  +  D     +P D
Sbjct: 57  LNKAILSKGAPIADVLYGFDNTFLSRALEADILLPYVSPEIRNLRSELLLDPSFRAIPVD 116

Query: 132 YGYLAFIYDKRQITQP--PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DN 188
           YG+++  YD+        P+  ++L        ++ ++P TS+ GL  L+     +G D 
Sbjct: 117 YGFVSLNYDRAYFRGKALPQRPEDLARPEYARLLVVENPATSSPGLAFLMATVARFGEDG 176

Query: 189 SAQVWKKIATKTATVTKGWTESY--GFFLKG-ESDFVLSYSTSPG---FYLLNYGQDDYV 242
               W ++      V KGW+E+Y   F L G +   V+SY+TSP    +Y     ++   
Sbjct: 177 YLDFWARLRDGGVRVAKGWSEAYYTHFTLHGGDRPLVVSYTTSPAAEVYYSEGKYKEPPT 236

Query: 243 AALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPD 301
             LF E  + Q+E    L  +K  + A+ F+ +++S   Q  +PT  W+YP   D  +P+
Sbjct: 237 GNLFPELAFFQVEFVGILKGTKNLEAARRFVDWLLSRPVQENIPTEMWVYPARRDARLPE 296

Query: 302 VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           V++    P  ++R +       R +WI  W   V
Sbjct: 297 VFRFTPPPAGAVRLDPARMAANRERWIEEWTRVV 330


>gi|325137243|gb|EGC59837.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M0579]
 gi|325139273|gb|EGC61817.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis ES14902]
 gi|325139503|gb|EGC62043.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis CU385]
 gi|325197345|gb|ADY92801.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis G2136]
 gi|325201231|gb|ADY96685.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M01-240149]
          Length = 333

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|325267017|ref|ZP_08133687.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Kingella denitrificans
           ATCC 33394]
 gi|324981517|gb|EGC17159.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Kingella denitrificans
           ATCC 33394]
          Length = 335

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 85/299 (28%), Positives = 140/299 (46%), Gaps = 22/299 (7%)

Query: 53  AFERKCNCELKLIGLSDGVALLNKLRM-EGENSAADIVLGFDNNLIDLARKTGLFAKSNI 111
           AFE   + ++ ++ + DG A+LN+L +   E   AD V G DNN +  A   G+ A    
Sbjct: 41  AFESANDAKVVILKMGDGNAMLNRLILTRNEGGVADAVYGLDNNTVAKAHAAGILAARQP 100

Query: 112 DASQ--LKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIY 165
            +++  ++LP        +  DYG++   YDK+   +     PK   +L        ++ 
Sbjct: 101 ASARTVVQLPHA------LAVDYGFVTLNYDKKWFAEKKLPLPKTLADLTQPAYRNLLVM 154

Query: 166 QDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTKGWTESY--GFFLKGES-DF 221
            +P TST GL  LL   +  G+  A  W  K+      VT+GW+++Y   F L G +   
Sbjct: 155 PNPATSTPGLAFLLANIRGLGEEGAFAWWAKMRQNGVKVTQGWSDAYYKEFTLNGGARPL 214

Query: 222 VLSYSTSPG---FYLLNYGQDDYVAALF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMI 277
           ++ Y++SP    FY         +  LF   G YLQIE AA L  +KQP LA + +Q + 
Sbjct: 215 MVGYASSPAAEVFYSEGKLTQPNMGLLFLPGGSYLQIEGAAVLNHAKQPALAAKLVQHLQ 274

Query: 278 SPSFQRILPTTNWMYPVVDISMPD-VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           S   Q+ +    W+YP V  +  D + +   +PQ+       +  + +  W++ W   V
Sbjct: 275 SAVVQKAIFRAMWVYPAVQGTPSDPMMRHSTVPQRPSLLPPAQVAQKQKDWVARWTRTV 333


>gi|304388841|ref|ZP_07370895.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Neisseria meningitidis
           ATCC 13091]
 gi|304337207|gb|EFM03387.1| thiamin/thiamine pyrophosphate ABC superfamily ATP binding cassette
           transporter, binding protein [Neisseria meningitidis
           ATCC 13091]
          Length = 353

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 61  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPGS 120

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 121 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 176

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 177 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 236

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 237 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 296

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 297 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 347


>gi|254669649|emb|CBA03718.1| thiamine transport system substrate-binding protein [Neisseria
           meningitidis alpha153]
          Length = 353

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 61  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 120

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 121 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 176

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 177 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 236

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 237 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 296

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 297 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 347


>gi|261391590|emb|CAX49028.1| thiamine-binding periplasmic protein [Neisseria meningitidis 8013]
 gi|325205139|gb|ADZ00592.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M04-240196]
          Length = 333

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|121633917|ref|YP_974162.1| putative solute-binding periplasmic protein [Neisseria meningitidis
           FAM18]
 gi|161869059|ref|YP_001598225.1| thiamin-binding periplasmic protein [Neisseria meningitidis 053442]
 gi|218767299|ref|YP_002341811.1| putative thiamin-binding periplasmic protein [Neisseria
           meningitidis Z2491]
 gi|254805881|ref|YP_003084102.1| thiamine transport system substrate-binding protein [Neisseria
           meningitidis alpha14]
 gi|120865623|emb|CAM09343.1| putative solute-binding periplasmic protein [Neisseria meningitidis
           FAM18]
 gi|121051307|emb|CAM07592.1| putative thiamin-binding periplasmic protein [Neisseria
           meningitidis Z2491]
 gi|161594612|gb|ABX72272.1| thiamin-binding periplasmic protein [Neisseria meningitidis 053442]
 gi|254669423|emb|CBA08646.1| thiamine transport system substrate-binding protein [Neisseria
           meningitidis alpha14]
 gi|325133200|gb|EGC55870.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M6190]
 gi|325145476|gb|EGC67750.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis M01-240013]
          Length = 333

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|308388263|gb|ADO30583.1| putative solute-binding periplasmic protein [Neisseria meningitidis
           alpha710]
          Length = 353

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 61  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 120

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 121 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 176

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 177 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 236

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 237 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 296

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 297 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 347


>gi|332668858|ref|YP_004451866.1| ThiB subfamily ABC transporter periplasmic binding protein
           [Cellulomonas fimi ATCC 484]
 gi|332337896|gb|AEE44479.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Cellulomonas fimi ATCC 484]
          Length = 361

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/342 (23%), Positives = 153/342 (44%), Gaps = 20/342 (5%)

Query: 10  GIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSD 69
           G   I G  +  T  G PA+  +T+ T++SF   +G    + + FE++    ++++   D
Sbjct: 24  GCSAIGGGEAAPTSSGDPARTTVTLVTHDSFGLSDG----LIETFEQQTGMTVEIVQPGD 79

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW---DDDI 126
             AL+N+L +  +    D+V G DN     A + G+      D    +   ++     D 
Sbjct: 80  AGALVNQLVLTKDAPLGDLVFGIDNTFASRAVEEGVVESFTPDVPAAEDAAQYAVEGSDA 139

Query: 127 FVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
               D+G +    D    T+     P   D+L        ++     TS+ GL  LL   
Sbjct: 140 LTAIDFGDVCLNVDHAWFTEHGVAEPATLDDLTRPEYKDLLVVPSAVTSSPGLAFLLATV 199

Query: 183 KIYGDNSAQV-WKKIATKTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNY 236
              G++  +  W+ +      V++GW+++Y     G    G    VLSY++SP F +   
Sbjct: 200 GAKGEDGWEAYWQALVANGVKVSEGWSDAYYTDFSGGGGDGPRPVVLSYASSPPFTVPEG 259

Query: 237 GQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD 296
           G++    AL  +  + Q+E A  L  +  P+ A++ + F++S   Q  +PT+ +MYPV  
Sbjct: 260 GEEPTTGALL-DTCFRQVEYAGVLTGAANPEGARQLLTFLLSDEVQADIPTSMYMYPVSS 318

Query: 297 -ISMPDVYQA-IRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
            + +P+ +     + Q+       +   +R +W+++W   V+
Sbjct: 319 AVDLPEEWARWAPLAQEPFEVAPADVDAHREEWLATWSEIVA 360


>gi|55377073|ref|YP_134923.1| thiamine-binding periplasmic protein-like protein [Haloarcula
           marismortui ATCC 43049]
 gi|55229798|gb|AAV45217.1| thiamine-binding periplasmic protein precursor-like [Haloarcula
           marismortui ATCC 43049]
          Length = 374

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 148/326 (45%), Gaps = 15/326 (4%)

Query: 19  SYCTLDGLPAKPVLTVYTYNSFVADEGAGPK--IKQAFERKCNCELKLIGLSDGVALLNK 76
           S  + DG  A   L V TY++FV      P   +KQ FE + +  L     S+ V    +
Sbjct: 46  STGSADG--ADETLVVGTYSAFVDSPSTSPGAWVKQRFEEEFDARLIWQTPSNEVNHYIE 103

Query: 77  LRMEGENSAADIVLGFDNNL---IDLARKTGLFAKSNIDASQ--LKLPIKWD-DDIFVPY 130
            R  G +  AD+ LG + +    +D     GLFA     A Q  +K  +++D D   +PY
Sbjct: 104 RRNAGVDIEADMYLGLNTDHLVRVDENLDDGLFADVGDVAGQDDIKSGLQFDPDGRAIPY 163

Query: 131 DYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNS 189
           D GY++ ++D    T P + FD L+       +I Q+P +S  G   LL   K +G D  
Sbjct: 164 DTGYISLVFDGTATTAP-ETFDGLLAEEHAGDLITQNPSSSATGRAFLLHTVKQFGPDGY 222

Query: 190 AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQ-DDYVAALFSE 248
              W  +      V   W+++Y  +  GE+  V+SYST   F   N    +++     ++
Sbjct: 223 LDYWSDLQDNDVRVLGSWSDAYSAWSGGEAPMVVSYSTDQVFADQNDANLEEHQIRFLND 282

Query: 249 GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS-MPDVYQAI- 306
             Y   E  A    +  P LA+EFM F++ P  Q  +   N  +P  + + +P+ Y  + 
Sbjct: 283 QGYANPEGMAVFDGADTPDLAREFMGFLLRPEIQGEIAVRNVQFPATESADLPEDYAELA 342

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQ 332
           + P + + F  +E     + WIS W+
Sbjct: 343 QEPPEPVTFGYDELKGSVSGWISDWE 368


>gi|325143377|gb|EGC65707.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis 961-5945]
          Length = 333

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWVQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|238022873|ref|ZP_04603299.1| hypothetical protein GCWU000324_02794 [Kingella oralis ATCC 51147]
 gi|237865681|gb|EEP66819.1| hypothetical protein GCWU000324_02794 [Kingella oralis ATCC 51147]
          Length = 357

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 82/301 (27%), Positives = 141/301 (46%), Gaps = 18/301 (5%)

Query: 48  PKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA 107
           P I Q FE++ + ++ ++ L  G  +LN+L +  ++  AD V G DNN    A   G+  
Sbjct: 60  PVIAQ-FEQQNDAKVSIVKLGSGNEMLNRLILSKKSPLADAVFGLDNNSSAKAHAAGILT 118

Query: 108 KSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKI 163
                +    + +       +  D+ ++   YDK+   +     PK  D+L        +
Sbjct: 119 AKQPQSKATSVSLSHA----LAVDFSFVTLNYDKQWFAKNNLPLPKTLDDLAQPKYKDLV 174

Query: 164 IYQDPRTSTLGLGLLLW-IQKIYGDNSAQVWKKIATKTATVTKGWTESY--GFFLKGES- 219
              +P TST GL  LL  I  +   N+ + W ++      +TKGW+++Y   F L G S 
Sbjct: 175 AVPNPATSTPGLAFLLANISGLGEKNAFKWWGQMRQNGVKITKGWSQAYYTEFTLNGGSR 234

Query: 220 DFVLSYSTSPG---FYLLNYGQDDYVAALFSEG-HYLQIEVAAQLVRSKQPQLAQEFMQF 275
             ++ Y+TSP    FY     +   +  LF  G  YLQ+E AA L ++KQP++A + +Q+
Sbjct: 235 PIIVGYATSPAAEVFYSEGKLKSPNMGNLFLHGGSYLQVEGAAVLNQAKQPEMAAKLVQY 294

Query: 276 MISPSFQRILPTTNWMYPVVDISMPD-VYQAIRIPQKSLRFNAEETTRYRNQWISSWQNA 334
           + SP+ Q  L T+ W+YP V  +    +      P+ +    A +    +  W++ W   
Sbjct: 295 LQSPAVQDSLMTSMWVYPAVKGTKAHPIATHASTPKDAKLLPAAQVNSKQKDWVAQWTRV 354

Query: 335 V 335
           V
Sbjct: 355 V 355


>gi|325207092|gb|ADZ02544.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria meningitidis NZ-05/33]
          Length = 333

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPGS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPELAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|320531440|ref|ZP_08032402.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136345|gb|EFW28331.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 333

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 147/324 (45%), Gaps = 26/324 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV T++SF   E     +++AF  +    LK+    D  AL+NKL +  +    D V 
Sbjct: 19  TVTVVTHDSFHVSE----DLQKAFTSETGYTLKIATSGDAGALVNKLVLTKDTPLGDAVF 74

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP------IKWDDDIFVPYDYGYLAFIYDKRQI 144
           G DN     A   G+   S    + + LP      +  D     P D G +    D    
Sbjct: 75  GIDNTYATRALDQGVIDTS----ATVSLPKGAESYVVADTPALAPIDVGDVCLNIDTGYF 130

Query: 145 T----QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATK 199
           T     PP  F++L        ++  +P  S+ G+  LL     +G  S A  WK++   
Sbjct: 131 TGKGLTPPATFEDLTKPECKGLLVAINPTNSSPGMAWLLATIGHFGAGSFADYWKQLVAN 190

Query: 200 TATVTKGWTESYGFFL----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
            A + + W+ +Y        KG    V+SY++SP F +         +AL  +  + Q+E
Sbjct: 191 GARIAEDWSAAYETDFSGSGKGTYPIVVSYASSPSFTVSKDKSSSSTSALL-DTAFRQVE 249

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAI-RIPQKSL 313
            A  L  +  P+  + F+++M+S + Q  +P   +MYPV+ D ++P+      ++ +  +
Sbjct: 250 YAGVLKGAANPEGGKAFVEWMLSKAVQEDIPGQMYMYPVLPDAALPETLTKFGQLSKSPV 309

Query: 314 RFNAEETTRYRNQWISSWQNAVSR 337
           + + +E T +R +W+++W  AV +
Sbjct: 310 KVDPKEITTHREEWLNTWTEAVGK 333


>gi|296314869|ref|ZP_06864810.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria polysaccharea ATCC 43768]
 gi|296838316|gb|EFH22254.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Neisseria polysaccharea ATCC 43768]
          Length = 333

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I +     +LNKL +   N  AD V G DN  I   R+ G+ A +   +
Sbjct: 41  FERANDVKVSIIQVGGANEMLNKLILSRANPIADAVYGLDNANIGKTREMGILAAAQPGS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY+A  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVAINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGMGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|254672523|emb|CBA06073.1| thiamine transport system substrate-binding protein [Neisseria
           meningitidis alpha275]
          Length = 333

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 133/291 (45%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +   +
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPGS 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSINYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANISGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSREV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPTHTTAPAQRDIDANQRGWVSRW 327


>gi|59802363|ref|YP_209075.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae FA 1090]
 gi|240081757|ref|ZP_04726300.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae FA19]
 gi|240114726|ref|ZP_04728788.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae PID18]
 gi|240116925|ref|ZP_04730987.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae PID1]
 gi|240122566|ref|ZP_04735522.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae PID332]
 gi|240126591|ref|ZP_04739477.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae SK-92-679]
 gi|254492784|ref|ZP_05105955.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae 1291]
 gi|260441463|ref|ZP_05795279.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae DGI2]
 gi|268597856|ref|ZP_06132023.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|268600376|ref|ZP_06134543.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|268602605|ref|ZP_06136772.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|268681155|ref|ZP_06148017.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|268685169|ref|ZP_06152031.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|291044824|ref|ZP_06570533.1| ABC transporter [Neisseria gonorrhoeae DGI2]
 gi|293397910|ref|ZP_06642116.1| thiamine transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
 gi|59719258|gb|AAW90663.1| putative ABC transporter, thiamine-binding periplasmic protein
           [Neisseria gonorrhoeae FA 1090]
 gi|226511824|gb|EEH61169.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae 1291]
 gi|268551644|gb|EEZ46663.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae FA19]
 gi|268584507|gb|EEZ49183.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae PID18]
 gi|268586736|gb|EEZ51412.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae PID1]
 gi|268621439|gb|EEZ53839.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae PID332]
 gi|268625453|gb|EEZ57853.1| thiamin-binding periplasmic protein [Neisseria gonorrhoeae
           SK-92-679]
 gi|291011718|gb|EFE03714.1| ABC transporter [Neisseria gonorrhoeae DGI2]
 gi|291611856|gb|EFF40925.1| thiamine transport system substrate-binding protein [Neisseria
           gonorrhoeae F62]
          Length = 333

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 80/291 (27%), Positives = 134/291 (46%), Gaps = 17/291 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FER  + ++ +I       +LNKL +   N  AD V G DN  I  AR+ G+ A +  ++
Sbjct: 41  FERANDAKVSIIQAGGANEMLNKLILSRANPIADAVYGLDNANIGKAREMGILAAAQPES 100

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P+       +  DYGY++  YDK+         P+   +L        ++   P 
Sbjct: 101 A----PVAVGLPSALAVDYGYVSVNYDKKWFEGKKLPLPQTLQDLTRPEYKNLLVVPSPA 156

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TS+ GLG L+      G+  A + W ++      V KGW+E+Y   F   G +   V+ Y
Sbjct: 157 TSSPGLGFLMANIGGLGEEGAFKWWAQMRQNGVKVAKGWSEAYYTDFSHNGGAYPLVVGY 216

Query: 226 STSPG----FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           + SP     F    Y +          G + Q+E AA L  +KQP+LA + +Q++ S   
Sbjct: 217 AASPAAEVYFSKGKYSEPPTGNLFLKGGVFRQVEGAAVLKGAKQPKLAAKLVQWLQSLEV 276

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSW 331
           Q+ +P+  W+YP V +  +PDV++  + P  +      +    +  W+S W
Sbjct: 277 QQAVPSEMWVYPAVKNTRLPDVFRFAQAPAHTTAPAQRDIDANQRGWVSRW 327


>gi|294631676|ref|ZP_06710236.1| ABC transporter substrate-binding protein [Streptomyces sp. e14]
 gi|292835009|gb|EFF93358.1| ABC transporter substrate-binding protein [Streptomyces sp. e14]
          Length = 367

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 90/363 (24%), Positives = 151/363 (41%), Gaps = 47/363 (12%)

Query: 2   KKFARIVVGIMMITGVISYCTLDG----LPAKPVLTVYTYNSFVADEGAGPKIKQAFERK 57
           K+F    VG+ ++T  +S C   G          +T+ +++S+ A +     +   FE+ 
Sbjct: 13  KRFVAAAVGLGLVT--LSACGSSGGQKSAADSKTVTLVSHDSWKASQ----SVITEFEKS 66

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLK 117
              ++K++   D    +NK  +  ++   D+  G DN L+  A   GLF       S   
Sbjct: 67  SGYKVKVLMDGDAGQAVNKAILTKDHPQGDVFFGVDNTLLSRALDNGLFQPYEAKGSDQI 126

Query: 118 LPIKWDDDI---FVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRT 170
            P    D+      P D G +   YDK+        PP  FD+L+       ++ +D   
Sbjct: 127 QPQYRADEAKHRVTPIDTGDICVNYDKKYFADHKLAPPATFDDLVEPQYKNLLVTEDAAA 186

Query: 171 STLGLGLLLWIQKIYGDNSAQV-WKKIATKTATVTKGWTESY---------GFFLKGESD 220
           S+ GLG LL     YGD   Q  WKK+      V  GW ++Y         G    G+  
Sbjct: 187 SSPGLGFLLGTAAKYGDTGWQAYWKKLEANGVKVVSGWEQAYDQEFSGSAGGKKANGDRP 246

Query: 221 FVLSYSTSPGFYLL-NYGQDDYVAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMIS 278
            V+SY++SP   ++    Q        +EG  + Q+E A  L  ++  +  + F+ F+I 
Sbjct: 247 LVVSYASSPPAEVIYAKPQPKTAPTGVAEGTCFRQVEYAGLLAGAENTEGGKAFLDFLIG 306

Query: 279 PSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFN----------AEETTRYRNQWI 328
             FQ  +P   ++YP        V Q  R+P +  ++            E+    R+QW+
Sbjct: 307 KRFQEDMPLNMFVYP--------VRQGARVPAEFTQYGPQAKNPETMAPEKIAANRDQWV 358

Query: 329 SSW 331
            SW
Sbjct: 359 KSW 361


>gi|329944934|ref|ZP_08292961.1| ABC transporter, substrate-binding protein, thiB family
           [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328529745|gb|EGF56641.1| ABC transporter, substrate-binding protein, thiB family
           [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 373

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 144/324 (44%), Gaps = 26/324 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV T++SF   E     + +AF  +    LK+    D  AL+NKL +  +    D V 
Sbjct: 59  TVTVVTHDSFHVSE----DLMKAFTSETGYTLKVATSGDAGALVNKLVLTKDAPLGDAVF 114

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP------IKWDDDIFVPYDYGYLAFIYDKRQI 144
           G DN     A   G+   S    + + LP      +  D     P D G +    D    
Sbjct: 115 GIDNTYASRALDQGVIDTS----ATVTLPQDAEGYVVADTPALAPIDVGDVCLNIDTGYF 170

Query: 145 T----QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATK 199
           T     PP  F++L        ++  +P  S+ G+  LL     +G  S A  WK++ + 
Sbjct: 171 TGKGLTPPATFEDLTKPEYKGLLVAINPTNSSPGMAWLLATIGHFGAGSFADYWKQLVSN 230

Query: 200 TATVTKGWTESYGFFL----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
              + + WT +Y        KG    V+SY++SP F + + G     +AL  +  + Q+E
Sbjct: 231 DLRIAEDWTSAYETDFSGGGKGTYPIVVSYASSPSFTVSDDGASSSTSALL-DTAFRQVE 289

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIR-IPQKSL 313
            A  L  +  P+  + F+++M+S + Q  +P   +MYPV+ D ++P+       +    +
Sbjct: 290 YAGVLKGAANPEGGKAFVEWMLSKAVQEDIPGQMYMYPVLPDAALPEALTKFGPLSSAPV 349

Query: 314 RFNAEETTRYRNQWISSWQNAVSR 337
               +E T +R +W+++W  AV +
Sbjct: 350 SVEPKEITAHREEWLNTWTGAVGK 373


>gi|94986032|ref|YP_605396.1| ABC transporter periplasmic-binding protein [Deinococcus
           geothermalis DSM 11300]
 gi|94556313|gb|ABF46227.1| ABC-type thiamine transport system, periplasmic component
           [Deinococcus geothermalis DSM 11300]
          Length = 343

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/289 (30%), Positives = 139/289 (48%), Gaps = 27/289 (9%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A+  LTV T++SF  ++    K+   FE+  N  ++ +   D   LLN+L +      AD
Sbjct: 18  AQTTLTVITHDSFDLNQ----KLIAQFEKANNVRVRFVKGGDAGELLNRLILTRRAPIAD 73

Query: 88  IVLGFDNNLIDLARKTGLF-AKSNIDASQLKLPIKWDD-DIFVPYDYGYLAFIYDKRQIT 145
           +V G DN L+  AR+ G+  A  + + +++    + D+  +    D G++A  YD+    
Sbjct: 74  VVYGLDNTLLPRARQAGILEAYRSPNLAKVPAAQRLDEAGLLNTVDEGFVALNYDRAWFQ 133

Query: 146 QP----PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTA 201
           +     PK  D+L         +   P TS+ GL  LL     YG+  A  W + A    
Sbjct: 134 KSGLPLPKTLDDLKKPPYARLTVVPSPATSSPGLAFLLATVNHYGEAGAWAWWREARANG 193

Query: 202 -TVTKGWTESYGF-FLK--GESDFVLSYSTSPGFYLLNYGQDDYVAA----------LFS 247
             VT+GW+++Y   F K  G+   VLSY++SP   +  Y  D Y  A          LF 
Sbjct: 194 LKVTRGWSDAYEKDFSKNGGKYPIVLSYASSPAAEV--YYTDGYNPAKLPAQSPTGNLFL 251

Query: 248 EGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
            G  + Q+E    L  +KQP LA++F+ FM+S   Q  +PT  W+YP V
Sbjct: 252 PGSTFRQLEGVGVLKGAKQPALARKFVDFMLSEPVQADIPTRMWVYPAV 300


>gi|134097577|ref|YP_001103238.1| ABC transporter substrate-binding protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|291009160|ref|ZP_06567133.1| ABC transporter substrate-binding protein [Saccharopolyspora
           erythraea NRRL 2338]
 gi|133910200|emb|CAM00313.1| ABC transporter substrate-binding protein [Saccharopolyspora
           erythraea NRRL 2338]
          Length = 348

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 146/324 (45%), Gaps = 30/324 (9%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+  ++SFVADE    K+   F+      + ++   D   L NKL +   +   D+  
Sbjct: 34  TVTLVAHDSFVADE----KLLAKFQETTGIRINVLNSGDAGELTNKLVLSKASPIGDVAY 89

Query: 91  GFDNNLIDLARKTGLFAKS---NIDASQLKLPIKWDD--------DIFVPYDYGYLAFIY 139
           G D+     A + G+F      N D    +  ++ ++        D+ V  D G+ A   
Sbjct: 90  GVDSTFASRALREGVFEPHRAPNADQGPQRYALEPENRLSAVDVADVCVNIDTGWFA--- 146

Query: 140 DKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIAT 198
            +R + +P  N  +L +          DP TS+ GL  LL     +G+N  Q  W+++A 
Sbjct: 147 -QRGLPEP-ANLRDLADPRYRDLFSVPDPTTSSPGLAFLLSTVAAFGENGWQDYWRQLAA 204

Query: 199 KTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
               V+ GW E+Y     G   KG    VLSY++SP   +   G     A   +   Y Q
Sbjct: 205 NGTKVSSGWEEAYNQDFSGSAGKGPRPIVLSYASSPAAEVNPDGSPRTKA--LTGTCYRQ 262

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVY-QAIRIPQK 311
           +E A  L  +K P+ A   + F++SP FQ  +  T ++YP V D+ +P  +  +  +P +
Sbjct: 263 VEYAGVLRGAKDPEAAGRVVDFLLSPEFQAQVADTMYVYPSVRDVPLPQSWVVSAPLPPQ 322

Query: 312 SLRFNAEETTRYRNQWISSWQNAV 335
                A++  + R++W+  W+  V
Sbjct: 323 PAELPAQQVEQNRDRWVEQWRAVV 346


>gi|257057091|ref|YP_003134923.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Saccharomonospora viridis DSM 43017]
 gi|256586963|gb|ACU98096.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Saccharomonospora viridis DSM 43017]
          Length = 357

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 151/348 (43%), Gaps = 27/348 (7%)

Query: 6   RIVVGIMMITGVISYCTL----DGLPAKPV-LTVYTYNSFVADEGAGPKIKQAFERKCNC 60
           R  + ++    + + CT+    D    +PV +T+ T+ S+   +    ++  AFE++   
Sbjct: 13  RAAIALLSAGALTAGCTVIGTEDESADEPVTVTLVTHQSWAVPQ----EVVDAFEQRAGV 68

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF---AKSNIDASQLK 117
            +++    D   L NKL +  +N  AD+  G D+     A   G+F        D    +
Sbjct: 69  RIEVRKEGDAGELTNKLVLTKDNPIADVAYGIDSTFASRALSEGVFQPYTSPEADRGPQR 128

Query: 118 LPIKWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTL 173
             +  +  +    D G +    D     +     P   D+L +       +   P TS+ 
Sbjct: 129 YAVDREQRLSA-VDVGDVCVNIDSEWFAENDVPEPTGLDDLTDPIYEDLFVVPSPATSSP 187

Query: 174 GLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY-----GFFLKGESDFVLSYST 227
           GL  L      YG++     W  +      V  GWTE+Y     G   +GE   VLSY++
Sbjct: 188 GLAFLFATVSEYGEDGWTDYWGDLKDNGVKVVSGWTEAYTQEFSGSSGEGERPIVLSYAS 247

Query: 228 SPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
           SP   +   G+    A L  +  Y Q+E A  L  ++ P  A + + F++SP FQ  LP 
Sbjct: 248 SPAAEIGQDGKPRTKALL--DTCYRQVEYAGVLAGTEHPDEAGKVIDFLLSPEFQSTLPE 305

Query: 288 TNWMYPVVD-ISMPDVYQ-AIRIPQKSLRFNAEETTRYRNQWISSWQN 333
             ++YP  + + +P+ ++ A  +P++S+    E+    R +WIS W+ 
Sbjct: 306 NMYVYPTREGVPLPEEWERAAPMPRESISLPGEQVQENRERWISEWRE 353


>gi|309789995|ref|ZP_07684571.1| ABC transporter periplasmic-binding protein [Oscillochloris
           trichoides DG6]
 gi|308228015|gb|EFO81667.1| ABC transporter periplasmic-binding protein [Oscillochloris
           trichoides DG6]
          Length = 397

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 92/350 (26%), Positives = 153/350 (43%), Gaps = 39/350 (11%)

Query: 15  TGVISYCTLDGLPAKP--VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVA 72
           T V +Y      PA     L + T++SF   E    ++  AF  +    ++++   D   
Sbjct: 56  TSVPAYPVATDAPASTGQTLIIMTHDSFSVSE----EVLAAFTAQTGITVQVLKSGDAGM 111

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF-----AKSNIDASQLKLPIKWDDDIF 127
           +LN+  +  +   AD++ G DN     A +  +F            ++L+L      +  
Sbjct: 112 VLNQAILSKDAPLADLLFGVDNTFFSRALEADIFLPYDAPALAALPAELRLDAT---NRL 168

Query: 128 VPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKP-W--KIIYQDPRTSTLGLGLLLW 180
           +P DYGY+   YDK  +      PP + ++L   TKP W  K++ +DP TS+ GL  LL 
Sbjct: 169 LPVDYGYVTINYDKAFLESAGLTPPTSLEDL---TKPEWRDKLVVEDPSTSSPGLAFLLA 225

Query: 181 IQKIYGDNSAQVWKK----IATKTATVTKGWTESYGFFLKGESD-----FVLSYSTSPG- 230
               +G+     WK     +      V+ GW+++Y     G S       V+SY+TSP  
Sbjct: 226 TISHFGETGDYTWKDYWRDLRANEVLVSSGWSDAYYTQFSGSSGAGAYPLVVSYATSPAA 285

Query: 231 ---FYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
              F      +      L   G + QIE    L  ++   LA++F+ FM+S +FQ  +P 
Sbjct: 286 EVYFSEGKLTEPPTGNLLVPGGSFRQIEFVGILKGTQHEDLARQFVDFMLSETFQADIPL 345

Query: 288 TNWMYPVV-DISMPDVY-QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
             ++YP +   + P+V+ Q   +P +      E+    R  WIS W   V
Sbjct: 346 QMFVYPALPSAAQPEVFTQFAEVPSQPAGLTPEQIEAGRESWISEWTEIV 395


>gi|222481101|ref|YP_002567338.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Halorubrum lacusprofundi ATCC 49239]
 gi|222454003|gb|ACM58268.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Halorubrum lacusprofundi ATCC 49239]
          Length = 431

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 146/329 (44%), Gaps = 27/329 (8%)

Query: 30  PVLTVYTYNSFVADEGAGPK--IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           P LTV TY+SF+      P   +K+AFE + + EL+     + V    +    G +  AD
Sbjct: 98  PTLTVATYSSFIDAPSVSPGEWLKEAFESRVDAELEWATPDNEVNYYVERASSGVSIDAD 157

Query: 88  IVLGF---DNNLIDLARKTGLF-AKSNIDA-SQLKLPIKWDD-DIFVPYDYGYLAFIYDK 141
           + +G    D   +D      LF  +  ++    ++  + +D  D  VP+D GY++ +YD 
Sbjct: 158 LYVGLTTEDLVRVDETLDDDLFVERGEVEGFDDVREGLLFDPFDRAVPFDTGYVSLVYDG 217

Query: 142 RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA----------- 190
             I + P+ F+ L++      +I Q+P  ST G   LL     +GD              
Sbjct: 218 TAI-EAPETFEGLLDDEHAGALIAQNPGASTTGRSFLLHTVHRFGDGPDGSVEGGDGDPD 276

Query: 191 ----QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQ-DDYVAAL 245
                 W ++      V   W ++Y  +  GE+  V+SYST   F  +     + +    
Sbjct: 277 YDYLDYWAELQDNDVRVLGSWDDAYAAWSGGEAPMVVSYSTDQVFASMEGADLEKHQIRF 336

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS-MPDVYQ 304
            ++  Y   E  A    + +P+LA+EFM FM+ P  Q ++   N  +P  D + +PD Y 
Sbjct: 337 LNDQAYANPEGMAVFADADEPELAREFMSFMLEPDVQGVIAERNVAFPATDTAELPDDYA 396

Query: 305 AI-RIPQKSLRFNAEETTRYRNQWISSWQ 332
            + + P + + F  +E     ++W+  W+
Sbjct: 397 ELAQEPSEPVTFTYDELQGSVSEWVEDWE 425


>gi|313124986|ref|YP_004035250.1| ABC transporter periplasmic binding protein, thib subfamily
           [Halogeometricum borinquense DSM 11551]
 gi|312291351|gb|ADQ65811.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Halogeometricum borinquense DSM 11551]
          Length = 388

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 149/320 (46%), Gaps = 19/320 (5%)

Query: 30  PVLTVYTYNSFV--ADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           P L V TY+SFV       GP +K+ FE + +  ++     + V    +    G + AAD
Sbjct: 65  PELVVGTYSSFVDAPSTSPGPWLKETFESEFDATIRYETPDNEVNHYIERASRGVDIAAD 124

Query: 88  IVLGFDNNL---IDLARKTGLFAKSN--IDASQLKLPIKWD-DDIFVPYDYGYLAFIYDK 141
           + +G D N+   ID    + +F   +   +   +K  +++D D   VPYD GY+  +++K
Sbjct: 125 LYVGLDVNMLIRIDENLDSPMFTSVDDLSNRGDVKESLEFDPDGRAVPYDTGYICLVFNK 184

Query: 142 ----RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQVWKKI 196
                + T P + FD L+       ++ Q+P +S  G   LL   K  G D+    W+K+
Sbjct: 185 LFGDSEFTAP-ETFDGLLKEQYADDLLVQNPVSSATGKAFLLHSIKAKGRDSYLDFWQKL 243

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD--DYVAALFSEGHYLQI 254
                 V K W  SY  + KGE+  V+SYST    Y    G+D   +     ++  Y   
Sbjct: 244 KENGVRVLKDWGTSYDAYSKGEAPMVVSYSTDQ-VYAHESGEDLAKHQLRFLNDQGYANP 302

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS-MPDVY-QAIRIPQKS 312
           E  A    + QP+LA+ FM FM+ P  Q  +   N  YP    + +P+ + +  + P ++
Sbjct: 303 EGMALFEGTDQPELARTFMDFMLRPEIQAEIAVRNVQYPATTTAELPESFGKYAQAPPEA 362

Query: 313 LRFNAEETTRYRNQWISSWQ 332
           + FN +      + W ++W+
Sbjct: 363 VTFNYDTLRDNLSDWTNAWE 382


>gi|297624871|ref|YP_003706305.1| ABC transporter periplasmic binding protein [Truepera radiovictrix
           DSM 17093]
 gi|297166051|gb|ADI15762.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Truepera radiovictrix DSM 17093]
          Length = 353

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 88/328 (26%), Positives = 153/328 (46%), Gaps = 25/328 (7%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A   L V T++SF   E    ++  AF  +   E+  I   D    +N+  +   N  AD
Sbjct: 25  AAQTLEVLTHSSFSLSE----ELVAAFTEETGIEVTFIQGGDAGETVNRAILTRANPLAD 80

Query: 88  IVLGFDNNLIDLARKTGLFAKSNIDASQL-KLPIKWD-DDIFVPYDYGYLAFIYD----K 141
           ++ G DN+LI  A +  LF      + QL ++P ++   ++  P D GY+ F YD    +
Sbjct: 81  VLFGVDNSLIARAAQADLFEPYT--SPQLARVPERYRFSELVTPVDVGYVNFNYDVAWFE 138

Query: 142 RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTA 201
            +  +PP + + L         + Q+P +S+ GL  +L     +GD     W  +     
Sbjct: 139 AEGLEPPTSLEALTEPAYRDLTVVQNPASSSPGLAFMLTTIAKFGDGWLAYWAALRDNGL 198

Query: 202 TVTKGWTES-YGFFLK--GESDFVLSYSTSPGFYLLNYGQDDYVAA----LFSEGH-YLQ 253
            VT GWT++ Y  F +  G+   VLSY++SP   ++ + ++   AA    LF EG  + Q
Sbjct: 199 QVTDGWTDAYYTAFTRYGGDRPIVLSYASSPAAEVV-FAEEALDAAPTANLFCEGCVFEQ 257

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQ---AIRIP 309
           IE A  L  S   + A+ F+ +++S   Q  +P   ++YPV  D  +P+V++    +  P
Sbjct: 258 IEAAGILAGSDNVEAARTFIDWLLSREVQEDIPLNMFVYPVSEDAEVPEVFREHGGLPEP 317

Query: 310 QKSLRFNAEETTRYRNQWISSWQNAVSR 337
           +       +E     + W+ +W   V +
Sbjct: 318 EHVAEIAFDEVAANLDAWLEAWTRVVQQ 345


>gi|256824335|ref|YP_003148295.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Kytococcus sedentarius DSM 20547]
 gi|256687728|gb|ACV05530.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Kytococcus sedentarius DSM 20547]
          Length = 392

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/325 (26%), Positives = 144/325 (44%), Gaps = 26/325 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            + + T++SF   EG    + + F ++    +K+    D  +L NKL +  +N   D V 
Sbjct: 76  TVQLVTHDSFNPPEG----VLEEFTQRTGITVKVQKSGDAGSLTNKLVLTKDNPIGDAVF 131

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDI---FVPYDYGYLAFIYD----KRQ 143
           G DN     A   G+ A+  +D  Q       + D      P D G +    D    +++
Sbjct: 132 GIDNTFGGRALTEGVVAEHGLDLPQGVADHAMEADAGARLAPVDAGDVCVNIDDTWFEKK 191

Query: 144 ITQPPKNFDELINSTKP-WKIIYQDP--RTSTLGLGLLLWIQKIYGDNS-AQVWKKIATK 199
              PP   D+L   TKP +K ++  P   TS+ GL  LL      GD+   Q WK +   
Sbjct: 192 GINPPATLDDL---TKPEYKGLFVTPGASTSSPGLAFLLATIGAKGDDGWEQYWKDLVAN 248

Query: 200 TATVTKGWTESYGFFL-----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQI 254
              VT GW ++Y          G+   VLSY++SP   +   G +   +AL  +  + Q+
Sbjct: 249 DVKVTAGWEDAYTVDFTAGGGNGDRPIVLSYASSPPITVPEGGDEPTTSALL-DTCFRQV 307

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQKS- 312
           E A  L  + +P+ A + ++F++   FQ  LP + ++YPV   + +P+ ++    P K  
Sbjct: 308 EYAGVLEGADEPEAAAKVVEFLLGEEFQAGLPDSMYVYPVRQGVELPEAWEQWAPPAKEP 367

Query: 313 LRFNAEETTRYRNQWISSWQNAVSR 337
           +  +A      R  W+  W  A  +
Sbjct: 368 IEVDAARIQENREDWLMRWSEAAGQ 392


>gi|325066426|ref|ZP_08125099.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Actinomyces oris K20]
          Length = 336

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 144/324 (44%), Gaps = 26/324 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV T++SF   E     +++AF  +    LK+    D  AL+NKL +  +    D V 
Sbjct: 22  TVTVVTHDSFHVSE----DLQKAFTSETGYTLKIATSGDAGALVNKLVLTKDAPLGDAVF 77

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP------IKWDDDIFVPYDYGYLAFIYDKRQI 144
           G DN     A   G+   S    + + LP      +  D     P D G +    D    
Sbjct: 78  GIDNTYATRALDQGVIDTS----ATVTLPKGAESYVVADTPALAPIDVGDVCLNIDTGYF 133

Query: 145 T----QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATK 199
           T     PP  F++L         +  +P  S+ G+  LL     +G  S A  WK++   
Sbjct: 134 TGKGLTPPATFEDLTKPEYKGLFVAINPTNSSPGMAWLLATIGHFGAGSFADYWKQLMAN 193

Query: 200 TATVTKGWTESYGFFL----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
            A + + W+ +Y        KG    V+SY++SP F +         +AL  +  + Q+E
Sbjct: 194 GARIAEDWSAAYETDFSGSGKGTYPIVVSYASSPSFTVSKDKSSSSTSALL-DTAFRQVE 252

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKS-L 313
            A  L  +  P+  + F+++M+S + Q  +P   +MYPV+ D ++P+         KS +
Sbjct: 253 YAGVLKGAANPEGGKAFVEWMLSKAVQEDIPGQMYMYPVLPDAALPEALTKFGPLSKSPV 312

Query: 314 RFNAEETTRYRNQWISSWQNAVSR 337
           +   +E T +R +W+++W  AV +
Sbjct: 313 KVEPKEITTHREEWLNTWTEAVGK 336


>gi|326772956|ref|ZP_08232240.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Actinomyces viscosus C505]
 gi|326637588|gb|EGE38490.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Actinomyces viscosus C505]
          Length = 365

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/324 (25%), Positives = 144/324 (44%), Gaps = 26/324 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV T++SF   E     +++AF  +    LK+    D  AL+NKL +  +    D V 
Sbjct: 51  TVTVVTHDSFHVSE----DLQKAFTSETGYTLKIATSGDAGALVNKLVLTKDAPLGDAVF 106

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP------IKWDDDIFVPYDYGYLAFIYDKRQI 144
           G DN     A   G+   S    + + LP      +  D     P D G +    D    
Sbjct: 107 GIDNTYATRALDQGVIDTS----ATVTLPKGAESYVVADTPALAPIDVGDVCLNIDTGYF 162

Query: 145 T----QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATK 199
           T     PP  F++L        ++  +P  S+ G+  +L     +G  S A  WK++   
Sbjct: 163 TGKGLTPPATFEDLTKPEYKGLLVAINPTNSSPGMAWMLATIGHFGAGSFAGYWKQLMAN 222

Query: 200 TATVTKGWTESYGFFL----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
            A + + W+ +Y        KG    V+SY++SP F +         +AL     + Q+E
Sbjct: 223 GARIAEDWSAAYETDFSGSGKGTYPIVVSYASSPSFTVSKDKSSSTTSALLDTA-FRQVE 281

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKS-L 313
            A  L  +  P+  + F+++M+S + Q  +P   +MYPV+ D ++P+         KS +
Sbjct: 282 YAGVLKGAANPEGGKAFVEWMLSKAVQEDIPGQMYMYPVLPDAALPEALTKFGPLSKSPV 341

Query: 314 RFNAEETTRYRNQWISSWQNAVSR 337
           +   +E T +R +W+++W  AV +
Sbjct: 342 KIEPKEITTHREEWLNTWTEAVGK 365


>gi|300789856|ref|YP_003770147.1| thiamine ABC transporter periplasmic protein [Amycolatopsis
           mediterranei U32]
 gi|299799370|gb|ADJ49745.1| periplasmic substrate-binding component of ABC-type thiamine
           transport system [Amycolatopsis mediterranei U32]
          Length = 344

 Score =  106 bits (264), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 85/334 (25%), Positives = 148/334 (44%), Gaps = 26/334 (7%)

Query: 21  CTLD----GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNK 76
           C+L     G    P +T+ T++SF+A +    ++  AF+++   ++ ++   D  +L NK
Sbjct: 17  CSLSNGDGGTQQTPTVTLVTHDSFLAPQ----EVLDAFQKQSGIKVSVLKQGDAGSLTNK 72

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLF---AKSNIDASQLKLPIKWDDDIFVPYDYG 133
           L +   N   D+  G D+     A   G+F        D    +  +  +  +    D G
Sbjct: 73  LVLTKANPIGDVAYGVDSTFASRALSEGVFEPYTSPEADRGPQRYAVDPEHRLSA-VDVG 131

Query: 134 YLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS 189
            +    D    T      P+++D+L +      ++ +DP T++ GL  LL     YGD  
Sbjct: 132 DVCVNVDTNYFTSKGIPAPESYDDLADPKYKDLLVAEDPATASPGLAFLLGTVAKYGDAG 191

Query: 190 -AQVWKKIATKTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
               W K+      V  GW E+Y     G   KG    V+SY++SP   + + G+    A
Sbjct: 192 WKDYWTKLKANGVKVVSGWEEAYTKQFSGSSGKGPRPIVVSYASSPAAEVGDDGKPRTKA 251

Query: 244 ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDV 302
            L  +  Y Q+E A  L   KQ + A++ + F++S  FQ  +  T ++YP    + +P  
Sbjct: 252 LL--DTCYRQVEYAGVLANGKQVENARKVVDFLLSQQFQATVAATMYVYPARQGVDLPAG 309

Query: 303 Y-QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           + Q   +PQK     A++    R +WI  W+  V
Sbjct: 310 WAQVAPLPQKPQALPADQVQAGREKWIGEWRTLV 343


>gi|329936698|ref|ZP_08286405.1| solute-binding transport system protein [Streptomyces
           griseoaurantiacus M045]
 gi|329303928|gb|EGG47811.1| solute-binding transport system protein [Streptomyces
           griseoaurantiacus M045]
          Length = 359

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 131/302 (43%), Gaps = 21/302 (6%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF---AKSN 110
           FE+K    +K++   D    +NK  +  +N   D++ G DN L+  A   GLF       
Sbjct: 57  FEKKSGYTVKVLKDGDAGQAVNKAILTKDNPQGDVLFGVDNTLLSRALDNGLFQPYEAKG 116

Query: 111 IDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT----QPPKNFDELINSTKPWKIIYQ 166
           +D       I  D     P D+G +   YDK   +     PP +F +L +      ++ +
Sbjct: 117 LDGVDAAYRID-DRHRVTPVDHGDICVNYDKAYFSAHKLSPPSSFADLADPRYRNLLVTE 175

Query: 167 DPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESY---------GFFLKG 217
           +  TS+ GLG LL     YGD     WKK+      V  GW ++Y         G   KG
Sbjct: 176 NAATSSPGLGFLLGTAAQYGDGWENYWKKLKANGVKVVDGWEQAYNEEFSGSAGGKKAKG 235

Query: 218 ESDFVLSYSTSPGFYLLNYGQDDYVA--ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQF 275
           +   V+SY++SP   ++        A   +     + QIE A  L  +   +  +  + F
Sbjct: 236 DRPLVVSYASSPPAEVVYADPQPKTAPTGVAENTCFRQIEFAGLLSGAHNTKGGKALLDF 295

Query: 276 MISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAE-ETTRYRNQWISSWQN 333
           +++  FQ+ +P   ++YPV  D  +P  + A     K+ R  A      +R++W+ SW +
Sbjct: 296 LLTKEFQQDMPLNMFVYPVTDDAKVPAAFTAYGPAAKNPRTMAPGRIAEHRDEWVKSWTS 355

Query: 334 AV 335
            V
Sbjct: 356 LV 357


>gi|15791182|ref|NP_281006.1| hypothetical protein VNG2395C [Halobacterium sp. NRC-1]
 gi|169236938|ref|YP_001690138.1| thiamine ABC transporter periplasmic substrate-binding protein
           [Halobacterium salinarum R1]
 gi|10581802|gb|AAG20486.1| conserved hypothetical protein [Halobacterium sp. NRC-1]
 gi|167728004|emb|CAP14792.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate thiamine) [Halobacterium salinarum
           R1]
          Length = 352

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 83/328 (25%), Positives = 138/328 (42%), Gaps = 13/328 (3%)

Query: 21  CTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           C   G  +   L V TY+SFV +  AG  +K  +E      ++    + GV      +  
Sbjct: 22  CLQMGGNSAETLRVGTYDSFVGEGSAGRWLKAQWEADHETTVEFTTPTAGVNEFVNKKRN 81

Query: 81  GENSAADIVLGF--------DNNLIDLARKTGLFAKSNIDASQLKLPIKWDD-DIFVPYD 131
           G    AD+ +G         DN L D  R     A     +S++K  +  D     + YD
Sbjct: 82  GVGIDADLFVGLNTGELVRIDNELGDDTRLFDGLAADVSRSSEIKEALHIDPAGRALTYD 141

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSA 190
            GY++ +YD   +   P+ F+ L        ++ Q  + S  G   LLW    +G D   
Sbjct: 142 TGYISLVYDG-TVVDGPETFEALTTEPYAGTLLTQTAQNSDPGRAFLLWTIHEFGPDGYL 200

Query: 191 QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGH 250
             W ++      V  GW+ESY  F +GE   V+SYST    Y        +     ++  
Sbjct: 201 DYWTRLVDNDVRVLNGWSESYTAFTEGERPMVVSYSTDRVIYNDPDDLPHHRVGFLNDQG 260

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDI-SMP-DVYQAIRI 308
           Y+  E  A+   +  P++A EF++FM+S   Q+ +   N  +P  +  S+P DV +    
Sbjct: 261 YINPEAVARFADTDTPEVAAEFVEFMLSSERQQGIAERNAQFPATETASLPADVAEYGYE 320

Query: 309 PQKSLRFNAEETTRYRNQWISSWQNAVS 336
           P + +R   +E      +W  +W   ++
Sbjct: 321 PPEPVRLTYDELAGSVAEWTETWAQRIA 348


>gi|227496422|ref|ZP_03926708.1| ABC superfamily ATP binding cassette transporter
           periplasmic-binding protein [Actinomyces urogenitalis
           DSM 15434]
 gi|226834041|gb|EEH66424.1| ABC superfamily ATP binding cassette transporter
           periplasmic-binding protein [Actinomyces urogenitalis
           DSM 15434]
          Length = 373

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 144/324 (44%), Gaps = 31/324 (9%)

Query: 32  LTVYTYNSF-VADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           +TV T++SF V DE     +  AFE+     L+++   D   L+NKL +  +    D V 
Sbjct: 59  VTVLTHDSFHVPDE-----LVAAFEKDSGYTLEIVPSGDAGELVNKLVLTKDAPLGDAVF 113

Query: 91  GFDNNLIDLARKTGLFAKSNIDAS-QLKLPIKWDDDI------FVPYDYGYLAFIYDKRQ 143
           G DN     A   G+     ID S  + LP   +  +        P D+G +    D   
Sbjct: 114 GIDNTFASRALDEGV-----IDTSVTVTLPDGAEQYVVDSTPALAPIDFGEVCVNIDAAW 168

Query: 144 ITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIAT 198
                  PP +F++L  +      +  +P TS+ GL  LL     +G++  A  WK++  
Sbjct: 169 FADKGLTPPTSFEDLTKAEYKDLFVTINPSTSSTGLAFLLATIGHFGEDGFADYWKQLVA 228

Query: 199 KTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQ 253
               + +GWT++Y     G    G    V+SYS+SP   +   G     A++ +   + Q
Sbjct: 229 NGTKIDEGWTDAYYTDFSGGGEGGTYPIVVSYSSSPAATVSEDGASSSTASVLATA-FRQ 287

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAI-RIPQK 311
           +E A  L     P+ A+ F+++M+S   Q  +P   +MYPV  + ++ +   A  ++   
Sbjct: 288 VEYAGALAGGANPEGAKAFIEWMLSTDVQTSIPDNMYMYPVSPEATLSEAMTAFGKVSDS 347

Query: 312 SLRFNAEETTRYRNQWISSWQNAV 335
            +   A+     R  W+++W  AV
Sbjct: 348 PVTVEADAIAANREAWLATWTEAV 371


>gi|302558122|ref|ZP_07310464.1| solute binding lipoprotein [Streptomyces griseoflavus Tu4000]
 gi|302475740|gb|EFL38833.1| solute binding lipoprotein [Streptomyces griseoflavus Tu4000]
          Length = 362

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 89/370 (24%), Positives = 155/370 (41%), Gaps = 50/370 (13%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKP-------VLTVYTYNSFVADEGAGPKIKQAF 54
           KK   + VG+ ++T  +S C   G             +T+ ++NS+   +     +  AF
Sbjct: 5   KKVTVLAVGLGLVT--LSACGSSGDGDAGGDGGGSRTVTLVSHNSWAVSK----DVVAAF 58

Query: 55  ERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDAS 114
           E++   +LK++   D    +NK  +  +N   D+  G DN L+  A   GLF       S
Sbjct: 59  EKQSGYQLKVLEDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQPYEAKGS 118

Query: 115 QLKLP---IKWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQD 167
            L L       D     P D G +   YDK    +    PPK+ D+L+       ++ ++
Sbjct: 119 DLVLDEYRADQDKHRVTPVDSGDVCVNYDKAWFDEHGLTPPKSLDDLVQPEYKDLLVTEN 178

Query: 168 PRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTESY---------GFFLKG 217
             TS+ GLG LL     YGD   Q  WKK+      V  GW ++Y         G   K 
Sbjct: 179 ASTSSPGLGFLLGTAAKYGDEGWQDYWKKLKANGVKVVDGWEQAYNEEFSGSAGGKKAKA 238

Query: 218 ESDFVLSYSTSPGFYLLNYGQDDYVA--ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQF 275
           +   V+SY++SP   ++        A   +  +  + Q+E A  L  +  P+  +  + F
Sbjct: 239 DRPLVVSYASSPPAEVIYADPKPATAPTGVAEDTCFRQVEYAGLLSNAANPEGGKALLDF 298

Query: 276 MISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE----------ETTRYRN 325
           +++  FQ  +P   ++YP        V +  ++P++  +F  +               R+
Sbjct: 299 LLTKRFQDDMPLNMFVYP--------VREGAQVPEEFTKFGPQAKNPQTMDPARIADNRD 350

Query: 326 QWISSWQNAV 335
           QW+ +W + V
Sbjct: 351 QWVKAWTSLV 360


>gi|167044773|gb|ABZ09442.1| putative bacterial extracellular solute-binding protein [uncultured
           marine microorganism HF4000_APKG8C21]
          Length = 427

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 141/327 (43%), Gaps = 28/327 (8%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELK-LIGLSDGVALLNKLRMEGENSAADIVL 90
           L V  +N+F      G  + + FE   N ++  L+  S G AL+  + +E  N +AD++ 
Sbjct: 108 LVVMVHNAF----DIGEDVIREFEEANNAKVVILVAGSSGDALVRAI-LEKGNPSADLLF 162

Query: 91  GFDNNLIDLARKTGLFA--KSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQIT-- 145
           G DN  +  A K  +F   KS +    +      DD   V P DYGY+   YDK  +   
Sbjct: 163 GIDNTYLGRALKEEIFITYKSPL-LDNVPAQFVLDDTYHVTPIDYGYVNINYDKAFMESN 221

Query: 146 --QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA----QVWKKIATK 199
             QPP   +EL       K++ ++P TS+ GL  L+     +G++        W  +   
Sbjct: 222 NLQPPATLEELTQQQWKGKLVVENPSTSSPGLAFLIVTISYFGEDDDYDYLDFWADLRAN 281

Query: 200 TATVTKGWTESY-GFFLK--GESDFVLSYSTSPGFYLLNYGQDDYVAA-----LFSEGHY 251
              V   W+++Y   F K  G+   V+SY+TSP   +  + ++D         L   G +
Sbjct: 282 DVVVKDSWSDAYYTDFTKYGGDRPLVVSYATSPAAEIF-FSEEDLSEPPTGNMLVDRGTF 340

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQ 310
           LQIE    L  S    LAQ F+ F +   FQ   P   ++YPV      PD ++   +P 
Sbjct: 341 LQIEGIGILDGSDNVDLAQRFIDFALGKRFQEDFPDKMFVYPVNSQAQTPDFFRFAEVPT 400

Query: 311 KSLRFNAEETTRYRNQWISSWQNAVSR 337
                        R +WI +W   V R
Sbjct: 401 LPADIGPARIDEKREEWIDAWIKVVLR 427


>gi|294789146|ref|ZP_06754385.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Simonsiella muelleri ATCC 29453]
 gi|294482887|gb|EFG30575.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Simonsiella muelleri ATCC 29453]
          Length = 335

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/295 (29%), Positives = 133/295 (45%), Gaps = 17/295 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+K + ++ +I   DG  LLNKL +      AD+V G DN  I  A    L A    ++
Sbjct: 43  FEQKNDAKISIIKAGDGNELLNKLIISKRKPIADVVYGLDNGNILKANAENLLADKQPES 102

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP----PKNFDELINSTKPWKIIYQDPR 169
           +    P        +  D+G++A  YDK+   +     PK   +L        ++  +P 
Sbjct: 103 A----PTVVSMPHALAVDFGFVAINYDKKWFKEKGLALPKTLADLAKPEYKNLLVTPNPA 158

Query: 170 TSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESY--GFFLKGES-DFVLSY 225
           TST  +  LL      G+  A   WK++      VTKGW+E+Y   F L G S   ++ Y
Sbjct: 159 TSTPAMAFLLANIGGLGEEQAFDWWKQMRNNGVKVTKGWSEAYYKEFSLNGGSRPMMVGY 218

Query: 226 STSPG---FYLLNYGQDDYVAALF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSF 281
           S+SP    FY         +  LF   G Y Q+E  A L  ++QP+LA +  Q++ S   
Sbjct: 219 SSSPAAEVFYSKGKLSTPNMGNLFLVGGVYRQMEGVAVLNGAQQPELAAKLAQYLQSDKV 278

Query: 282 QRILPTTNWMYPVV-DISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           QR +PT+ W+YP V ++ +  V     +P      + +        W+S W   V
Sbjct: 279 QRAVPTSMWVYPAVKNVPLAAVMVHSSVPTAHYAPHDKRVFANYKTWLSRWNKTV 333


>gi|224369355|ref|YP_002603519.1| TbpA [Desulfobacterium autotrophicum HRM2]
 gi|223692072|gb|ACN15355.1| TbpA [Desulfobacterium autotrophicum HRM2]
          Length = 377

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 95/353 (26%), Positives = 163/353 (46%), Gaps = 33/353 (9%)

Query: 4   FARI-VVGIMMITGVISYCTLDGLPAKPV-------LTVYTYNSFVADEGAGPKIKQAFE 55
           FA I V+ I+ ITG    C+ D    K V       +T+ T++SF     A   + QAFE
Sbjct: 28  FAAISVLMIISITG----CSKDDSNDKAVKADGIQEITLMTHDSF----SASTDVIQAFE 79

Query: 56  RKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF-AKSNIDAS 114
           +  + ++  +   D    LNK  +   N  ADI  G DN  +  A    +F A  +    
Sbjct: 80  QANHAKIIFLKSGDAGEALNKAILSKNNPIADIFYGVDNTFLTRALSENIFVAHDSPLLD 139

Query: 115 QLKLPIKWD-DDIFVPYDYGYLAFIYD----KRQITQPPKNFDELINSTKPWKIIYQDPR 169
           +L   ++ D ++  +P D+G +   +D    K++   PP   ++L+       ++ ++P 
Sbjct: 140 RLPESLRLDPENRLIPVDFGDVCINFDIAWFKQRNLDPPVCLEDLLAPRFKDLVVVENPA 199

Query: 170 TSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY-GFFL---KGESDFVLS 224
           TS+ GL  LL     +G       WK +      +T GW E+Y G F    KG    V+S
Sbjct: 200 TSSPGLAFLLATVARFGQTGYLDFWKGMKQNQVMITSGWKEAYWGQFTAASKGTRPVVVS 259

Query: 225 YSTSPG---FYLLNYGQDDYVAALFSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPS 280
           Y++SP    +Y  N         +   G  + Q+E A  L  +K+ +LA + M F++S +
Sbjct: 260 YASSPAAEVYYAKNPMDKAPTGVMVDNGAAFRQVEFAGILKGTKKLELAGKLMDFLVSKT 319

Query: 281 FQRILPTTNWMYPV-VDISMPDVY-QAIRIPQKSLRFNAEETTRYRNQWISSW 331
           FQ  +P   +++P   +  +PDV+ +   I  +  R + +  ++ R  WI +W
Sbjct: 320 FQEDIPLQMFVFPANKEAVLPDVFKKHAVITDQPARLDYDIISKNRESWIINW 372


>gi|29829162|ref|NP_823796.1| ABC transpo_ter substrate-binding protein [Streptomyces avermitilis
           MA-4680]
 gi|29606268|dbj|BAC70331.1| putative ABC transporter substrate-binding protein [Streptomyces
           avermitilis MA-4680]
          Length = 361

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 140/326 (42%), Gaps = 25/326 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++S+ A +     + + FE++    +K++   D    +NK  +  +N   D+  
Sbjct: 38  TVTLVSHDSWAASK----SVLEDFEKQSGYTVKVLKDGDAGQAVNKAILTKDNPQGDVFF 93

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP---IKWDDDIFVPYDYGYLAFIYDKRQIT-- 145
           G DN L+  A   GLF       S L  P   +        P D G +   YDK+     
Sbjct: 94  GVDNTLLSRALDNGLFQPYEAKGSGLIRPEYQVDRAKHRVTPIDSGDICVNYDKKYFADH 153

Query: 146 --QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTAT 202
              PP +F +L+       ++ ++  TS+ GLG LL     YGD      WKK+      
Sbjct: 154 KLDPPASFGDLVEPRYKNLLVTENAATSSPGLGFLLGTAAEYGDKGWPDYWKKLKANGVK 213

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA--ALFSEGHY 251
           V  GW ++Y         G   KG+   V+SY++SP   ++        A   + S   +
Sbjct: 214 VVDGWEQAYNQEFSGSAGGKKAKGDRPLVVSYASSPPAEVIYASPKPKTAPTGVASGTCF 273

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQAIRIPQ 310
            Q+E A  L  +K  +  +  + F+++  FQ  +P   ++YPVV    +P  +       
Sbjct: 274 RQVEYAGLLSNAKNTKGGKALLDFLVTKEFQEDMPLNMFVYPVVKGAQVPAEFSEFGPAA 333

Query: 311 KSLRFNA-EETTRYRNQWISSWQNAV 335
           KS    A  E    R+QW+ SW + V
Sbjct: 334 KSPETLAPAEIADNRDQWVKSWTSLV 359


>gi|320160080|ref|YP_004173304.1| putative ABC transporter substrate binding protein [Anaerolinea
           thermophila UNI-1]
 gi|319993933|dbj|BAJ62704.1| putative ABC transporter substrate binding protein [Anaerolinea
           thermophila UNI-1]
          Length = 363

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 89/332 (26%), Positives = 151/332 (45%), Gaps = 29/332 (8%)

Query: 28  AKPV-LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAA 86
           ++PV L V T++SF   E    +I +AFE +   ++  I   D  A LN+  +  EN  A
Sbjct: 39  SQPVELRVMTHDSFAVSE----EIVRAFEAEHRAKVTFIKSGDTGAALNRAILTRENPQA 94

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQL--KLPIKWDDDI---FVPYDYGYLAFIYDK 141
           D+  G DN  +  A    +F      AS L  K+P  +  D     +P DYG +   YDK
Sbjct: 95  DVFYGVDNTFLSRALDENIFEPY---ASPLLEKIPASFKLDSSNRALPVDYGDVCINYDK 151

Query: 142 RQITQP----PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKI 196
               +     P++ ++L        ++ ++P TS+ GL  L      +G+      WK +
Sbjct: 152 AYFAEKNLPIPQSLEDLTKPEYRGLLVVENPATSSPGLAFLFATIAHFGEEGYLDYWKAL 211

Query: 197 ATKTATVTKGWTESYGFFL-----KGESDFVLSYSTSPGFYLLNYGQ---DDYVAALFSE 248
                 V   W  +Y  +      KG    V+SY++SP   ++   Q   D   A+L   
Sbjct: 212 RANDVVVASDWESAYYTYFSASSGKGPQPMVVSYASSPAAEVIFAEQPLSDAPTASLTGA 271

Query: 249 GH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVY-QA 305
           G  Y QIE    L  + Q +LA+ F+ FM+  +FQ  +P   +++PV  + ++P+ + + 
Sbjct: 272 GMCYRQIEFVGILKGTPQRKLAEAFVDFMLGKTFQEDMPLQMFVFPVNSEATLPEAFTRY 331

Query: 306 IRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            ++ ++    ++      R  WI +W  AV R
Sbjct: 332 AQVAEQPAALDSAVIAAKREAWIQAWTEAVLR 363


>gi|292654199|ref|YP_003534096.1| ABC transporter periplasmic substrate-binding protein [Haloferax
           volcanii DS2]
 gi|291371776|gb|ADE04003.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate thiamine) [Haloferax volcanii DS2]
          Length = 378

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 88/319 (27%), Positives = 139/319 (43%), Gaps = 21/319 (6%)

Query: 31  VLTVYTYNSFV--ADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
            LTV TY SFV       GP +K+ FE + +  L+      GV    +  + G  S AD+
Sbjct: 56  TLTVGTYGSFVDAPSSSPGPWLKETFESEFDATLEWQTPDSGVNYYIERGLRGVESGADL 115

Query: 89  VLGFDNNL---IDLARKTGLFAK----SNIDASQLKLPIKWD-DDIFVPYDYGYLAFIYD 140
            +G D  +   ID      LF+     S ID   +K  + +D     VPYD GY++ +YD
Sbjct: 116 YVGLDAQMLVRIDRELDEALFSPAEGLSRID--DVKEGLNFDPQGRAVPYDTGYISLVYD 173

Query: 141 KRQITQ---PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKI 196
           +         P+ FD L++S     ++ Q+P +S  G   LL      G++S    W  +
Sbjct: 174 ETYGDGDFVAPETFDGLLDSEYAGALLAQNPTSSATGQAFLLHTIDAKGEDSYLDYWASL 233

Query: 197 ATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD--DYVAALFSEGHYLQI 254
                 V   W ++Y  +  GE+  V+SYST   F     G+D   +     ++  Y   
Sbjct: 234 KENDVRVLGNWEDTYNAYSNGEAPMVVSYSTDQVF-AAESGEDMARHQIRFLNDQAYANP 292

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS-MP-DVYQAIRIPQKS 312
           E  A    +  P LA EFM FM+ P  Q  +   N  +P    + +P D  Q  + P ++
Sbjct: 293 EGMAPFADASNPDLAVEFMDFMLRPEVQAEIAVRNVQFPATTTAELPEDFAQYAQEPPEA 352

Query: 313 LRFNAEETTRYRNQWISSW 331
           + F+ +      + W  +W
Sbjct: 353 VTFSYDRLQNNLSDWTDAW 371


>gi|302554451|ref|ZP_07306793.1| ABC transporter substrate-binding protein [Streptomyces
           viridochromogenes DSM 40736]
 gi|302472069|gb|EFL35162.1| ABC transporter substrate-binding protein [Streptomyces
           viridochromogenes DSM 40736]
          Length = 361

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 87/359 (24%), Positives = 157/359 (43%), Gaps = 30/359 (8%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAK----PVLTVYTYNSFVADEGAGPKIKQAFERK 57
           K+   +VVG+ M  G ++ C   G          +T+ +++S+   +     +  AFE++
Sbjct: 6   KRLTAVVVGLGM-AGTLAACGSSGGSQGSGDSKTVTLVSHDSWAVSK----DVIAAFEKQ 60

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDAS-QL 116
              ++ ++   D    +NK  +  +N   D+  G DN L+  A   GLF       S Q+
Sbjct: 61  SGYKVNVLKDGDAGQAVNKAILTKDNPQGDVFFGVDNTLLSRALDNGLFQPYEAKGSDQV 120

Query: 117 KLPIKWDDDIF--VPYDYGYLAFIYDKRQIT----QPPKNFDELINSTKPWKIIYQDPRT 170
           K   + D D     P D G +   YDK+        PP++ D+L+       ++ ++   
Sbjct: 121 KAEYRVDQDKHRVTPVDTGDICVNYDKKYFADHELDPPRSLDDLVKPQYKNLLVTENASA 180

Query: 171 STLGLGLLLWIQKIYGDNSAQ-VWKKIATKTATVTKGWTESY---------GFFLKGESD 220
           S+ GLG LL     YGD   +  WKK+      V  GW ++Y         G   KG+  
Sbjct: 181 SSPGLGFLLGTAAKYGDGGWEGYWKKLKANGVKVVDGWEQAYNEEFSGSAGGKKAKGDRP 240

Query: 221 FVLSYSTSPGFYLLNYGQDDYVAAL-FSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMIS 278
            V+SY++SP   ++        A    +EG  + Q+E A  L  +K  +  +  + F+++
Sbjct: 241 LVVSYASSPPAEVVFADPKPSTAPTGVAEGTCFRQVEYAGLLSNAKNTKGGKALLDFLLT 300

Query: 279 PSFQRILPTTNWMYPVVDISM--PDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
             FQ  +P   ++YPV + +   P+  +     +     +  +    R+QW+ SW + V
Sbjct: 301 KRFQEDMPLNMFVYPVREGAQVPPEFVKYGPQAKDPETMDPAKIADNRDQWVKSWTSLV 359


>gi|295836268|ref|ZP_06823201.1| ABC transporter substrate-binding protein [Streptomyces sp. SPB74]
 gi|197697367|gb|EDY44300.1| ABC transporter substrate-binding protein [Streptomyces sp. SPB74]
          Length = 362

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 81/328 (24%), Positives = 144/328 (43%), Gaps = 25/328 (7%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
           G   +  +T+ +++SF A +     + + FE+K    LK++   D    +N+  +   + 
Sbjct: 33  GSSRRKTVTLVSHDSFAASK----SVLKKFEQKTGYHLKVLKSGDAGQAVNQAVLTKGHP 88

Query: 85  AADIVLGFDNNLIDLARKTGLFAKSNIDA-SQLKLPIKWDD--DIFVPYDYGYLAFIYDK 141
             D+  G DN L+  A   G+FA       S +   ++ DD      P D G +   YDK
Sbjct: 89  QGDVFFGVDNTLLSRALNEGVFASYEAKGLSAVPADLRLDDARHRVTPIDTGDICVNYDK 148

Query: 142 RQIT----QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKI 196
           +        PP+  D+L +      ++ ++  TS+ GLG LL     YG+   Q  WKK+
Sbjct: 149 KYFADKKLDPPRTLDDLADPAYKNLLVTENTATSSPGLGFLLGSVARYGEQGWQTYWKKL 208

Query: 197 ATKTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAAL 245
                 V   W ++Y         G    G+   V+SY++SP   +L  +    +    +
Sbjct: 209 RHNGVKVVDSWEQAYNEEFSGSAGGRKAGGDRPLVVSYASSPPVEVLYADPRPKEAPTGV 268

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQ 304
            +   + Q E A  L  +  P+  +  + F++S +FQR +P   ++ PVV    +PD++ 
Sbjct: 269 ATGTCFRQTECAGLLDGAPNPEGGKALLDFLLSGTFQRDMPLQMFVKPVVKGTPLPDLFT 328

Query: 305 AIRIPQKSLRFNA-EETTRYRNQWISSW 331
                    R  A E+   +R  WI++W
Sbjct: 329 RYGASSDGARTLAPEKIAEHREDWINTW 356


>gi|260223108|emb|CBA33342.1| hypothetical protein Csp_B18570 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 314

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 87/317 (27%), Positives = 137/317 (43%), Gaps = 18/317 (5%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + V T++SF   +   P + Q FE++   +L++    D   +LNKL +   N  AD+V G
Sbjct: 1   MRVLTHSSFTVPK---PLLAQ-FEKENGVKLRITKAGDAGEMLNKLILTKANPIADVVYG 56

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK----RQITQP 147
            DN L   A    +       A+  K P+       VP DYGY+   YDK    +     
Sbjct: 57  IDNALAPKALAADVLEAGAPVAAGRK-PVAELPAPLVPVDYGYVTLNYDKAWFAKNGVAL 115

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKG 206
           PK  D+L        ++ Q+P TS+ G   LL      G++ A   W K+      V KG
Sbjct: 116 PKTLDDLTQPAYAKLLVVQNPATSSPGYAFLLSTIATLGEDKAFDFWAKLRANGLKVAKG 175

Query: 207 WTESYGFFLK---GESDFVLSYSTSPG---FYLLNYGQDDYVAALFSEGH-YLQIEVAAQ 259
           WTE+Y        G+   V+SY+TSP    FY      +    +L   G  + Q+E  A 
Sbjct: 176 WTEAYYTEFSQNGGKHPMVVSYATSPAAELFYSKTKLVEPPTGSLSLPGAVFRQVEGVAL 235

Query: 260 LVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAIRIPQKSLRFNAE 318
           +   K    A++F+ FM S   Q  + T  WM+P    ++  + ++    P      +  
Sbjct: 236 VKGGKNRAAAEKFVDFMRSAPVQTGMQTEMWMFPAEAGVAKAEAFKFAPEPTAFSAPSDA 295

Query: 319 ETTRYRNQWISSWQNAV 335
           +      +W++ W  AV
Sbjct: 296 DIAAKGAEWVARWTKAV 312


>gi|256374894|ref|YP_003098554.1| ABC transporter periplasmic protein [Actinosynnema mirum DSM 43827]
 gi|255919197|gb|ACU34708.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Actinosynnema mirum DSM 43827]
          Length = 344

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 149/336 (44%), Gaps = 24/336 (7%)

Query: 17  VISYCTLDG-LPAKP---VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVA 72
           +++ C++ G  PA P   V+T+ T++SF  D+     +   F+      +K +   D   
Sbjct: 14  LLAACSVAGNQPAAPGERVVTLVTHDSFAVDQA----LLDEFKSDTGITIKPLASGDAGE 69

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK---SNIDASQLKLPIKWDDDIFVP 129
           L NKL +   N   D+  G D+     A K  +FA+      D    +  ++  + +   
Sbjct: 70  LTNKLVLTKANPIGDVAFGVDSTFASRALKESVFAEYTSPEGDKGAQRYQLEPANRLHA- 128

Query: 130 YDYGYLAFIYDKRQITQ--PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
            D G +    D   +     P+   +L +      ++ +DP TS+ GL  LL     +G+
Sbjct: 129 VDVGDVCLNVDVAALKDVGEPQKLSDLADPKYRDMLVVEDPATSSPGLAFLLNTIATFGE 188

Query: 188 -NSAQVWKKIATKTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDY 241
            N    W ++      V  GW E+Y     G   KG    V+SY++SP   + + G    
Sbjct: 189 ENWTNYWGQLKANGVKVVSGWEEAYNQDFSGSAGKGPRPIVVSYASSPSAEIGDDGAPRT 248

Query: 242 VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMP 300
            A L  +  Y Q+E A  L  +K P+ A++ + F++   FQ  +P   ++YP   DI +P
Sbjct: 249 KALL--DTCYRQVEYAGVLENAKNPEDAKKVLDFLLGADFQAQVPEQMYVYPSREDIPLP 306

Query: 301 DVY-QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           + + +A  +P  S    A++    R QW+  W+  V
Sbjct: 307 EAWAKAAPLPANSRTLPADQVDAGREQWVQQWRTLV 342


>gi|291454432|ref|ZP_06593822.1| ABC transporter substrate-binding protein [Streptomyces albus
           J1074]
 gi|291357381|gb|EFE84283.1| ABC transporter substrate-binding protein [Streptomyces albus
           J1074]
          Length = 368

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 155/356 (43%), Gaps = 36/356 (10%)

Query: 8   VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
             G+  +T   S    D   +K V T+ T++SF   +     +   F++K    ++++  
Sbjct: 23  CAGLFAVTACGSGDGADEAQSKQV-TLVTHDSFNVSK----DVLAEFKKKTGYTVEVLKS 77

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA------------KSNIDASQ 115
            D    +N+  +   N   D++ G DN L+  A   G+FA            +  +DA +
Sbjct: 78  GDAGQAVNQAVLSKGNPQGDVLFGVDNTLLSRAVDNGVFAPYEAKGLDRVPAEYQLDAEK 137

Query: 116 LKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGL 175
            ++      DI V YD  Y A   DK+    PP+ F++L +      ++ ++  TS+ GL
Sbjct: 138 HRVTPVDTGDICVNYDKSYFA---DKK--LDPPRTFEDLADPKYKNLLVTENVATSSPGL 192

Query: 176 GLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYG---------FFLKGESDFVLSY 225
           G LL     +GD      WKK+      V +GW ++Y              G+   V+SY
Sbjct: 193 GFLLGTAAEFGDEGWRDYWKKLKANGVKVVEGWEQAYNEEFSGSAGGKKAGGDRPLVVSY 252

Query: 226 STSPGFYLL--NYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQR 283
           ++SP   +L  +   D+    + ++  + QIE A  L  +K P+  ++ + F+I  +FQ 
Sbjct: 253 ASSPPVEVLYADPQPDEAPTGVLTDTCFRQIEFAGLLDGAKNPEGGKKLLDFLIGKTFQE 312

Query: 284 ILPTTNWMYPVV-DISMPDVYQAIRIPQKSLR-FNAEETTRYRNQWISSWQNAVSR 337
            LP   ++ PV  D  +P ++          R    E+    R  W+ SW + V +
Sbjct: 313 DLPLQMFVRPVADDAKLPKLFTEFGAEADRARSLEPEKIAENREAWVKSWTSLVVK 368


>gi|239982589|ref|ZP_04705113.1| putative ABC transporter substrate-binding protein [Streptomyces
           albus J1074]
          Length = 360

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 154/356 (43%), Gaps = 36/356 (10%)

Query: 8   VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGL 67
             G+  +T   S    D   +K V T+ T++SF         +   F++K    ++++  
Sbjct: 15  CAGLFAVTACGSGDGADEAQSKQV-TLVTHDSF----NVSKDVLAEFKKKTGYTVEVLKS 69

Query: 68  SDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA------------KSNIDASQ 115
            D    +N+  +   N   D++ G DN L+  A   G+FA            +  +DA +
Sbjct: 70  GDAGQAVNQAVLSKGNPQGDVLFGVDNTLLSRAVDNGVFAPYEAKGLDRVPAEYQLDAEK 129

Query: 116 LKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGL 175
            ++      DI V YD  Y A   DK+    PP+ F++L +      ++ ++  TS+ GL
Sbjct: 130 HRVTPVDTGDICVNYDKSYFA---DKK--LDPPRTFEDLADPKYKNLLVTENVATSSPGL 184

Query: 176 GLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYG---------FFLKGESDFVLSY 225
           G LL     +GD      WKK+      V +GW ++Y              G+   V+SY
Sbjct: 185 GFLLGTAAEFGDEGWRDYWKKLKANGVKVVEGWEQAYNEEFSGSAGGKKAGGDRPLVVSY 244

Query: 226 STSPGFYLL--NYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQR 283
           ++SP   +L  +   D+    + ++  + QIE A  L  +K P+  ++ + F+I  +FQ 
Sbjct: 245 ASSPPVEVLYADPQPDEAPTGVLTDTCFRQIEFAGLLDGAKNPEGGKKLLDFLIGKTFQE 304

Query: 284 ILPTTNWMYPVV-DISMPDVYQAIRIPQKSLR-FNAEETTRYRNQWISSWQNAVSR 337
            LP   ++ PV  D  +P ++          R    E+    R  W+ SW + V +
Sbjct: 305 DLPLQMFVRPVADDAKLPKLFTEFGAEADRARSLEPEKIAENREAWVKSWTSLVVK 360


>gi|124027223|ref|YP_001012543.1| thiamine-binding, periplasmic protein [Hyperthermus butylicus DSM
           5456]
 gi|123977917|gb|ABM80198.1| Thiamine-binding, periplasmic protein [Hyperthermus butylicus DSM
           5456]
          Length = 414

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 149/308 (48%), Gaps = 38/308 (12%)

Query: 29  KPV-LTVYTYNSFVA---DEGAGPKIKQAFERKCNCELKLIGLSDGV-----ALLNKLRM 79
           KPV L VYTY+ F+A   DE    K+ Q FE +   ++ +I   DG       +LN+L  
Sbjct: 75  KPVKLVVYTYDDFMAWGEDEELFDKLVQRFENETGIDV-VIYRFDGARQMVTQVLNELDQ 133

Query: 80  EGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD-DDIFVPYDYGYLAFI 138
             E   AD+V+G D  L+   +K          ++ L++    D D    P DYG +A +
Sbjct: 134 GVET--ADVVIGIDPILLQELKKHNAVVCYLSPSAPLEVANALDPDHCATPIDYGLIALV 191

Query: 139 YDKRQITQPP-------KNFDELINSTKPWKIIYQDPRTSTLGLGLLLW---IQKIYGDN 188
           YD  ++T+            DEL+      +I+ +DP  S+ GL  LL+   + ++ G +
Sbjct: 192 YDPSRLTEEELAMLRDGVTLDELVKLAP--RIVGEDPTKSSTGLNFLLYTMALSRLEGRD 249

Query: 189 SAQVWKKIATKTATVTKGWTESYGFFLKGESD--FVLSYSTSPGF---YLLNYG---QDD 240
             ++W+++      +   W  +Y  FL+  S    V+SY T P +   Y    G   +  
Sbjct: 250 WKELWRQLVGNGMMIAPSWGSAYDEFLREGSPRAIVVSYGTDPAYSAWYSAKEGGAEEPS 309

Query: 241 YVAALFSEGH----YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD 296
             A + + G     ++Q+E  A ++R  +   A++F+ +++S   QR +P + WM+P VD
Sbjct: 310 VNATVLAAGGKRLGWMQVEGVA-IIRGAELDAAKKFVDWLLSEEVQREIPASQWMFPAVD 368

Query: 297 ISMPDVYQ 304
           +S+P  Y+
Sbjct: 369 VSLPSFYK 376


>gi|119714697|ref|YP_921662.1| ABC transporter periplasmic-binding protein [Nocardioides sp.
           JS614]
 gi|119535358|gb|ABL79975.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Nocardioides sp. JS614]
          Length = 359

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/339 (25%), Positives = 145/339 (42%), Gaps = 26/339 (7%)

Query: 15  TGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALL 74
           +G  S  +  G P + VL   T+ SF   +   P IKQ FE++   +L +    D   L 
Sbjct: 31  SGDESTASPGGEPGRVVLV--THESFSLPK---PLIKQ-FEQQSGYDLVVRASGDAGILT 84

Query: 75  NKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNI----DASQLKLPIKWDDDIFVPY 130
           NKL +   +   D+  G DN     A   G+FA  +      A Q +LP   D+    P 
Sbjct: 85  NKLVLTKGDPLGDVAFGIDNTFASRALDEGVFAPYDAPLPDGADQYRLPGD-DEHDLTPI 143

Query: 131 DYGYLAFIYDKR----QITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG 186
           D   +    D          PPK  D+L         +     TS+ GL  LL     YG
Sbjct: 144 DNASVCVNVDDTWFADHHLAPPKTLDDLAAPEYQGLFVTPGAATSSPGLAFLLSTIAAYG 203

Query: 187 DNSAQ-VWKKIATKTATVTKGWTESYGFFL-----KGESDFVLSYSTSPGFYLLNYGQDD 240
           ++  Q  W ++      +T GW+++Y         +G+   VLSY +SP F + + G+  
Sbjct: 204 EDGWQDYWARLMENGTKLTAGWSDAYEVDFTQGGGQGDRPIVLSYDSSPAFTVAD-GESS 262

Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISM 299
             A L  +  + Q+E A  L  +  P  A++ + F++SP  Q  LP + +++PV   + +
Sbjct: 263 TSALL--DTCFRQVEYAGVLDGAANPAGAEQLVDFLLSPEVQAALPESMYVFPVDSSVQL 320

Query: 300 PDVYQAI-RIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           P  +    + P      +      +R++W+  W +  SR
Sbjct: 321 PKEWARFAKQPSDPFSVDPASIDEHRDEWLREWTDVTSR 359


>gi|302530069|ref|ZP_07282411.1| ABC transporter substrate-binding protein [Streptomyces sp. AA4]
 gi|302438964|gb|EFL10780.1| ABC transporter substrate-binding protein [Streptomyces sp. AA4]
          Length = 356

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 92/363 (25%), Positives = 158/363 (43%), Gaps = 42/363 (11%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAK----------PVLTVYTYNSFVADEGAGPKI 50
           M +  R V G+  +  + S C+L G  +           P +T+ T++SF A +     +
Sbjct: 2   MSRTVRTVAGLAGVAVLASACSLSGGDSGGSSASPDQKTPTVTLVTHDSFAAPQ----DV 57

Query: 51  KQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF---- 106
             AF+R+   +LK++   D  AL NKL +   +   D+  G DN     A   G+F    
Sbjct: 58  LDAFQRQSGIKLKILKSGDAGALTNKLVLTKGSPIGDVAYGVDNTFASRALSEGVFQPYT 117

Query: 107 --------AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST 158
                    + ++D  Q +L      D+ V  D  Y A     + + + PK++D+L +  
Sbjct: 118 SPEADRGPQRYSVD-PQHRLSAVDLGDVCVNIDPAYFA----SKGLPE-PKSYDDLADPK 171

Query: 159 KPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY-----G 212
                + + P T++ GL  LL     YG++     W+K+         GW E+Y     G
Sbjct: 172 YKDLTVAESPATASPGLAFLLGTVAKYGEDGWKGYWQKLKDNGLKTVSGWEEAYTKDFSG 231

Query: 213 FFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEF 272
              KG    V+SY++SP   +   G+    A L  +  + Q+E A  L   KQ   AQ+ 
Sbjct: 232 SSGKGPRPIVVSYASSPAAEVGEDGKPRTKALL--DTCFRQVEYAGVLTNGKQIPQAQKV 289

Query: 273 MQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQ-AIRIPQKSLRFNAEETTRYRNQWISS 330
           + F++S  FQ  +    ++YP    + +P  +  A  +PQ      A++    R +WI  
Sbjct: 290 VDFLLSQQFQTTVAANMYVYPARQGVELPAGWATAAPLPQAPATMPADKVQAGREKWIGE 349

Query: 331 WQN 333
           W++
Sbjct: 350 WRS 352


>gi|282861395|ref|ZP_06270460.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces sp. ACTE]
 gi|282564053|gb|EFB69590.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces sp. ACTE]
          Length = 361

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 149/350 (42%), Gaps = 25/350 (7%)

Query: 9   VGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLS 68
           +G+ ++ G        G      +T+ +++SF A +     + +AF ++    +K++   
Sbjct: 16  LGVTVLAGCGDDSGSTGAGGSKTVTLVSHDSFDASDA----VLKAFTKETGYTVKVLKSG 71

Query: 69  DGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA---KSNIDASQLKLPIKWDDD 125
           D  A LN+  +   +   D+  G DN L+  A   GLF       +D     + +  D  
Sbjct: 72  DAGAALNQEILTKGSPRGDVFFGVDNTLLSRALDNGLFTPYEAKGLDRVAADVQLDADKH 131

Query: 126 IFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
              P D G +   YDK+        PP +FD+L+       ++ ++  TS+ GLG LL  
Sbjct: 132 RVTPVDTGDICVNYDKKYFADKKLDPPTSFDDLLKPAYKNLLVTENAATSSPGLGFLLGT 191

Query: 182 QKIYGDNSAQ-VWKKIATKTATVTKGWTESYG---------FFLKGESDFVLSYSTSPGF 231
              +GD+  Q  WKK+      V  GW ++Y              G+   V+SY++SP  
Sbjct: 192 VAAHGDSGYQDYWKKLKANGVKVVDGWEQAYNEEFSGSAGGKKAGGDRPLVVSYASSPPV 251

Query: 232 YLL--NYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTN 289
            +L  +    +    + +   + QIE A  L  +      +  + F+I   FQ  +P   
Sbjct: 252 EVLYADPQPTEAPTGVATGTCFRQIEFAGLLDGAGNEAGGKALLDFLIGKRFQEDMPLKM 311

Query: 290 WMYPVV-DISMPDVYQAIRI-PQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           ++ PVV D  +P+++       +K      ++    R QW+ SW + V +
Sbjct: 312 FVNPVVKDAKLPELFTKFGAESEKPATVAPDKIAENREQWVRSWSSIVVK 361


>gi|296128086|ref|YP_003635336.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Cellulomonas flavigena DSM 20109]
 gi|296019901|gb|ADG73137.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Cellulomonas flavigena DSM 20109]
          Length = 367

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 144/321 (44%), Gaps = 23/321 (7%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +T+ T+ SF   EG    + + FE      ++++  +D  AL+N+L +  +    D+V G
Sbjct: 51  VTLVTHESFGLSEG----LLEQFEADTGLTVEVVQQADAGALVNQLVLTKDAPLGDLVFG 106

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLP----IKWDDDIFVPYDYGYLAFIYD-----KR 142
            D+     A   G+     +DA   +      +  D+      D G +    D     +R
Sbjct: 107 VDDAFASRALDEGVVVPVELDAPAAQDAAAYAVPGDEGALTAVDLGDVCLNVDVGWFAER 166

Query: 143 QITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTA 201
            + +P    + L++      ++  DP TS+ GL  LL     +G++     W  +     
Sbjct: 167 GVPEP-TTLESLLDPAYRDLVVVPDPVTSSPGLAFLLATVGAFGEDGWVDYWAGLRDNGL 225

Query: 202 TVTKGWTESY-GFFLKGESD----FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEV 256
            V  GW+E+Y   F  G  D     VLSY++SP F + + G +    AL  +  Y Q+E 
Sbjct: 226 KVADGWSEAYYTDFTAGGGDGPRPVVLSYASSPPFTVPDGGDEPTTRALL-DTCYRQVEY 284

Query: 257 AAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQA-IRIPQKSLR 314
           A  L  +  P+ A + ++F++S   Q  +PT+ +MYPV   + +P+ +     +  +   
Sbjct: 285 AGVLAGAANPEGAAQLLEFLLSDEVQADIPTSMYMYPVSSSVELPEEWARWAPLADEPFD 344

Query: 315 FNAEETTRYRNQWISSWQNAV 335
               + + +R QW+ +W + V
Sbjct: 345 VAPADISTHREQWLQTWSDTV 365


>gi|290957075|ref|YP_003488257.1| solute-binding transporter protein [Streptomyces scabiei 87.22]
 gi|260646601|emb|CBG69698.1| putative solute-binding transport system protein [Streptomyces
           scabiei 87.22]
          Length = 360

 Score =  102 bits (253), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 151/332 (45%), Gaps = 37/332 (11%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ ++ SF   +     + +AFE++   ++K++   D    +N+  +  +N   D+  
Sbjct: 37  TVTLVSHGSFTYSK----DVLKAFEKESGYKVKVLKSGDAGQAVNQAILTKDNPQGDVFF 92

Query: 91  GFDNNLIDLARKTGLF------------AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           G DN L+  A   GLF            A+  +D ++ ++      DI V YD  Y    
Sbjct: 93  GVDNTLLSRALDNGLFQPYEAKGLGKVGAEYQLDKAEHRVTPIDTGDICVNYDKAY---- 148

Query: 139 YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIA 197
           + K++I +PP+ FD+LI       ++ ++  TS+ GLG +L     YGD   +  WKK+ 
Sbjct: 149 FSKKKI-EPPQTFDDLIKPQYKNLLVTENASTSSPGLGFVLGTAAKYGDGGWEGYWKKLK 207

Query: 198 TKTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYGQ---DDYVAAL 245
                V  GW ++Y         G    G+   V+SY++SP   ++ Y +   +     +
Sbjct: 208 ANGVKVVDGWEQAYYQEFSGSTDGRKAGGDRPLVVSYASSPPAEVI-YAEPRPETAPTGV 266

Query: 246 FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-ISMPDVYQ 304
            +   + Q E A  L  ++  +  +  + F+IS  FQ  +P   ++YPVV+  S+P  + 
Sbjct: 267 ATGTCFRQTEFAGLLSNARNAEGGKALIDFLISKRFQEDMPLNMFVYPVVEGASVPAEFT 326

Query: 305 AIRIPQKSLRFNA-EETTRYRNQWISSWQNAV 335
                 K     A  +    R++W+ SW + V
Sbjct: 327 EYGPAAKDPETMAPAKIAEKRDEWVKSWTSLV 358


>gi|330863018|emb|CBX73150.1| hypothetical protein YEW_IY38520 [Yersinia enterocolitica W22703]
          Length = 84

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 63/84 (75%)

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSL 313
           +EVA  +  SKQP+LAQ FMQFM++P+FQ  +PT NWMYPV+ + +P  +  + +PQK+L
Sbjct: 1   MEVAGVVASSKQPELAQRFMQFMVTPAFQNHIPTGNWMYPVIKMDLPAGFDTLTVPQKAL 60

Query: 314 RFNAEETTRYRNQWISSWQNAVSR 337
           +F+A++    R +WI +WQ+AVSR
Sbjct: 61  QFDAKDVADNRGKWIQAWQSAVSR 84


>gi|302537212|ref|ZP_07289554.1| ABC transporter substrate-binding protein [Streptomyces sp. C]
 gi|302446107|gb|EFL17923.1| ABC transporter substrate-binding protein [Streptomyces sp. C]
          Length = 365

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/338 (25%), Positives = 147/338 (43%), Gaps = 38/338 (11%)

Query: 27  PAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAA 86
           P    +T+ +++SF   E     + + FE++    +K++   D  A LN+  +   +   
Sbjct: 39  PKSKTVTLVSHDSFNVTEA----VLKEFEQQSGYTVKVLKSGDAGAALNQEILTKGSPRG 94

Query: 87  DIVLGFDNNLIDLARKTGLFAKSN------------IDASQLKLPIKWDDDIFVPYDYGY 134
           D+  G DN L+  A   G+F                +D      P+    DI V YD  Y
Sbjct: 95  DVFFGVDNTLLSRALDNGVFTPYQAKGLDTVKPEFVLDKQHRVTPVD-SGDICVNYDKAY 153

Query: 135 LAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVW 193
            A   DK+    PP+  D+L+       ++ ++  TS+ GLG LL     YG+      W
Sbjct: 154 FA---DKK--IAPPQTLDDLVKPEYKNLLVTENAATSSPGLGFLLASVGKYGEEGWKDYW 208

Query: 194 KKIATKTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA 244
            K+      V  GW ++Y         G   KG+   V+SY++SP   +L YG+     A
Sbjct: 209 SKLKANGVEVVDGWEQAYNERFSGSAGGKKAKGDRPLVVSYASSPPVEVL-YGEPQPAEA 267

Query: 245 ---LFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMP 300
              + +   + Q+E A  L  +K  +  +  + F++S  FQ  +P   ++ PVV D  +P
Sbjct: 268 PTGVATGTCFRQVEFAGLLKGAKNEEGGKALIDFLVSKKFQEDMPLQMFVNPVVKDAKLP 327

Query: 301 DVY-QAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
           D++ +   +  K      E   + R QW+ +W + V +
Sbjct: 328 DLFTKHGVVVDKPENVAPEAIAKNREQWVKTWSSLVVK 365


>gi|333024149|ref|ZP_08452213.1| putative ABC transporter substrate-binding protein [Streptomyces
           sp. Tu6071]
 gi|332744001|gb|EGJ74442.1| putative ABC transporter substrate-binding protein [Streptomyces
           sp. Tu6071]
          Length = 388

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 142/326 (43%), Gaps = 25/326 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++SF A +     + + FE+K    LK++   D    +N+  +       D+  
Sbjct: 65  TVTLVSHDSFAASK----SVLKKFEQKTGYRLKVLKSGDAGQAVNQAVLTKGRPQGDVFF 120

Query: 91  GFDNNLIDLARKTGLF---AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKR----Q 143
           G DN L+  A   G+F       + A    L +        P D G +   YDK+    +
Sbjct: 121 GVDNTLLSRALDQGVFQPYEAKGLSAVPADLQLDGKRHRVTPIDTGDICVNYDKKYFEGK 180

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTAT 202
              PPK   +L +      ++ ++  TS+ GLG LL     YG+   Q  WKK+      
Sbjct: 181 KLDPPKTLADLADPAYKNLLVTENTATSSPGLGFLLGSVAQYGERGWQTYWKKLRANGVK 240

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHY 251
           V   W ++Y         G    G+   V+SY++SP   +L  +   +D    + +   +
Sbjct: 241 VVDSWEQAYNEEFSGSAGGHKAGGDRPLVVSYASSPPVEVLYADPRPEDAPTGVATGTCF 300

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQ 310
            Q E A  L  +  P+  +  + F++S +FQR +P   ++ PVV   ++PD++       
Sbjct: 301 RQTEFAGLLDGAPNPEGGKALLDFLLSDTFQRDMPLQMFVNPVVKGTALPDLFTRYGAEA 360

Query: 311 KSLRFNA-EETTRYRNQWISSWQNAV 335
              R  A ++   +R  WI++W + V
Sbjct: 361 DGARTVAPQKIAEHREDWINAWTSLV 386


>gi|262203225|ref|YP_003274433.1| ABC transporter periplasmic-binding protein, thiB subfamily
           [Gordonia bronchialis DSM 43247]
 gi|262086572|gb|ACY22540.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Gordonia bronchialis DSM 43247]
          Length = 351

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 91/349 (26%), Positives = 149/349 (42%), Gaps = 44/349 (12%)

Query: 11  IMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDG 70
           ++ +TG ++ C  D      V T+ T++SF   E     +   F ++    LK+I   D 
Sbjct: 25  VLAVTG-LTACADDAQSGAEV-TLLTHDSFALPE----SVFDTFRQQTGLTLKIIKSGDA 78

Query: 71  VALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLP---IKWDDDIF 127
             L + + +   +  AD V G DN L   A   G        A+        I    D  
Sbjct: 79  GQLASTVALTPGSPKADAVYGIDNTLASRAINAGALEPYAPPAAADGAARYAIPGAADQL 138

Query: 128 VPYDYGYLAFIYDK-----RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
              D G +    D      R+ T PP  F +L N T   + +  DPRTS+ G+  LL   
Sbjct: 139 TAVDRGDVCLNIDDTWYADRRAT-PPTGFRDLTNPTFAAQSVLLDPRTSSPGMAFLLTTI 197

Query: 183 KIYGDNSAQVWKKIATKTATVTKGWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYG 237
            + GD     WK +    AT++  WT++Y     G    G    V+SY++SP       G
Sbjct: 198 GVLGDGWQNYWKTVVAGGATISGDWTDAYEHQFSGGTGHGPKPIVVSYASSPA---AQPG 254

Query: 238 QDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD- 296
               + + F +  Y+ I     L  ++ P  A++ + FM+S + Q+ LP++ ++YPV + 
Sbjct: 255 TSALLDSCFGQVEYIGI-----LKGTRNPDGARKLVDFMLSQTVQKELPSSMYVYPVQNG 309

Query: 297 ISMPDVYQA--------IRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
             +PD +Q         + +P + +  NAE       +W   W+ AV R
Sbjct: 310 TPLPDGWQQRAPVPAWRVSLPPEYIAANAE-------KWQDQWRTAVGR 351


>gi|326776284|ref|ZP_08235549.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces cf. griseus XylebKG-1]
 gi|326656617|gb|EGE41463.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces cf. griseus XylebKG-1]
          Length = 365

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/366 (24%), Positives = 157/366 (42%), Gaps = 41/366 (11%)

Query: 3   KFARIVVGIMMITGVISYCTLDGLPAKP---------VLTVYTYNSF-VADEGAGPKIKQ 52
           K+A  V+   +   V++ C  D   A            +T+ +++SF V+D     K+ +
Sbjct: 6   KYAATVLAAALGVTVLAGCGSDDGSAGSGASKGSGSKTVTLVSHDSFNVSD-----KVLK 60

Query: 53  AFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNID 112
           AF  +   +++++   D  A LN+  +   +   D+  G DN L+  A   GLF      
Sbjct: 61  AFTEETGYKVEILKSGDAGAALNQEILTKGSPRGDVFFGVDNTLLSRALDNGLFTAYEAK 120

Query: 113 ASQLKLPIKWDDDIF--VPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQ 166
                 P    D+     P D G +   YDK+        PPK F +L+       ++ +
Sbjct: 121 GLDGVAPDTQTDEKHRVTPVDTGDICVNYDKKYFADKKLAPPKTFADLLKPAYKNLLVTE 180

Query: 167 DPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTATVTKGWTESY---------GFFLK 216
           +  +S+ GLG LL      G++  +  WKK+      V  GW ++Y         G   K
Sbjct: 181 NAASSSPGLGFLLGTIAAEGEDGYEAYWKKLKANGVKVVDGWEQAYNEEFSGSAGGKKAK 240

Query: 217 GESDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQ 274
            +   V+SY++SP   +L  +    +    + +   + Q E A  L  +K     +  + 
Sbjct: 241 ADRPLVVSYASSPPVEVLYADPQPKEAPTGVATGTCFRQTEYAGLLTGAKNEAGGKALLD 300

Query: 275 FMISPSFQRILPTTNWMYPVV-DISMPDVY----QAIRIPQKSLRFNAEETTRYRNQWIS 329
           FMI  +FQ  +P   ++ PVV D ++P+++    + I  P        E+ T  R QWI 
Sbjct: 301 FMIGETFQEDMPLNMFVNPVVKDATLPELFTKFGEKIDTPP---TVAPEKITANREQWIQ 357

Query: 330 SWQNAV 335
           SWQ+ V
Sbjct: 358 SWQSLV 363


>gi|326328812|ref|ZP_08195148.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Nocardioidaceae bacterium Broad-1]
 gi|325953434|gb|EGD45438.1| ABC transporter, periplasmic substrate-binding protein, ThiB family
           [Nocardioidaceae bacterium Broad-1]
          Length = 358

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/366 (25%), Positives = 157/366 (42%), Gaps = 39/366 (10%)

Query: 1   MKKFARIVVGIMMITGVI-SYCTLDGLPAKP-----------VLTVYTYNSFVADEGAGP 48
           M+  A     I  ++ ++ S C   G PAKP            + + T++SF   +    
Sbjct: 3   MRTPAITATAITAVSALLLSACG--GTPAKPDAEKSSGADDKTVVLLTHDSFTLPK---- 56

Query: 49  KIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGL--- 105
           ++   F  K     ++    DG  L  K+ ++  N   D V G DN     A   G    
Sbjct: 57  EVLAEFTEKTGYTAEIRHAGDGGELTTKIALDTGNPDGDAVFGVDNTFASRAIDQGALEA 116

Query: 106 FAKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYD-----KRQITQPPKNFDELINSTK 159
           +  S I        +  D++ F+ P D G +    D      +++T PPK+ D+L     
Sbjct: 117 YTPSEIPEGVSDFNLPGDEEHFLTPVDNGSVCVNIDTEWFAAKKLT-PPKSLDDLAEPAY 175

Query: 160 PWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY-GFFL-- 215
              ++     TST G+  LL     YG++  A  W K+    A V  GW ++Y   F   
Sbjct: 176 KDLLVTPGAATSTPGMAFLLATVAEYGEDGWADYWGKLMDNGAKVVDGWDQAYYSDFTQG 235

Query: 216 --KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFM 273
             KG    V+SY +SP F + + G+    A L  +  + Q+E A  L  +  P+ AQ  +
Sbjct: 236 GGKGTRPIVVSYDSSPAFTVKD-GKTTTAALL--DTCFRQVEYAGVLKGADHPEGAQALI 292

Query: 274 QFMISPSFQRILPTTNWMYPV-VDISMPDVYQAI-RIPQKSLRFNAEETTRYRNQWISSW 331
            FM+S S Q  LP + +++PV  D+ +P  +    + P   L    +E    R  W+++W
Sbjct: 293 DFMLSDSVQGALPESMYVFPVSSDVKLPAEWAKFAQQPTSPLSVEPKEIEENREAWLATW 352

Query: 332 QNAVSR 337
            + +++
Sbjct: 353 SDTIAQ 358


>gi|320008273|gb|ADW03123.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces flavogriseus ATCC 33331]
          Length = 364

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/329 (24%), Positives = 142/329 (43%), Gaps = 27/329 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++SF A +     + +AF  +   ++K++   D  A LN+  +   +   D+  
Sbjct: 41  TVTLVSHDSFNASDA----VLKAFTEQTGYKVKVLKSGDAGAALNQEILTKGSPRGDVFF 96

Query: 91  GFDNNLIDLARKTGLFA---KSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT-- 145
           G DN L+  A   GLF       +D     + +  D     P D G +   YDK+     
Sbjct: 97  GADNTLLSRALDNGLFTPYEAKGLDRVPADVQLDADQHRVTPVDTGDICVNYDKKYFADK 156

Query: 146 --QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTAT 202
              PP+ FD+L+       ++ ++  TS+ GLG LL     +G+   Q  WKK+      
Sbjct: 157 KLDPPQTFDDLLKPAYKNLLVTENAATSSPGLGFLLGTVAAHGETGYQDYWKKLKDNGVK 216

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA---LFSEGH 250
           V  GW ++Y         G   K +   V+SY++SP   +L Y       A   + +   
Sbjct: 217 VVDGWEQAYNDEFSGSAGGRKAKADRPLVVSYASSPPVEVL-YADPQPAEAPTGVATGTC 275

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIP 309
           + QIE A  L  ++     +  + F+I   FQ  +P   ++ PV  D  +P+++      
Sbjct: 276 FRQIEFAGLLDGARNEAGGKALLDFLIGKQFQEDMPLNMFVNPVAKDAKLPELFTKFGAT 335

Query: 310 -QKSLRFNAEETTRYRNQWISSWQNAVSR 337
             +      E+  + R QW+ SW + V +
Sbjct: 336 VDEPATVAPEKIAKNREQWVQSWSSLVVK 364


>gi|325283347|ref|YP_004255888.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Deinococcus proteolyticus MRP]
 gi|324315156|gb|ADY26271.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Deinococcus proteolyticus MRP]
          Length = 395

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 82/284 (28%), Positives = 126/284 (44%), Gaps = 23/284 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            L V T++SF   +G    + + FE+     ++LI   D   +LN+L +  +   AD+V 
Sbjct: 74  TLKVITHDSFALSDG----MIEGFEKSTGVNVELIKAGDAGQMLNRLILTKQAPLADVVY 129

Query: 91  GFDNNLIDLARKTGLFAKSNIDA-SQLKLPIKWDDD-IFVPYDYGYLAFIYDKRQITQP- 147
           G DN+++  AR   L       A S +    + D+  +    DYG +A  YD+    +  
Sbjct: 130 GLDNSMLPRARAEDLLMAYRSPALSGVPSERRLDESGLLNTVDYGVVALNYDRDAWAKTG 189

Query: 148 ---PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVT 204
              P+  DEL       +++   P TS+ GL  L+      G+  A  W   A      T
Sbjct: 190 LPLPQTLDELKGEEYASRLVVPSPATSSPGLAFLMATVNELGEEGAWAWWNEAENNGMKT 249

Query: 205 -KGWTESYGF-FLK--GESDFVLSYSTSPG---FYLLNYG-----QDDYVAALFSEG-HY 251
             GW+++Y   F +  G    VLSY +SP    FY   Y       +   A LF  G  Y
Sbjct: 250 VSGWSDAYNTEFTRAGGRYPLVLSYGSSPAAEVFYAEGYDPARLPAEAPTANLFIPGTSY 309

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           LQ+E    L  +     A+ F+ +M+SP  QR +PT  W+YP  
Sbjct: 310 LQLEGVGILKSTGNEAAAKAFVDWMLSPEVQRDIPTNMWVYPAA 353


>gi|328885357|emb|CCA58596.1| Thiamin ABC transporter, substrate-binding component [Streptomyces
           venezuelae ATCC 10712]
          Length = 364

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 88/338 (26%), Positives = 145/338 (42%), Gaps = 38/338 (11%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
           G PA   +T+ +++SF A +    ++  AF ++    +K++   D    +NK  +     
Sbjct: 36  GAPAPKTVTLVSHDSFNASK----EVLAAFTQQTGFTVKVLKSGDAGEAVNKEILTKGAP 91

Query: 85  AADIVLGFDNNLIDLARKTGLF------------AKSNIDASQLKLPIKWDDDIFVPYDY 132
             D+  G DN L+  A   G+F            A   +D      PI    DI V YD 
Sbjct: 92  QGDVFFGVDNTLLSRALDNGIFVPYEAKGLDRVPAAYQLDKEHRVTPID-SGDICVNYDK 150

Query: 133 GYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ- 191
            Y A   DK+    PP  FD+L        ++ ++P  S+ GLG LL     YGD+  Q 
Sbjct: 151 KYFA---DKK--LAPPVTFDDLAKPAYKDLLVVENPERSSPGLGFLLGTAAKYGDDGWQD 205

Query: 192 VWKKIATKTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYGQ---D 239
            W K+          W  +Y         G   KG+   V+SY++SP   +L YG+    
Sbjct: 206 YWSKLKANGVKTVDSWELAYNQEFSGSAGGKKAKGDRPLVVSYASSPPVEVL-YGEPQPK 264

Query: 240 DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DIS 298
           +    + +   + Q E A  L  +K P+  +  + F+IS  FQ  +P   ++ PV  D +
Sbjct: 265 EAPTGVSTGTCFRQTEFAGLLNGAKNPEGGKALIDFLISKKFQEDMPLQMFVNPVAKDAA 324

Query: 299 MPDVY-QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           +P+++ +   +  K      E+    R+ WI  W + V
Sbjct: 325 LPELFTKHGVVVGKPETMAPEKIAEKRDPWIQQWSSLV 362


>gi|254382050|ref|ZP_04997412.1| ABC transporter substrate-binding protein [Streptomyces sp. Mg1]
 gi|194340957|gb|EDX21923.1| ABC transporter substrate-binding protein [Streptomyces sp. Mg1]
          Length = 366

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/333 (24%), Positives = 148/333 (44%), Gaps = 28/333 (8%)

Query: 27  PAKPVLTVYTYNSF-VADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
           P    +T+ +++SF V D      + + FE++    +K++   D  A LN+  +   +  
Sbjct: 40  PKSKTVTLVSHDSFNVTD-----TVLKEFEQQSGYTVKVLKSGDAGAALNQEILTKGSPR 94

Query: 86  ADIVLGFDNNLIDLARKTGLFAKSNIDA-SQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQ 143
            D+  G DN L+  A   G+F    +    ++K     D +  V P D G +   YDK+ 
Sbjct: 95  GDVFFGVDNTLLSRALDNGIFTPYEVKGLGEVKPEYVLDKEHRVTPVDSGDICVNYDKQY 154

Query: 144 ITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIAT 198
                  PP+  D+L+       ++ ++  TS+ GLG LL     YG++     W K+  
Sbjct: 155 FADKKLAPPQTLDDLVKPEYKNLLVTENAATSSPGLGFLLASVGKYGEDGWKDYWSKLKA 214

Query: 199 KTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA---LF 246
               V  GW ++Y         G   KG+   V+SY++SP   +L YG+     A   + 
Sbjct: 215 NGVEVVDGWEQAYNERFSGSAGGKKAKGDRPLVVSYASSPPVEVL-YGEPQPAEAPTGVS 273

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQA 305
           +   + Q+E A  L  +K     +  + F++   FQ  +P   ++ PVV D  +P+++  
Sbjct: 274 TGTCFRQVEFAGLLKGAKNEAGGKALLDFLVGKKFQEDMPLQMFVNPVVKDAKLPELFTK 333

Query: 306 IRIP-QKSLRFNAEETTRYRNQWISSWQNAVSR 337
             +  +K      E   + R+QW+ SW   V +
Sbjct: 334 HGVVIEKPENVAPETIAKNRDQWVKSWSALVVK 366


>gi|182435650|ref|YP_001823369.1| putative ABC transporter substrate-binding protein [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|178464166|dbj|BAG18686.1| putative ABC transporter substrate-binding protein [Streptomyces
           griseus subsp. griseus NBRC 13350]
          Length = 391

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 144/329 (43%), Gaps = 32/329 (9%)

Query: 31  VLTVYTYNSF-VADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
            +T+ +++SF V+D     K+ +AF  +    ++++   D  A LN+  +   +   D+ 
Sbjct: 69  TVTLVSHDSFNVSD-----KVLKAFTEETGYTVEILKSGDAGAALNQEILTKGSPRGDVF 123

Query: 90  LGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIF--VPYDYGYLAFIYDKRQITQ- 146
            G DN L+  A   GLF            P    D+     P D G +   YDK+     
Sbjct: 124 FGVDNTLLSRALDNGLFTAYEAKGLDGVAPDTQTDEKHRVTPVDTGDICVNYDKKYFADK 183

Query: 147 ---PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTAT 202
              PPK F +L+       ++ ++  +S+ GLG LL      G++  +  WKK+      
Sbjct: 184 KLAPPKTFADLLKPAYKNLLVTENAASSSPGLGFLLGTIAAEGEDGYEAYWKKLKANGVK 243

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHY 251
           V  GW ++Y         G   K +   V+SY++SP   +L  +    +    + +   +
Sbjct: 244 VVDGWEQAYNEEFSGSAGGKKAKADRPLVVSYASSPPVEVLYADPQPKEAPTGVATGTCF 303

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVY----QAI 306
            Q E A  L  +K     +  + FMI  +FQ  +P   ++ PVV D ++P+++    + I
Sbjct: 304 RQTEYAGLLTGAKNEAGGKALLDFMIGKTFQEDMPLNMFVNPVVKDATLPELFTKFGEKI 363

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQNAV 335
             P        E+ T  R QWI SWQ+ V
Sbjct: 364 DTPPT---VAPEKITANREQWIQSWQSLV 389


>gi|318056587|ref|ZP_07975310.1| solute-binding transport system protein [Streptomyces sp. SA3_actG]
 gi|318075676|ref|ZP_07983008.1| solute-binding transport system protein [Streptomyces sp. SA3_actF]
          Length = 362

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 79/326 (24%), Positives = 142/326 (43%), Gaps = 25/326 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++SF A +     + + FE+K    LK++   D    +N+  +   +   D+  
Sbjct: 39  TVTLVSHDSFAASK----SVLKKFEQKTGYRLKVLKSGDAGQAVNQAVLTKGHPQGDVFF 94

Query: 91  GFDNNLIDLARKTGLF---AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKR----Q 143
           G DN L+  A   G+F       + A    L +        P D G +   YDK+    +
Sbjct: 95  GVDNTLLSRALDQGVFQPYEAKGLSAVPADLQLDGKQHRVTPIDTGDICVNYDKKYFEGK 154

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTAT 202
              PPK   +L +      ++ ++  TS+ GLG LL     YG+   Q  WKK+      
Sbjct: 155 KLDPPKTLADLADPAYKNLLVTENTATSSPGLGFLLGSIAQYGERGWQTYWKKLRANGVK 214

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHY 251
           V   W ++Y         G    G+   V+SY++SP   +L  +   +D    + +   +
Sbjct: 215 VVDSWEQAYNEEFSGSAGGRKAGGDRPLVVSYASSPPVEVLYADPRPEDAPTGVATGTCF 274

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQ 310
            Q E A  L  +  P+  +  + F++S +FQR +P   ++ PVV    +PD++       
Sbjct: 275 RQTEFAGLLDGAPNPEGGKALLDFLLSDTFQRDMPLQMFVNPVVKGTPLPDLFTRYGTKA 334

Query: 311 KSLRFNA-EETTRYRNQWISSWQNAV 335
              R  A ++   +R  WI++W + V
Sbjct: 335 DGARTVAPQKIAEHREDWINAWTSLV 360


>gi|309811970|ref|ZP_07705736.1| ABC transporter, substrate-binding protein, thiB family
           [Dermacoccus sp. Ellin185]
 gi|308434028|gb|EFP57894.1| ABC transporter, substrate-binding protein, thiB family
           [Dermacoccus sp. Ellin185]
          Length = 364

 Score = 99.0 bits (245), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 82/370 (22%), Positives = 154/370 (41%), Gaps = 40/370 (10%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDG-----------------LPAKPVLTVYTYNSFVAD 43
           M +  R V+ +  + G ++ C++D                    A   +T+ T+ S+  D
Sbjct: 2   MSRGGRAVLALACV-GALAACSVDNNSSGSKSSSAGGSGASGSGASKTVTLVTHESWAPD 60

Query: 44  EGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKT 103
           +     +   F ++    +K++   D   L NKL +   N   D+V G DN         
Sbjct: 61  K----NVMAEFTKQTGYTVKVVKSGDAGELANKLVLSKNNPLGDVVFGIDNTFASRVTTN 116

Query: 104 GLFAK-----SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDEL 154
            +        +   AS+ +LP         P D   +    D    T+     P +FD+L
Sbjct: 117 DVLEPYSPKGAPASASKYELPDGQGKGQLSPIDTASVCVNVDDAWFTKNHKTKPASFDDL 176

Query: 155 INSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTATVTKGWTESYGF 213
           +       ++     +S+ G+   L     YG +  +  WKK+      +T GW+++Y  
Sbjct: 177 VKPEYKNLMVAPGASSSSPGMAFFLATVGHYGQDGWEAYWKKLMANGLKLTSGWSDAYEV 236

Query: 214 FL----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
                 KG+   V+SY +SP F +   G     A L  +  +   E A  L  +K P  A
Sbjct: 237 DFTGSGKGKRPIVVSYDSSPAFTVDKAGTSTTSALL--DTCFRSTEYAGVLKGAKNPDGA 294

Query: 270 QEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQA-IRIPQKSLRFNAEETTRYRNQW 327
           +  + FM   SFQ+ LP + +++PV  ++ +P  + A  + P K +  +  +  + R++W
Sbjct: 295 KALIDFMNGASFQKSLPDSMYVFPVDSNVELPKAWAANAKQPTKPIEVSPADIDKNRSEW 354

Query: 328 ISSWQNAVSR 337
           ++ W++  S+
Sbjct: 355 LTKWKDVTSK 364


>gi|227495653|ref|ZP_03925969.1| ABC superfamily ATP binding cassette transporter
           periplasmic-binding protein [Actinomyces coleocanis DSM
           15436]
 gi|226830885|gb|EEH63268.1| ABC superfamily ATP binding cassette transporter
           periplasmic-binding protein [Actinomyces coleocanis DSM
           15436]
          Length = 353

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/319 (23%), Positives = 142/319 (44%), Gaps = 17/319 (5%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV  Y+S   ++     +K  FE++   +L +  +  G  L NKL +  +N   D+  
Sbjct: 40  TVTVLAYDSLEFED----DLKAEFEKETGFKLDIQQIGSGGELTNKLVLTKDNPLGDVAF 95

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDD-DIFVPYDYGYLAFIYD----KRQIT 145
           G DN     A K G+FA+   + S+ +   +  D    VP++   +    D    K +  
Sbjct: 96  GVDNISAYRAVKEGVFAEKAAEVSEAEKAQQISDAPALVPFNQSDVCVNADPAWFKAKNL 155

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
           + PK  D+L +      ++  +P +S+ GL   +     Y D     W  +      VTK
Sbjct: 156 EMPKTLDDLKDPKYKDLLVAMNPTSSSPGLAFFMATVAKYEDGWKDYWMALKDNGLKVTK 215

Query: 206 GWTESYGFFL-----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
           GW++++G        KG+   ++SYS+SP  Y +N    +   A   E  + Q+E    L
Sbjct: 216 GWSDAFGTDFSAGEGKGDRPLMVSYSSSPA-YAVNEALTESAIANLPETCFHQVEYVGVL 274

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQAI-RIPQKSLRFNAE 318
             +K    A+ F++FM   S Q +    N+++P+  D+ +P+       + +K    +  
Sbjct: 275 NGAKNVAGAEAFVKFMQKASTQEVFVANNYVHPINPDVKLPEALARFGMLSEKPFTLDPM 334

Query: 319 ETTRYRNQWISSWQNAVSR 337
           +    + QW++ W   +++
Sbjct: 335 KIDENQAQWLAEWSELIAK 353


>gi|257387980|ref|YP_003177753.1| ABC transporter periplasmic protein [Halomicrobium mukohataei DSM
           12286]
 gi|257170287|gb|ACV48046.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Halomicrobium mukohataei DSM 12286]
          Length = 388

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/323 (26%), Positives = 144/323 (44%), Gaps = 23/323 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAADIV 89
            L+V TY+SFV ++ AG  +K  FE +  +  ++     +G+    + + EG    AD+ 
Sbjct: 70  TLSVATYSSFVGEDTAGNWLKSEFESEHPDVTVEFETPENGLNQYIQRKSEGAPIDADLF 129

Query: 90  LGFDNNLI---DLARKTGLFAKSNI---DASQLKLPIKWD-DDIFVPYDYGYLAFIYDKR 142
           +G +   +   D      LFA ++     A  +K  +++D D   VPYD GY++ +YD+ 
Sbjct: 130 VGLNTGELVRADEQLDEALFATASDRIEGADTVKPELQFDPDGRVVPYDTGYISLVYDEG 189

Query: 143 QITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG---DNSAQVWKKIATK 199
           ++   P  FD L+       +I Q+ + S  G   LLW   IY    D     W+ +   
Sbjct: 190 EV-DAPGTFDALLEPAYEDALIAQNAQQSDPGRAFLLWT--IYNKDPDGYLDYWEGLVDN 246

Query: 200 TATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQ----DDYVAALFSEGHYLQIE 255
             T+   W  +Y  +   E+  V+SYST   FY   +G+      +     ++  Y   E
Sbjct: 247 GVTILSDWEPAYNAYSDEEAPMVVSYSTDQVFY---HGEGVDMSRHQIGFLNDQGYANPE 303

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP--DVYQAIRIPQKSL 313
             AQ   S   +LA+ F  F ++   QR + T N  +P V+   P  D  +    P + +
Sbjct: 304 GMAQFADSDDAELARAFASFALTAPAQREIATRNVQFPAVEGVDPGGDFGEYALEPPEPV 363

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            F  +E +   + WI  W   ++
Sbjct: 364 TFTYDELSGNVSGWIDEWARQIA 386


>gi|159896794|ref|YP_001543041.1| ABC transporter periplasmic-binding protein [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159889833|gb|ABX02913.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 386

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 143/333 (42%), Gaps = 30/333 (9%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
           A   L V +++SF        ++   FE+     ++++   D    LNK  +       D
Sbjct: 61  AGQTLVVVSHDSFAISS----EVISGFEQMTGATVQILESGDAGEALNKSILAKGAPLGD 116

Query: 88  IVLGFDNNLIDLARKTGLF---AKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQ 143
           ++ G DN  +  A    +F   A  N++  Q+   +K D    V P D GY+   YDK  
Sbjct: 117 VLYGVDNTFLSRALDADIFEAYAAKNLE--QIPAELKLDSQNRVSPVDVGYVTINYDKAA 174

Query: 144 ITQP----PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK---- 195
           + +     P +  +L       K++ ++P TS+ GL  +L     +G++S   W+     
Sbjct: 175 LAEAGLSLPTDLRDLTKPEWKGKLVVENPATSSPGLSFMLATIAHFGESSDYTWRNFWSD 234

Query: 196 IATKTATVTKGWTESYGFFLKGESD----FVLSYSTSPGFYLLNYGQDDYVAA-----LF 246
           +      V  GW E+Y     G SD     V+SY+TSP   ++ +       A     L 
Sbjct: 235 LRANEIKVASGWEEAYYGDFSGASDGQYPLVVSYATSPAAEVI-FATTPLTDAPTGNLLL 293

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMP-DVYQ 304
             G + QIE    L  +K P+L + ++ +M+S +FQ  +    ++YP +    +P +  Q
Sbjct: 294 PGGAFQQIEFVGLLKDAKNPELGKAWIDYMLSDTFQSDIGGQMFVYPALPSAKVPAEFTQ 353

Query: 305 AIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
             ++P         E    R +W++ WQ  V R
Sbjct: 354 YAQVPSNVTTLAPAEIAANRERWLNEWQETVLR 386


>gi|218961385|ref|YP_001741160.1| hypothetical protein CLOAM1091 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730042|emb|CAO80954.1| hypothetical protein CLOAM1091 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 351

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 138/326 (42%), Gaps = 28/326 (8%)

Query: 24  DGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGEN 83
           + L  K  L VY  + F    G    I   F++K NC+L++I   +   L   ++     
Sbjct: 26  ESLTYKHKLVVYATDEF-RKSGLEHSIIPDFQKKHNCQLEVILFRNTAELSKAVKNRDNY 84

Query: 84  SAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDI------------FVPYD 131
              D+ +G DN+          FA S   A     P  +D ++            F+PY 
Sbjct: 85  GKYDLAIGIDNS----------FAFSETLAVNFVPPESFDKELLIQETVFDPYLRFIPYA 134

Query: 132 YGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-A 190
           Y  L+ +Y+   +  PP++F EL ++    +I   DP+TS LG  +L W   ++G     
Sbjct: 135 YSNLSLVYNTSLVKNPPQSFGELQDAKYLSQIAICDPQTSGLGRSMLFWSVALFGTQGYE 194

Query: 191 QVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYL-LNYGQDDYVAALFSEG 249
            +WK +          + E+     +GE  F++ Y+T+P F   L+    ++  ++  EG
Sbjct: 195 HLWKSLRKNIYKTYSNYNEALETLKRGECSFIIGYNTTPAFLQELDPLNRNFEVSMLKEG 254

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS-MPDVYQAIRI 308
            +  IE       +K+  L  +F+ + +S   Q+++     M+P    + +P  + AI  
Sbjct: 255 SFQYIEAIGIHRGTKKSSLCNKFVDYFLSSEAQKMVIYKLGMFPANRKTLLPMHFSAIPF 314

Query: 309 PQKSL--RFNAEETTRYRNQWISSWQ 332
              S+  R +        N W+  W+
Sbjct: 315 ISYSVNDRLSQATIQEQINAWLDFWE 340


>gi|289580144|ref|YP_003478610.1| ABC transporter periplasmic protein [Natrialba magadii ATCC 43099]
 gi|289529697|gb|ADD04048.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Natrialba magadii ATCC 43099]
          Length = 387

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 154/337 (45%), Gaps = 31/337 (9%)

Query: 22  TLDGLPAKP----VLTVYTYNSFVADE-GAGPKIKQAFERKC-NCELKLIGLSD-GVALL 74
           T D  P  P     L V +Y S + +E  AGP +K+AFE +  + EL+   L D G+   
Sbjct: 48  TPDPEPENPDLEGTLEVVSYESMIDEETAAGPWLKEAFESEFPDAELEWTLLPDQGINYY 107

Query: 75  NKLRMEGENSAADIVLGFDNNLIDLAR------KTGLFAKSNID----ASQLKLPIKWDD 124
                +GE+  AD+ LG   N+ DL        + GLF + N D    + +++  +   D
Sbjct: 108 INSAEQGESIDADVYLGL--NIDDLVSVDDNLAEGGLFRELNTDRIERSGRIRDGLDMGD 165

Query: 125 --DIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
             D  + YD GY++ +YD+ ++ +P + F++L+ S     ++ Q+ +TS  G   LLW  
Sbjct: 166 PHDRVLAYDTGYISLVYDETEVDEP-QTFEDLLESEYEESLLAQNAQTSDPGQAFLLWTI 224

Query: 183 KIYG-DNSAQVWKKIATKTATVTKGWTESY-GFFLKGESDFVLSYSTSPGFYLLNYGQD- 239
             +G D     W  +      V   W +SY G ++  E   V+SYST   F   + G D 
Sbjct: 225 DAFGEDGYLDYWADLEDNGVRVLDSWNDSYNGAYMNEERPMVVSYSTDQVFASAS-GHDL 283

Query: 240 -DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD-- 296
             +     ++  Y   E  A    + Q  LA  F+ F++S S Q  +   N  +P V+  
Sbjct: 284 SRHQVGFLNDQGYANPEGMAIFEDATQVDLAYAFLDFVLSNSAQAEIAERNVQFPAVEDE 343

Query: 297 -ISMPDVY-QAIRIPQKSLRFNAEETTRYRNQWISSW 331
            + + D + +   +P +++    ++     + W+  W
Sbjct: 344 HVDLDDEFDEYAHVPPEAVTIGYDDLRGNLDGWVDDW 380


>gi|72159737|gb|AAZ66751.1| periplasmic protein [Halobacterium sp. AS7092]
          Length = 359

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 91/350 (26%), Positives = 152/350 (43%), Gaps = 32/350 (9%)

Query: 8   VVGIMMITGVISYCTLDGLPAK---PVLTVYTYNSFVADEG--AGPKIKQAFERK-CNCE 61
            VG   + GV    T D  P       L + TY S V +EG  AG  +K+AFE +    E
Sbjct: 9   AVGGSTVAGVAGCLTRDSTPGGGDGDALRIATYPSMV-EEGDPAGVWLKEAFESEYPEAE 67

Query: 62  LKLIGLSDGV-ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK-----------S 109
           +      +G+   + + R +  +  AD+  G   N+ +L R    F              
Sbjct: 68  ISWTVPENGINTYIERARQDAVD--ADVYFGL--NVDELVRVDDSFDGQLFRSLERDRIE 123

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
            +D  +  L     +D  +PYD GY++ +YD+  +  PP++ D L+++     +I Q+ +
Sbjct: 124 GVDRLRDDLTFGDPNDRVLPYDTGYISLVYDE-SVLAPPESLDALLDTEYEDTLITQNAQ 182

Query: 170 TSTLGLGLLLWIQKIYG-DNSAQVWKKIATKTATVTKGWTESY-GFFLKGESDFVLSYST 227
           +S  GL  LLW    YG D   + W+ +      +  GW+ESY G + + E   ++SYST
Sbjct: 183 SSDPGLAFLLWTIAEYGADGYLEYWRALRDNGVQILDGWSESYFGSYAEEERPMIVSYST 242

Query: 228 SPGFYLLNYGQD--DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRIL 285
              F+      D   +  A  +E  Y   E  A    S +  LA +FM F++S   Q  +
Sbjct: 243 DQVFHATGDEPDLTRHQIAFPNEQGYENPEGMAIFADSDKADLAADFMAFVLSSEAQAEI 302

Query: 286 PTTNWMYPVV---DISMPDVY-QAIRIPQKSLRFNAEETTRYRNQWISSW 331
              N  +P V    + + + + Q    P + + F  ++     + WI  W
Sbjct: 303 ARRNVQFPAVADDHVELDESFAQYAHAPAEPVAFTYDDLRGNLDGWIEDW 352


>gi|300710008|ref|YP_003735822.1| thiamine-binding periplasmic protein precursor-like protein
           [Halalkalicoccus jeotgali B3]
 gi|299123691|gb|ADJ14030.1| thiamine-binding periplasmic protein precursor-like protein
           [Halalkalicoccus jeotgali B3]
          Length = 355

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 144/349 (41%), Gaps = 26/349 (7%)

Query: 12  MMITGVISYCTLDGLPAKPV---------LTVYTYNSFV--ADEGAGPKIKQAFERKCNC 60
            + +G      L G  A PV         L V TY SFV    +  G  IK+ F+ + + 
Sbjct: 6   FLGSGAAVTACLAGCSANPVDSDESDDGTLAVATYGSFVDAPSDSPGAWIKEEFDARHDA 65

Query: 61  ELKLIGLSDGVALLNKLRMEGENSAADIVLGFD-NNLIDLARKTGLFAKSNIDASQLKLP 119
            L+      G+    +          D+ LGF  + L+ + R T        D S+ +  
Sbjct: 66  TLEWHTPDQGINYYIERHNSDVEIEPDLYLGFGPHELVRVDRNTDGELFGQWDESRFEHL 125

Query: 120 IKWDDDIF-------VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTST 172
              D+  +       +P D  Y A +YD R + +P +  ++L++     +I   +P+ +T
Sbjct: 126 ADVDEQFYFDPQDRTIPVDSSYCALVYDGRTVPEP-ETLEDLLDPAYEGRIALANPQGAT 184

Query: 173 LGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGF 231
            GL  LLW    +G+    + W+ +      +   W + Y  F +GE+  ++SYS     
Sbjct: 185 TGLLFLLWTIDEFGEEGYLEYWQGLLENDVRILDSWADVYTQFEEGEAPVIVSYSND-RV 243

Query: 232 YLLNYGQD--DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTN 289
           Y    G D   +  A+ +   Y  IE  A+         A +F  F++SP  Q ++   N
Sbjct: 244 YAKRAGSDLEKHRVAMPNGEAYASIEGMARFAEGTNDGPAHQFADFVLSPEVQAVIAERN 303

Query: 290 WMYPV-VDISMPDVYQAI-RIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
              PV  + + P+VY+   R P + + F  +        WI  W +AV+
Sbjct: 304 VTGPVNTEATPPEVYREFAREPDEPVFFGYDALAEGLPGWIEDWSDAVA 352


>gi|284165787|ref|YP_003404066.1| ABC transporter periplasmic-binding protein [Haloterrigena
           turkmenica DSM 5511]
 gi|284015442|gb|ADB61393.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Haloterrigena turkmenica DSM 5511]
          Length = 370

 Score = 95.9 bits (237), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 145/326 (44%), Gaps = 32/326 (9%)

Query: 31  VLTVYTYNSFV-ADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA---A 86
            LTV TY S +  ++ AGP +K+AFE + + EL+   L DG   +N      +  A   A
Sbjct: 45  TLTVVTYESMIDTEDSAGPWLKEAFEDEFDAELEWEQLPDGG--INHYIQRADRDAGIDA 102

Query: 87  DIVLGFDNNLIDLAR------KTGLFAKSNIDASQLKLPIKWDDDIFV--------PYDY 132
           D+ LG   N+ DL R         LF +  +D  +L+   +  D+  +         YD 
Sbjct: 103 DVYLGL--NVDDLVRVDDQLEDGALFRE--LDRDRLERADRVRDEFALGDPHGRTLTYDM 158

Query: 133 GYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG-DNSAQ 191
           GY++ +YD+ ++ +P  + ++L        ++ Q+ + +  G   LLW    +G D    
Sbjct: 159 GYISLVYDENEVAEPA-SLEDLTEPEYENTLLAQNAQKADSGQAFLLWTIDAFGEDGYLD 217

Query: 192 VWKKIATKTATVTKGWTESY-GFFLKGESDFVLSYSTSPGFY-LLNYGQDDYVAALFSEG 249
            W+++      V  GWTESY G +++GE   V+SYST   +    +Y    +  A  +E 
Sbjct: 218 YWQRLEDNGVRVLDGWTESYSGAYMEGERPMVVSYSTDQVYTNRFDYDFSRHQVAFPNEQ 277

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAI--- 306
            Y   E  A    +    LA +F  F++S   Q  + T N  +P V     D+ +     
Sbjct: 278 GYANPEGMAIFEDAGDVDLAYDFFDFVLSSEAQAEIATRNVQFPAVADEHVDLDEEFDEY 337

Query: 307 -RIPQKSLRFNAEETTRYRNQWISSW 331
              P + + F+ +      + W+  W
Sbjct: 338 AHRPSEMVSFDYDGLRGNLDGWVEDW 363


>gi|297191768|ref|ZP_06909166.1| ABC transporter substrate-binding protein [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197721714|gb|EDY65622.1| ABC transporter substrate-binding protein [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 366

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/335 (23%), Positives = 143/335 (42%), Gaps = 27/335 (8%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
           G      +T+ +++SF A +     + + F  +    +K++   D    LNK  +   + 
Sbjct: 37  GASGPKTVTLVSHDSFAASDA----VLKEFTARTGYTVKVLKSGDAGTALNKEILTKGSP 92

Query: 85  AADIVLGFDNNLIDLARKTGLFA---KSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDK 141
             D+  G DN L+  A    LF       +D    ++ +        P D G +   YDK
Sbjct: 93  QGDVFFGVDNTLLSRALDNDLFTPYEAKGLDQVAQEVQLDAGKHRVTPVDTGDICVNYDK 152

Query: 142 R----QITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKI 196
           +    +   PP+ F +L        ++ ++  TS+ GLG LL     YG++  Q  W K+
Sbjct: 153 KFFADKKLAPPRTFADLAKPEYKNMLVVENAATSSPGLGFLLGTIGEYGESGWQGYWNKL 212

Query: 197 ATKTATVTKGWTESYGFFLKGESD---------FVLSYSTSPGFYLLNYGQDDYVAA--- 244
                 V  GW ++Y     G +           V+SY++SP   +L Y +     A   
Sbjct: 213 KDNGVKVVDGWEQAYNEEFSGSAGGKKAGADRPLVVSYASSPPVEVL-YSEPQPAQAPTG 271

Query: 245 LFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVY 303
           + +   + QIE A  L  +K     +  + F+IS  FQ  +P   ++ PVV D  +P+++
Sbjct: 272 VATGTCFRQIEFAGLLTGAKNEAGGKALLDFLISKKFQEDMPLNMFVNPVVEDAKLPELF 331

Query: 304 -QAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +   + +K     A+   + R QW+ SW + V +
Sbjct: 332 TKHGAVVEKPETVAADTIAKNREQWVRSWSSLVVK 366


>gi|302522181|ref|ZP_07274523.1| ABC transporter substrate-binding protein [Streptomyces sp. SPB78]
 gi|302431076|gb|EFL02892.1| ABC transporter substrate-binding protein [Streptomyces sp. SPB78]
          Length = 362

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 141/326 (43%), Gaps = 25/326 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++SF A +     + + F +K    LK++   D    +N+  +   +   D+  
Sbjct: 39  TVTLVSHDSFAASK----SVLKKFGQKTGYRLKVLKSGDAGQAVNQAVLTKGHPQGDVFF 94

Query: 91  GFDNNLIDLARKTGLF---AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKR----Q 143
           G DN L+  A   G+F       + A    + +        P D G +   YDK+    +
Sbjct: 95  GVDNTLLSRALDQGVFQPYEARGLSAVPAGIQLDGKRHRVTPIDTGDICVNYDKKYFEGK 154

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTAT 202
              PPK   +L +      ++ ++  TS+ GLG LL     YG+   Q  WKK+      
Sbjct: 155 KLDPPKTLADLADPAYKNLLVTENTATSSPGLGFLLGSVAQYGERGWQTYWKKLRANGVK 214

Query: 203 VTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAALFSEGHY 251
           V   W ++Y         G    G+   V+SY++SP   +L  +   +D    + +   +
Sbjct: 215 VVDSWEQAYNEEFSGSAGGRKAGGDRPLVVSYASSPPVEVLYADPRPEDAPTGVATGTCF 274

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVYQAIRIPQ 310
            Q E A  L  +  P+  +  + F++S +FQR +P   ++ PVV    +PD++       
Sbjct: 275 RQTEFAGLLDGAPNPEGGKALLDFLLSDTFQRDMPLQMFVNPVVKGTPLPDLFTRYGAEA 334

Query: 311 KSLRFNA-EETTRYRNQWISSWQNAV 335
              R  A ++   +R  WI++W + V
Sbjct: 335 DGARTVAPQKIAEHREDWINAWTSLV 360


>gi|239944639|ref|ZP_04696576.1| putative ABC transporter substrate-binding protein [Streptomyces
           roseosporus NRRL 15998]
 gi|239991103|ref|ZP_04711767.1| putative ABC transporter substrate-binding protein [Streptomyces
           roseosporus NRRL 11379]
          Length = 365

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 142/334 (42%), Gaps = 42/334 (12%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++SF   E     + +AF ++    +K +   D  A LN+  +   +   D+  
Sbjct: 43  TVTLVSHDSFNVSE----DVLKAFTKETGYTVKTLKSGDAGAALNQEILTKGSPRGDVFF 98

Query: 91  GFDNNLIDLARKTGLFA------------KSNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           G DN L+  A   GLF              +  D      P+    DI V YD  Y A  
Sbjct: 99  GVDNTLLSRALDNGLFTAYEAKGLDRVAPDTQTDEKHRVTPVDT-SDICVNYDKKYFA-- 155

Query: 139 YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIA 197
            DK+    PP+ F +L+       ++ +   +S+ GLG LL      G++  +  WKK+ 
Sbjct: 156 -DKK--LAPPQTFADLLKPAYKDLLVTEHAASSSPGLGFLLGTIAAEGEDGYEAYWKKLK 212

Query: 198 TKTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAALF 246
                V  GW ++Y         G   K +   V+SY++SP   +L  +    +    + 
Sbjct: 213 ANGVKVVDGWEQAYNEEFSGSAGGKKAKADRPLVVSYASSPPVEVLYADPQPKEAPTGVA 272

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVY-- 303
           +   + Q E A  L  +K     +  + FMIS +FQ  +P   ++ PVV D  +P+++  
Sbjct: 273 TGTCFRQTEYAGLLTGAKNEAGGKALLDFMISKTFQEDMPLNMFVNPVVTDAELPELFTK 332

Query: 304 --QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
             + +  P        E+    R QWI SWQ+ V
Sbjct: 333 HGEKVDTPP---TVAPEKIAANREQWIKSWQSLV 363


>gi|257051475|ref|YP_003129308.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Halorhabdus utahensis DSM 12940]
 gi|256690238|gb|ACV10575.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Halorhabdus utahensis DSM 12940]
          Length = 388

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 138/311 (44%), Gaps = 15/311 (4%)

Query: 34  VYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAADIVLGF 92
           V TY+SF  ++ AG  +K AFE +  +  ++     +G+      + EG    AD+ +G 
Sbjct: 74  VATYSSFTGEDTAGNWLKSAFEAEYPDKTVEFTTPENGLNQYILRQQEGAGIDADLYVGL 133

Query: 93  DNNLI---DLARKTGLFAKSNID---ASQLKLPIKWD-DDIFVPYDYGYLAFIYDKRQIT 145
           + + +   D      LF     D   A  +K  ++ D D   + YD GY++ +Y+  ++ 
Sbjct: 134 NTSELVRADQEIDGSLFQTVQDDLARAGNVKSGLEIDPDGRAITYDTGYISLVYNGNEV- 192

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW-IQKIYGDNSAQVWKKIATKTATVT 204
           Q P  FD L +      +I Q+ + S  G   LLW I +   D   + W+ +     T+ 
Sbjct: 193 QNPATFDALTSDQYQGDLIVQNAQQSDPGRAFLLWTIAQKGTDGYLEYWQDLVDNDVTIL 252

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD--DYVAALFSEGHYLQIEVAAQLVR 262
             W  +Y  ++  E+  V+SYST   +Y    G D   +     ++  Y   E  A    
Sbjct: 253 SDWEPAYQAYMNDEAPMVVSYSTDQVYY-HGEGVDIQKHQVGFLNDQGYANPEAMALFDD 311

Query: 263 SKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP--DVYQAIRIPQKSLRFNAEET 320
           +  P+L +EFM F++SP  Q  +   N  +P V+   P  +  Q    P + + F+ +E 
Sbjct: 312 ADAPELGREFMDFVLSPKAQSEIAVRNVQFPAVEGVDPGEEFSQYAYEPPEPVTFSYDEL 371

Query: 321 TRYRNQWISSW 331
           +     WI  W
Sbjct: 372 SGNVEGWIEDW 382


>gi|291448103|ref|ZP_06587493.1| solute binding lipoprotein [Streptomyces roseosporus NRRL 15998]
 gi|291351050|gb|EFE77954.1| solute binding lipoprotein [Streptomyces roseosporus NRRL 15998]
          Length = 373

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 142/334 (42%), Gaps = 42/334 (12%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ +++SF   E     + +AF ++    +K +   D  A LN+  +   +   D+  
Sbjct: 51  TVTLVSHDSFNVSE----DVLKAFTKETGYTVKTLKSGDAGAALNQEILTKGSPRGDVFF 106

Query: 91  GFDNNLIDLARKTGLFA------------KSNIDASQLKLPIKWDDDIFVPYDYGYLAFI 138
           G DN L+  A   GLF              +  D      P+    DI V YD  Y A  
Sbjct: 107 GVDNTLLSRALDNGLFTAYEAKGLDRVAPDTQTDEKHRVTPVDT-SDICVNYDKKYFA-- 163

Query: 139 YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIA 197
            DK+    PP+ F +L+       ++ +   +S+ GLG LL      G++  +  WKK+ 
Sbjct: 164 -DKK--LAPPQTFADLLKPAYKDLLVTEHAASSSPGLGFLLGTIAAEGEDGYEAYWKKLK 220

Query: 198 TKTATVTKGWTESY---------GFFLKGESDFVLSYSTSPGFYLL--NYGQDDYVAALF 246
                V  GW ++Y         G   K +   V+SY++SP   +L  +    +    + 
Sbjct: 221 ANGVKVVDGWEQAYNEEFSGSAGGKKAKADRPLVVSYASSPPVEVLYADPQPKEAPTGVA 280

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPDVY-- 303
           +   + Q E A  L  +K     +  + FMIS +FQ  +P   ++ PVV D  +P+++  
Sbjct: 281 TGTCFRQTEYAGLLTGAKNEAGGKALLDFMISKTFQEDMPLNMFVNPVVTDAELPELFTK 340

Query: 304 --QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
             + +  P        E+    R QWI SWQ+ V
Sbjct: 341 HGEKVDTPP---TVAPEKIAANREQWIKSWQSLV 371


>gi|307330071|ref|ZP_07609222.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces violaceusniger Tu 4113]
 gi|306884332|gb|EFN15367.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Streptomyces violaceusniger Tu 4113]
          Length = 357

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/352 (21%), Positives = 148/352 (42%), Gaps = 29/352 (8%)

Query: 4   FARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
           F  + +G ++  G  S    D       +T+ T++SF A +     + + F ++   +++
Sbjct: 14  FGSLALGALVGCGEDSKSGAD----SKTVTLVTHDSFAASKA----VLKEFTKETGYKVR 65

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA---KSNIDASQLKLPI 120
           +    D  A +N+  +   +   D+  G DN L+  A    LF       +D     L +
Sbjct: 66  VQAGGDAGAAVNQAILSKGHPQGDVFFGVDNTLLSRALDNDLFTPYTAKGLDKVPAALQL 125

Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLG 176
              +    P D+G +   YD++        PP+  D+L        ++ ++  TS+ GLG
Sbjct: 126 DRAEHRVTPVDFGDICVNYDRKYFADKKLAPPRTLDDLTKPAYKNLLVTENAATSSPGLG 185

Query: 177 LLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESY-------GFFLKGESDFVLSYSTS 228
            LL     YGD+     WKK+      V  GW ++Y           KG+   V+SY++S
Sbjct: 186 FLLATAAKYGDDGWKGYWKKLRANGVEVVDGWEQAYYDRFSGSAGGGKGDRPLVVSYASS 245

Query: 229 PGFYLLNYGQDDYVA--ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILP 286
           P   + +       A   + +   + Q+E A  L  +   +  +  + F++S  FQ  +P
Sbjct: 246 PPAEVADAKTKPAKAPTGVATGTCFRQVEFAGLLNGAGNTKGGKALLDFLLSKRFQEDVP 305

Query: 287 TTNWMYPV-VDISMPDVYQ--AIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
              ++ P   D  +P+++    +RI   S     ++  + R  W+ +W + V
Sbjct: 306 LNMYVNPAREDAKLPELFTRYGVRIAD-SATLAPQKIAKNREPWVKTWSSLV 356


>gi|297156854|gb|ADI06566.1| putative solute-binding transport system protein [Streptomyces
           bingchenggensis BCW-1]
          Length = 359

 Score = 93.2 bits (230), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/325 (21%), Positives = 142/325 (43%), Gaps = 25/325 (7%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            + + +++SF A +     + + F R+   +++++   D  A +N+  +   +   D+  
Sbjct: 39  TVKLVSHDSFAASKA----VLKEFTRQTGYKVQVLPGGDAGAAVNQAILSKSHPQGDVFF 94

Query: 91  GFDNNLIDLARKTGLFA---KSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ- 146
           G DN L+  A    LF       +D     L +   +    P D+G +   YD++     
Sbjct: 95  GVDNTLLSRALDNDLFTPYQAKGLDKVPAALQLDAAEHRVTPVDFGDICVNYDRKYFADK 154

Query: 147 ---PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ-VWKKIATKTAT 202
              PPK  D+L        ++ ++  TS+ GL  LL     YGD+  Q  WKK+      
Sbjct: 155 KLAPPKTLDDLTKPAYKNLLVTENAATSSPGLAFLLGTAARYGDDGWQGYWKKLRANGVE 214

Query: 203 VTKGWTESY-------GFFLKGESDFVLSYSTSPGFYLLNYG--QDDYVAALFSEGHYLQ 253
           V  GW ++Y           KG+   V+SY++SP   +++     +     + +   + Q
Sbjct: 215 VVDGWEQAYYDRFSGSAGGAKGDRPLVVSYASSPPAEVVDAKPRPEQAPTGVATGTCFRQ 274

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQ--AIRIPQ 310
           +E A  L  +   +  +  + F+++  FQ  +P   ++ P   D  +P+++    ++I  
Sbjct: 275 VEFAGLLKGASNTKGGKALLDFLLTKRFQEDVPLNMYVNPAREDAKLPELFAKYGVKIAD 334

Query: 311 KSLRFNAEETTRYRNQWISSWQNAV 335
            S   +  +  + R+QW+ +W + V
Sbjct: 335 -SATLDPRKIAKNRDQWVKAWSSLV 358


>gi|302542186|ref|ZP_07294528.1| ABC transporter, periplasmic substrate-binding protein
           [Streptomyces hygroscopicus ATCC 53653]
 gi|302459804|gb|EFL22897.1| ABC transporter, periplasmic substrate-binding protein
           [Streptomyces himastatinicus ATCC 53653]
          Length = 357

 Score = 92.4 bits (228), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 151/353 (42%), Gaps = 47/353 (13%)

Query: 15  TGVISYC---TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGV 71
           TGV+S C     DG  +K V T+ +++SF A +     + + F RK   ++++    D  
Sbjct: 19  TGVLSGCGGGAADGKDSKTV-TLVSHDSFAASKA----VLKEFTRKTGYKVRVQAGGDAG 73

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQL-KLPIKWDDDI---- 126
           A +N+  +   +   D+  G DN L+  A    LF  +  +A  L K+P  +  D     
Sbjct: 74  AAVNQAILSKGHPQGDVFFGVDNTLLSRALDNDLF--TPYEAKGLDKVPAAFQLDRAKHR 131

Query: 127 FVPYDYGYLAFIYDK----RQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQ 182
             P DYG +   YD+    R+   PPK F +L        ++ ++  TS+ GL  LL   
Sbjct: 132 VTPVDYGDICVNYDRAYFERKKLAPPKTFADLTKPAYKNLLVTENAATSSPGLAFLLGTA 191

Query: 183 KIYGDNS-AQVWKKIATKTATVTKGWTESY-------GFFLKGESDFVLSYSTSPGFYLL 234
             YGD+     WKK+      V  GW ++Y           KG+   V+SY++SP   + 
Sbjct: 192 ARYGDHGWRDYWKKLRANGVEVVDGWEQAYYDHFSGSAGGAKGDKPLVVSYASSPPAEVA 251

Query: 235 NYGQDDYVAAL-FSEGH-YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMY 292
           +       A    ++G  + Q E A  L  +   +  +  + F+++  FQ  +P   ++ 
Sbjct: 252 DAKSKPAKAPTGVADGTCFRQTEFAGLLNGAGNTKGGKALLDFLLTKRFQEDVPLNMYVN 311

Query: 293 PVVDISMPDVYQAIRIPQKSLRFNAE----------ETTRYRNQWISSWQNAV 335
           P        V +  ++P+   R+  E          +  + R  W+ +W + V
Sbjct: 312 P--------VREGAKLPEVFTRYGTEVADPATLPPRKIAKNREPWVKAWSSLV 356


>gi|289581607|ref|YP_003480073.1| ABC transporter periplasmic protein [Natrialba magadii ATCC 43099]
 gi|289531160|gb|ADD05511.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Natrialba magadii ATCC 43099]
          Length = 383

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 125/272 (45%), Gaps = 25/272 (9%)

Query: 87  DIVLGFD-------NNLIDLARKTGLFAKSNID----ASQLKLPIKWDD--DIFVPYDYG 133
           D++LG         ++++D    T LF     D    A +++  + +DD  D  +P    
Sbjct: 112 DVILGLTASELALVDSVLDAHGDTRLFESLERDRLEHADRIQSDLAFDDPRDRVLPVGTS 171

Query: 134 YLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV- 192
           YL+ +YD+  +  PP+ FD+L++S     ++ QDPR S  G    LW    YG  S  + 
Sbjct: 172 YLSLVYDETVLESPPETFDDLLDSAYADTLLAQDPRVSNPGQAFFLWTVAEYGSGSGMLS 231

Query: 193 -WKKIATKTATVTKGWTESY-GFFLKGESDFVLSYSTSPGFYLLNYG--QDDYVAALFSE 248
            W+++      + + WT++Y   +L+GE   V+SYST            Q   VA L + 
Sbjct: 232 FWEELQANGVRIEERWTDAYRDAYLEGERPMVVSYSTDQVVAAATDRDMQRHQVAPLDNA 291

Query: 249 GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-----VDISMPDVY 303
           G Y   E AA    + + +LA EF+  ++S + Q  L T N  +P      VD+    + 
Sbjct: 292 G-YRSTEGAAIFADATRTELAYEFVDLLLSQTAQAELATRNAQFPAVSDEYVDLDATFLE 350

Query: 304 QAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
            A+  P +++    ++       W+ +W + +
Sbjct: 351 NAVE-PDETVTLTYDDLEGEFATWLETWDDEI 381


>gi|297519476|ref|ZP_06937862.1| thiamine transporter substrate binding subunit [Escherichia coli
           OP50]
          Length = 77

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 52/75 (69%)

Query: 263 SKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTR 322
           SKQP+LAQ+F+QFM+SP+FQ  +PT NWMYPV ++++P  ++ +  P  +L F   E   
Sbjct: 3   SKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVANVTLPAGFEKLTKPATTLEFTPAEVAA 62

Query: 323 YRNQWISSWQNAVSR 337
            R  WIS WQ AVSR
Sbjct: 63  QRQAWISEWQRAVSR 77


>gi|89902015|ref|YP_524486.1| ABC transporter periplasmic-binding protein [Rhodoferax
           ferrireducens T118]
 gi|89346752|gb|ABD70955.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Rhodoferax ferrireducens T118]
          Length = 340

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 133/320 (41%), Gaps = 25/320 (7%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L V  ++SF   +   P + Q FE +    L +I   D   +LNKL +      AD+V G
Sbjct: 28  LRVMVHSSFSLPK---PLLAQ-FEAQNGIRLAIIKGGDAGEMLNKLILTRAQPIADVVFG 83

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYD-----KRQITQ 146
            DN L+  A   G+   +    ++   P           DYG++   YD     KR I+ 
Sbjct: 84  IDNTLVGKALAAGVLEPALPQTAE--APDANLGAALAAVDYGFVTLNYDKAAVAKRGISL 141

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV-WKKIATKTATVTK 205
           P    D  + + K W ++  +P TS+ G   +L      G+  A   W ++      V K
Sbjct: 142 PKTLQDLTLPAYKNW-LVTPNPATSSTGYAFMLATISAMGEEPAFAWWAQMRGNGLKVVK 200

Query: 206 GWTESYGFFL---KGESDFVLSYSTSPG---FYLLNYGQDDYVAAL-FSEGHYLQIEVAA 258
           GW+E+Y       KG    V+SY+TSP    FY      +   A+L    G + Q+E   
Sbjct: 201 GWSEAYYTDFARNKGAYPLVVSYATSPAAEVFYSKEKTPESPTASLNLKGGVFRQVEGVG 260

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAE 318
            +    Q   A +F+ F+ S   Q  L T  WMYP V    P + + +R   +   F A 
Sbjct: 261 LVKGGGQRATALKFVDFLRSAPVQEALQTAMWMYP-VQAKTP-LAEVMRHAAEPTEFEAP 318

Query: 319 ETTRYRN---QWISSWQNAV 335
            T        QW++ W   V
Sbjct: 319 ATQVVAGKGAQWVARWTKVV 338


>gi|322368054|ref|ZP_08042623.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Haladaptatus paucihalophilus DX253]
 gi|320552070|gb|EFW93715.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Haladaptatus paucihalophilus DX253]
          Length = 372

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 145/323 (44%), Gaps = 20/323 (6%)

Query: 31  VLTVYTYNSFVADEGAGPK--IKQAFERK-CNCELKLIGLSDGVALLNKLRMEGENSAAD 87
            L V TY++ V    + P   +K+ FE++     L+     + V    + + +G    AD
Sbjct: 51  TLNVATYSALVDAPSSSPGAWLKKEFEKEYPKATLQWQTPENEVNYFIQRKAQGVGIDAD 110

Query: 88  IVLGFD-NNLIDLARKTG---LF---AKSNIDASQLKLPIKWD-DDIFVPYDYGYLAFIY 139
           + +G + + LI +  K G   LF   A S  +   +K  + +D  +  VPYD GY++ +Y
Sbjct: 111 VYVGLNVDQLITIDDKLGGKQLFTPIADSLSNYGHVKEGLTFDPKNRAVPYDTGYVSLVY 170

Query: 140 DKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW-IQKIYGDNSAQVWKKIAT 198
           D+ ++   P  FD L        ++ ++ + +  G   LLW I ++  DN    WK+++ 
Sbjct: 171 DETKV-DGPGTFDALTKPKFEGTLLTENAQQAATGRAFLLWTIHQMGEDNYLDYWKRLSN 229

Query: 199 KTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD---DYVAALFSEGHYLQIE 255
               +   W  +Y  F  GE   V+SYST    Y    G +     +  L  +G Y   E
Sbjct: 230 NDVQILGSWDAAYTAFSNGERPIVVSYSTDQ-VYAHRDGANLKKHQIGFLNGQG-YANPE 287

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP--DVYQAIRIPQKSL 313
             A+   +   +LA  F+ FM+S   Q  +PT N  +P  D + P  +  +  + P+K +
Sbjct: 288 GMAKFADTDNSKLADAFLDFMLSKKAQSKIPTLNVSFPATDWAEPGAEFEKYAKAPEKPV 347

Query: 314 RFNAEETTRYRNQWISSWQNAVS 336
            ++ ++       W+  W   ++
Sbjct: 348 TYSYDQLKGNVEGWVDEWARQIA 370


>gi|289706834|ref|ZP_06503177.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Micrococcus luteus SK58]
 gi|289556519|gb|EFD49867.1| ABC transporter periplasmic binding protein, ThiB family protein
           [Micrococcus luteus SK58]
          Length = 355

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 118/274 (43%), Gaps = 22/274 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ T++SF   +    ++ Q FE++    LK     D  +++N+L +  +    D V 
Sbjct: 46  TVTIMTHDSFNLPQ----ELVQKFEQESGYTLKTTAPGDAGSVVNQLMLAKDEPTVDGVY 101

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT----Q 146
           G +++      + G+ A             +  +D   P D G + F  D    T    +
Sbjct: 102 GVEDHSAHRLVREGVVAAYTPKDLPASAQDRMVEDRMTPVDQGQVCFNTDPAWFTAHDVE 161

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTK 205
            P + D+L +       +   P  S+ GL LL    + YGD+  Q W + +      V  
Sbjct: 162 APTSIDQLDDPEYAKLTVATSPVASSPGLALLAATTEKYGDDGWQDWWQGLMENGGKVAD 221

Query: 206 GWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            W+++Y     G   KG+   VLSYS+SP F             +  +    Q+E A  L
Sbjct: 222 SWSDAYNSDFSGGEGKGQFPVVLSYSSSPAFAPET--------EVIEDSCTPQVEYAGVL 273

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
             +K P+ AQ F+ F+++   Q  LP + +MYP+
Sbjct: 274 EGAKNPEGAQAFVDFLLTEEVQSALPESMYMYPI 307


>gi|239918423|ref|YP_002957981.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Micrococcus luteus NCTC 2665]
 gi|281415380|ref|ZP_06247122.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Micrococcus luteus NCTC 2665]
 gi|239839630|gb|ACS31427.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Micrococcus luteus NCTC 2665]
          Length = 355

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 68/274 (24%), Positives = 118/274 (43%), Gaps = 22/274 (8%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +T+ T++SF   +    ++ Q FE++    LK     D  +++N+L +  +    D V 
Sbjct: 46  TVTIMTHDSFNLPQ----ELVQKFEQESGYTLKTTAPGDAGSVVNQLLLAKDEPTVDGVY 101

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT----Q 146
           G +++      + G+ A             +  +D   P D G + F  D    T    +
Sbjct: 102 GVEDHSAHRLVREGVVAAYTPKDLPASAQDRMVEDRMTPVDQGQVCFNTDPAWFTDHDVE 161

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTK 205
            P + D+L +       +   P  S+ GL LL    + YGD+  Q W + +      V  
Sbjct: 162 APTSIDQLDDPEYAKLTVATSPVASSPGLALLAATTEKYGDDGWQDWWQGLMENGGKVAD 221

Query: 206 GWTESY-----GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQL 260
            W+++Y     G   KG+   VLSYS+SP F             +  +    Q+E A  L
Sbjct: 222 SWSDAYNSDFSGGEGKGQFPVVLSYSSSPAFAPET--------EVIEDSCTPQVEYAGVL 273

Query: 261 VRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
             +K P+ AQ F+ F+++   Q  LP + +MYP+
Sbjct: 274 EGAKNPEGAQAFVDFLLTEEVQSALPESMYMYPI 307


>gi|15790773|ref|NP_280597.1| thiamin-binding periplasmic protein-like protein [Halobacterium sp.
           NRC-1]
 gi|169236516|ref|YP_001689716.1| thiamine ABC transporter periplasmic substrate-binding protein
           [Halobacterium salinarum R1]
 gi|10581322|gb|AAG20077.1| thiamin-binding periplasmic protein precursor homolog
           [Halobacterium sp. NRC-1]
 gi|167727582|emb|CAP14370.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate thiamine) [Halobacterium salinarum
           R1]
          Length = 382

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 124/297 (41%), Gaps = 18/297 (6%)

Query: 46  AGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLAR---- 101
           AG  +K A + +   +   +   +GV    +   +G +  AD  +G      DLAR    
Sbjct: 78  AGNWVKDAVQSEYTVDFDWVVAENGVTEFMRRAQQGVDLGADGYVGV--TAADLARADRE 135

Query: 102 -KTGLFAKSNIDASQLKLPIK---WDD--DIFVPYDYGYLAFIYDKRQITQPPKNFDELI 155
               LFA  + DA      +    W D  D  +P    Y+  IYD+  +   P+    L 
Sbjct: 136 LSAPLFAAFDTDAVDNTDNVHDRFWIDGTDRMLPTGASYVTIIYDE-TVVDAPETLAALT 194

Query: 156 NSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGFF 214
                  I+  +P+ +  GL  +LW    +G++   + W+++A         W  +Y  +
Sbjct: 195 TDEYSDGILVPNPQNTATGLAFVLWTVDAFGEDGFLEYWRRLADNGLQTAGSWNATYSAY 254

Query: 215 LKGESDFVLSYSTSPGFYLLNYGQD--DYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEF 272
             GE+  V+SYST   +   +   D   +  A   +  Y  +    +   +  P L   F
Sbjct: 255 SGGEAPMVMSYSTDQVYASQDPDVDMARHQVAFPGDSAYTYVSGTTKFESATNPALVDTF 314

Query: 273 MQFMISPSFQRILPTTNWMYP-VVDISMP-DVYQAIRIPQKSLRFNAEETTRYRNQW 327
             FM+S   QRI+   N   P V + S+P ++ + + +P+  +  +AE   ++ ++W
Sbjct: 315 ASFMLSGDTQRIVAEKNVGIPTVTNASLPAELREYVHVPEAPISHSAETLRQHADEW 371


>gi|326381436|ref|ZP_08203130.1| ABC transporter periplasmic-binding protein, thiB subfamily
           [Gordonia neofelifaecis NRRL B-59395]
 gi|326199683|gb|EGD56863.1| ABC transporter periplasmic-binding protein, thiB subfamily
           [Gordonia neofelifaecis NRRL B-59395]
          Length = 345

 Score = 80.5 bits (197), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 78/331 (23%), Positives = 136/331 (41%), Gaps = 48/331 (14%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +T+ T++SF   +     +   FE++   +LK++   D   L   + +   +   D V G
Sbjct: 38  VTLLTHDSFELPQ----NLIDKFEQQTGTKLKIVRSGDAGQLSAVVSLTPGSPKGDAVFG 93

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIK-------WDDDI------FVPYDYGYLAFI 138
            DN           FA+  IDA  L+  +         D DI          D G +   
Sbjct: 94  IDNT----------FAERPIDAKALEPYVSPAAKNGAADYDIKDAPGQLTAVDRGDVCLN 143

Query: 139 -----YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW 193
                +DK  I  P K  ++L            DP TS+ G+G LL     +G+ +   W
Sbjct: 144 VDDAWFDKHGIEAPTK-LEQLTEPQYRDMSALLDPSTSSPGMGFLLSTIGRFGERADDYW 202

Query: 194 KKIATKTATVTKGWTESYGFFL-----KGESDFVLSYSTSPGFYLLNYGQDDYVAALFSE 248
           + +    A +  GW  +Y          G+   V+SY++SP       G    + + F++
Sbjct: 203 RGLVDNGAQIVTGWEVAYNQLFSAGAGHGDKPIVVSYASSPA---ATPGTSALLNSCFAQ 259

Query: 249 GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMP-DVYQAI 306
             Y+ +     L  +     A++ + FM++P  Q  LPT  ++YPV  D  +P D  Q  
Sbjct: 260 VEYIGV-----LRGAANTAGAKKLVDFMLTPEVQAALPTAMYVYPVQKDTPLPADWRQRA 314

Query: 307 RIPQKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +P  ++  + E    +R +W++ W+  V R
Sbjct: 315 PVPAWTVTMSPEYINAHREEWLNEWRATVKR 345


>gi|126458839|ref|YP_001055117.1| ABC transporter periplasmic-binding protein [Pyrobaculum
           calidifontis JCM 11548]
 gi|126248560|gb|ABO07651.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Pyrobaculum calidifontis JCM 11548]
          Length = 337

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 145/338 (42%), Gaps = 21/338 (6%)

Query: 7   IVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIG 66
           IVV ++    ++++  L  L   P   V    + ++D G    + + F  K       + 
Sbjct: 11  IVVAVL----IVAFLALQSLQQPPKRLVIVGPAGISDLGKA--LAKKFSEKYGVNATFVP 64

Query: 67  LSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDI 126
           L   V ++N+L    +N   D+ +G       +  + G+     +    +     WD   
Sbjct: 65  LGGAVEMVNELVRAKDNPPWDVAIGVPEFYYTVLIEQGVLYCPGLKVEGVPAEEFWDPHG 124

Query: 127 FV-PYDYGYLAFIYDKRQITQ----PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
            V P D  Y+  +Y++  + +    PP+  D+L+       I Y +P  S  GL +L WI
Sbjct: 125 CVYPLDKSYIGIVYNESALAKLGLPPPQTLDDLLKPEYKGLIAYPNPVQSGTGLAVLSWI 184

Query: 182 QKIYGDNSA-QVWKKIATKTATV--TKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQ 238
             + G+    +  K++A + A V    G+T       +G+    LS+ +    + ++ G 
Sbjct: 185 MSVKGEEEGWRFLKQLAGQIAKVGYPSGFTSLRNALKRGDVVIALSWYS----HAIDPGT 240

Query: 239 DDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDIS 298
               AA +S   +L  E  A L  +K   LA EF++F +S   Q ++   N+M PV   +
Sbjct: 241 PHMRAATYSA--FLYREGVAVLKNAKNRDLAVEFVKFALSKEGQDLVDPYNYMLPVRPDA 298

Query: 299 MPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           + +  + +  PQ  + +N    ++  ++W   WQ  ++
Sbjct: 299 VVENNKGLPQPQTVVVYNPALGSK-ADEWRLRWQREIA 335


>gi|289806410|ref|ZP_06537039.1| thiamine transporter substrate binding subunit [Salmonella
          enterica subsp. enterica serovar Typhi str. AG3]
          Length = 66

 Score = 79.0 bits (193), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 34/48 (70%), Positives = 40/48 (83%)

Query: 29 KPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNK 76
          KPVLTVYTY+SF AD G GP +K+AFE  CNCELKL+ L DGV+LLN+
Sbjct: 19 KPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNR 66


>gi|269954986|ref|YP_003324775.1| ABC transporter periplasmic binding protein, thiB subfamily
           [Xylanimonas cellulosilytica DSM 15894]
 gi|269303667|gb|ACZ29217.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Xylanimonas cellulosilytica DSM 15894]
          Length = 386

 Score = 79.0 bits (193), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/376 (21%), Positives = 146/376 (38%), Gaps = 66/376 (17%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAK-----PVLTVYTYNSFVADEGAGPKIKQAFER 56
           +  A +VVG++            G  A        +T+ T++S+   E    ++   FE 
Sbjct: 33  RAAAVVVVGLLPALAACGSGETPGADASEPAPSSTVTLVTHDSWAVSE----EVVAQFEA 88

Query: 57  KCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQL 116
           +    +K + + D   L N++ +  ++   D+V G DN           FA   +DA  L
Sbjct: 89  ESGFTVKQVPMGDAGTLANQVVLTKDSPLGDVVFGIDNT----------FASRVVDAGAL 138

Query: 117 K-----------LPIKWDDDIFVPYDYGYL-----AFIYDKRQITQPPKNFDELINSTKP 160
           +           +P+   D    P   G +     A  ++   I +P +  ++L      
Sbjct: 139 EPHTPAGLPASAVPLVLGDGALTPVTVGDVCVNTDAAWFEAEGIAEP-ETLEDLTEPEFQ 197

Query: 161 WKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV------WKKIATKTATVTKGWTESY--- 211
             ++  +P +S+ G+  LL     +GD+          W  +      +T  W+++Y   
Sbjct: 198 DLMVALNPASSSPGMAFLLATIGAFGDDGFGGEGWTGYWAALRANGLRITDSWSDAYYAE 257

Query: 212 --GFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLA 269
             G    G    V+SYSTSP F     G      AL     + Q+E A  L  +  P+ A
Sbjct: 258 FSGGGEGGTRPIVVSYSTSPAFTTTEDGSASTTRALLGT-CFRQVEYAGILAGAANPEGA 316

Query: 270 QEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFN----------AEE 319
           +  + F++S  FQ  +P   +MYP           +I +P++ LRF             +
Sbjct: 317 RALVDFLVSEPFQADVPGQMYMYP--------ADSSIELPEEWLRFAPLSDSPFDVPPAD 368

Query: 320 TTRYRNQWISSWQNAV 335
              +R  W+ +W  AV
Sbjct: 369 IAAHREAWLDAWTAAV 384


>gi|269217602|ref|ZP_06161456.1| ABC transporter, periplasmic substrate-binding protein,
           solute-binding family 1 [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269212537|gb|EEZ78877.1| ABC transporter, periplasmic substrate-binding protein,
           solute-binding family 1 [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 345

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 131/318 (41%), Gaps = 34/318 (10%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
            +TV T++SF   +    ++ + FE K   +L      D   + N+L +  ++   D V 
Sbjct: 40  TVTVLTHDSFNLPK----ELVKEFESKTGYKLVTTPAGD-AGVANQLVLTKKSPKYDAVY 94

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDD------DIFVPYDYGYLAFIYD---- 140
           G D+    +    GLF    +D +   LP    +          P D G +    D    
Sbjct: 95  GIDSYTAGIPAGEGLF----VDYASPALPQSAKEYEIKGVKGLTPVDRGDVCINVDHKWF 150

Query: 141 KRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT 200
           K +  + P   D+L        +   DP  ST G   L  ++ + G+++     ++A   
Sbjct: 151 KEKGVKEPTGVDDLAKPEYSKLLSIIDPNASTTGFAYLAGVRTVKGEDAKGYLSRMAAGG 210

Query: 201 ATVTKGWTESYGF-FLKGESD----FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIE 255
             V   WT +Y   F  GE       VLSY++SP F      +D     +       QIE
Sbjct: 211 VHVASDWTNAYNVDFSAGEGKGNYPLVLSYASSPAF-----AKD---TGVIESTCVRQIE 262

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV-VDISMPDVYQA-IRIPQKSL 313
            A  +  +   + A+ F+ FM+S   Q  +PT+ +MYPV   + +P  + A  ++ +  +
Sbjct: 263 YAGVVKGTDNEKGAKAFVDFMVSKKVQSAIPTSMYMYPVDSSVQLPAEWAAKAKLAKNPI 322

Query: 314 RFNAEETTRYRNQWISSW 331
             +  +    R++W+  W
Sbjct: 323 VPDPGKAAASRDKWLEDW 340


>gi|297570763|ref|YP_003696537.1| thiamine ABC transporter periplasmic protein [Arcanobacterium
           haemolyticum DSM 20595]
 gi|296931110|gb|ADH91918.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Arcanobacterium haemolyticum DSM 20595]
          Length = 356

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 107/259 (41%), Gaps = 25/259 (9%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA------ 107
           F +K   +++L+   +   L +K+ +       D+V+G   N +    + G+F       
Sbjct: 61  FTKKSGFKVELLNGEESGTLESKIILTKNKPVGDVVIGLTANNVAQVAEAGVFDSTVKVA 120

Query: 108 ------KSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPW 161
                 K  +  ++  + +   D  F  YD  Y      K +   PP   ++L+      
Sbjct: 121 GPAGADKYTVKGAEGAIAVDRSDACF-NYDIAYF-----KDKGLTPPAGLEDLVKPEYKN 174

Query: 162 KIIYQDPRTSTLGLGLLLWIQKIYGDNS-AQVWKKIATKTATVTKGWTESYGF-FLKGES 219
             + QDP  S  G  LL      +G+      WKK+      V   W ++Y   F  GE 
Sbjct: 175 LTVIQDPSKSDTGFALLASTISTFGEEGYVDYWKKLLANGTKVDASWKDAYQVDFTAGEG 234

Query: 220 D----FVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQF 275
                 V+SY++SP F+ +    D    A  + G Y  +E A  L  +K  + A++F+++
Sbjct: 235 KGAYPIVMSYASSP-FWTITKAGDSSTTANVAGGCYPVVEYAGVLKGAKNTEGAKKFLEW 293

Query: 276 MISPSFQRILPTTNWMYPV 294
           + SP  Q ++   N  YP+
Sbjct: 294 ISSPEMQTVIAKENVTYPI 312


>gi|145592336|ref|YP_001154338.1| ABC transporter periplasmic-binding protein [Pyrobaculum
           arsenaticum DSM 13514]
 gi|145284104|gb|ABP51686.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Pyrobaculum arsenaticum DSM 13514]
          Length = 338

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/298 (22%), Positives = 129/298 (43%), Gaps = 15/298 (5%)

Query: 47  GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF 106
           G  + + F  K       I L   V ++N+L    +N   D+ +G       +  + G+ 
Sbjct: 46  GQALAKKFSEKYGVNATFIPLGGAVEMVNELVRNKDNPPWDVAIGIPEFYYTVLVERGVL 105

Query: 107 AKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYD----KRQITQPPKNFDELINSTKPW 161
               +    +     WD +  V P D  Y+  +Y+    +R   +PP+  D+L+      
Sbjct: 106 HCPKLSVEGVPPEEFWDPNGCVYPLDKSYIGIVYNATALERLGLRPPETLDDLLRPEYKG 165

Query: 162 KIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATV--TKGWTESYGFFLKGE 218
            + Y +P  S  GL +L WI  + G+ +   + K+++ + A V    G+T       +G+
Sbjct: 166 LVTYPNPVQSGTGLAVLSWIMSVKGEEAGWTYLKQLSGQIAKVGYPSGFTALRSALKRGD 225

Query: 219 SDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMIS 278
               LS+ +    ++++ G     AA +S   +L  E  A L  +K   LA EF++F +S
Sbjct: 226 VVIALSWYS----HVIDPGTPHMRAATYSA--FLYREGVAVLKNAKNRDLAVEFVKFALS 279

Query: 279 PSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
              Q ++   N+M PV   ++      +  P+  + +N    ++  ++W   WQ  V+
Sbjct: 280 KEGQDLVDPYNYMLPVRADAVVKNNVGLPQPRSVVVYNPALGSK-ADEWRLRWQREVA 336


>gi|119873441|ref|YP_931448.1| ABC transporter periplasmic-binding protein [Pyrobaculum islandicum
           DSM 4184]
 gi|119674849|gb|ABL89105.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Pyrobaculum islandicum DSM 4184]
          Length = 338

 Score = 72.0 bits (175), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 63/300 (21%), Positives = 126/300 (42%), Gaps = 19/300 (6%)

Query: 47  GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF 106
           G ++ + F  K       + L   V ++N+L    +N   D+ +G       +  + G+ 
Sbjct: 46  GKELAKKFSEKYGVNATFVPLGGAVEMVNELVRNRDNPPWDVTIGVPEFYYMVLIERGVL 105

Query: 107 AKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQIT----QPPKNFDELINSTKPW 161
                    +     WD    V P D  Y+  +Y++  +     +PP+  D+L+      
Sbjct: 106 YCPGFKVEGVPAEEYWDPHGCVYPLDKSYIGIVYNETALAARGLKPPQTLDDLLKPEYKG 165

Query: 162 KIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK-----GWTESYGFFLK 216
            I Y +P  S  GL +L W+  + G+     W+ +      ++K     G+T       +
Sbjct: 166 LITYPNPVQSGTGLAVLSWVMSVKGEEEG--WRYLKQLAGQISKIGYPSGFTPLRNALKR 223

Query: 217 GESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFM 276
           G+    LS+ +    + ++ G  +  AA +S   +L  E  A L  ++   LA EF++F 
Sbjct: 224 GDVLIALSWYS----HAIDPGTPNIKAATYSA--FLYREGVAVLKNARNRDLAVEFVKFA 277

Query: 277 ISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           +S   Q ++   N+M PV   ++    + +  PQ  + +N+    +  ++W   WQ  ++
Sbjct: 278 LSKEGQDLVDPYNYMLPVRPDAVIKNNKGLPQPQSVVVYNSALGAK-ADEWRLRWQREIA 336


>gi|171185547|ref|YP_001794466.1| ABC transporter periplasmic-binding protein [Thermoproteus
           neutrophilus V24Sta]
 gi|170934759|gb|ACB40020.1| ABC transporter, periplasmic binding protein, thiB subfamily
           [Thermoproteus neutrophilus V24Sta]
          Length = 338

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 126/300 (42%), Gaps = 19/300 (6%)

Query: 47  GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF 106
           G ++ + F  +       + L   V ++N+L    +N   D+ +G       +  + G+ 
Sbjct: 46  GRELARRFSERYGVNATFVALGGAVEMVNELVRNRDNPPWDVAIGVPEFYYTVLVEKGVL 105

Query: 107 AKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQIT----QPPKNFDELINSTKPW 161
                    +     WD    V P D  Y+  +Y++  +     +PP+  D+L+      
Sbjct: 106 YCPGFKVEGVPAEEYWDPHGCVYPLDKSYIGIVYNESALAARGLKPPQTLDDLLKPEYRG 165

Query: 162 KIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK-----GWTESYGFFLK 216
            I Y +P  S  GL +L W+  + G+     W+ +   ++ ++K     G+T       +
Sbjct: 166 LITYPNPVQSGTGLAVLSWVMSVKGEEEG--WRYLKQLSSQISKIGYPSGFTPLRSALKR 223

Query: 217 GESDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFM 276
           G+    LS+ +    + ++ G     AA +S   +L  E  A L  ++   LA EF++F 
Sbjct: 224 GDVLIALSWYS----HAIDPGTPSMKAATYSA--FLYKEGVAVLKNARNRDLALEFVKFA 277

Query: 277 ISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVS 336
           +S   Q ++   N+M PV   ++      +  PQ  + +N    ++  ++W   WQ  ++
Sbjct: 278 LSKEGQDLVDPYNYMLPVRPDAVVKNNLGLPRPQSVVVYNPALGSK-ADEWRLRWQREIA 336


>gi|18311870|ref|NP_558537.1| thiamine-binding periplasmic protein [Pyrobaculum aerophilum str.
           IM2]
 gi|18159283|gb|AAL62719.1| thiamine-binding periplasmic protein [Pyrobaculum aerophilum str.
           IM2]
          Length = 288

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 100/250 (40%), Gaps = 20/250 (8%)

Query: 47  GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF 106
           G  + + F  K       + L   V ++N+L    +N   D+ +G       +     + 
Sbjct: 46  GTALAKKFSEKYGVNATFVPLGGAVEMVNELVRNKDNPPWDVAIGVPEFYYTVLIDKDVL 105

Query: 107 AKSNIDASQLKLPIKWDDDIFV-PYDYGYLAFIYDKRQIT----QPPKNFDELINSTKPW 161
               I    +     WD  + V P D  Y+  +Y+   +     QPP+  D+L+      
Sbjct: 106 YCPGIKIEGIPQEEYWDPHMCVYPLDKSYIGIVYNASALAKMGIQPPRTLDDLLKPEYKG 165

Query: 162 KIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATV--TKGWTESYGFFLKGE 218
            I Y +P  S  GL +L WI  + G+     + K++  + A +    G+T       +GE
Sbjct: 166 LITYPNPVQSGTGLAVLSWIMSVKGEEGGWTYLKQLKGQIAKIGYPSGFTSLRNALKRGE 225

Query: 219 SDFVL---SYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQF 275
               L   S++  PG    N     Y A L+ EG        A L  SK  +LA EF++F
Sbjct: 226 VLIALSWYSHAIDPG--TPNMKASTYSAFLYREG-------VAVLKNSKNRELAVEFLKF 276

Query: 276 MISPSFQRIL 285
            +S   Q ++
Sbjct: 277 ALSKEGQDLV 286


>gi|145636531|ref|ZP_01792199.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
          influenzae PittHH]
 gi|145270356|gb|EDK10291.1| thiamin ABC transporter periplasmic-binding protein [Haemophilus
          influenzae PittHH]
          Length = 95

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 1/68 (1%)

Query: 28 AKPVLTVYTYNSFVADEGAGPKIKQAFERKC-NCELKLIGLSDGVALLNKLRMEGENSAA 86
          A+  + VY+Y+SF+++ GAGPK+KQ FE+    C +          LLN++R+EG+ + A
Sbjct: 22 AQQSVNVYSYDSFISEWGAGPKVKQDFEKAHPQCAINFTPFESVGVLLNRVRLEGKKTKA 81

Query: 87 DIVLGFDN 94
          DIVLG DN
Sbjct: 82 DIVLGLDN 89


>gi|289810904|ref|ZP_06541533.1| thiamine transporter substrate binding subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 49

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 37/49 (75%)

Query: 74  LNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW 122
           LN+LRMEG+NS AD+VLG DNNL++ A +T LFAKS +    +K+P  W
Sbjct: 1   LNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANEAVKVPGGW 49


>gi|313891423|ref|ZP_07825039.1| ABC transporter, solute-binding protein [Dialister microaerophilus
           UPII 345-E]
 gi|329121484|ref|ZP_08250108.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           binding protein [Dialister micraerophilus DSM 19965]
 gi|313120198|gb|EFR43374.1| ABC transporter, solute-binding protein [Dialister microaerophilus
           UPII 345-E]
 gi|327469399|gb|EGF14869.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter,
           binding protein [Dialister micraerophilus DSM 19965]
          Length = 345

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 130/302 (43%), Gaps = 23/302 (7%)

Query: 50  IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF-AK 108
           + + FE+     +  + +S G   L+++R E +N  AD+  G   +   +A+K GL  A 
Sbjct: 53  VAEEFEKDTGIHVNFVRMSGG-ETLSRIRAEKDNPQADVWYGGSADSFIMAKKEGLLEAY 111

Query: 109 SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKR----QITQPPKNFDELINSTKPWKII 164
            + +A ++K   K  D  +     GYL FI D R       Q PK++D+L+      +I+
Sbjct: 112 KSPNAEKIKPEFKDADGYWTGIYQGYLGFILDGRYFDEHNLQEPKSWDDLLKPEFKGQIV 171

Query: 165 YQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTKGWTESYGFFLKGESDFVL 223
             +P +++ G  ++  I +  G+     +  K+  +    TK           GE+   +
Sbjct: 172 MGNPGSASTGYVIVSAIVQNMGEEKGMEYLAKLNKQIKQYTKAGAAPARSAALGEAAIGI 231

Query: 224 SYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQR 283
           +Y    G  L+  G  +   +L  EG   ++   A +  +   + A++F+ + ++   Q 
Sbjct: 232 TY-IHNGIRLMKEGNTNVRLSLPEEGTAYELGAVAIIKNAPNMENAKKFVDWCLTKKAQE 290

Query: 284 ILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW--------ISSWQNAV 335
           I    N  Y    ++ PD       P+++++F   +  +Y  QW        + +W  AV
Sbjct: 291 IGQHNN-SYQF--LTNPDA----NPPEEAMKFKDAKLMKYDFQWSGDNRGRLLEAWNAAV 343

Query: 336 SR 337
             
Sbjct: 344 KE 345


>gi|229917657|ref|YP_002886303.1| extracellular solute-binding protein family 1 [Exiguobacterium sp.
           AT1b]
 gi|229469086|gb|ACQ70858.1| extracellular solute-binding protein family 1 [Exiguobacterium sp.
           AT1b]
          Length = 353

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 69/322 (21%), Positives = 138/322 (42%), Gaps = 29/322 (9%)

Query: 2   KKFARIVVGIMMITGVISYC-------TLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAF 54
           KK+A + +   + T +++ C       + +G     V+ VY+   +  D+    ++ + F
Sbjct: 3   KKYAALGISAALTTSLLAACASTDETTSNEGSDDSNVVNVYSSRHYDVDQ----QLYKQF 58

Query: 55  ERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           E +   ++ ++ G SD   LL +L  EGEN+ AD+ +  D   +  A++ G     + D 
Sbjct: 59  EEETGIKVNVVEGKSD--ELLERLNTEGENTEADLFITADAGNLYQAKEAGHLQAVDSDE 116

Query: 114 SQLKLPIKW--DDDIFVPYDYGYLAFIYDKRQIT-QPPKNFDELINSTKPWKIIYQDPRT 170
            +  +P K+   D+ +          +Y K ++  +    ++ L       K++ + P  
Sbjct: 117 LESNIPEKYRDTDNEWFGLTKRARVIVYSKDRVKPEDLSTYEALTEEQWNGKVLVR-PSE 175

Query: 171 STLGLGLLLWIQKIYGDNSAQVWKK-IATKTATVTKGWTESYG-FFLKGESDFVLSYSTS 228
           +   + LL    ++ G + A+ W K +    A   +G         + GE D  +  +  
Sbjct: 176 NMYNISLLASFIEVNGVDEAKEWAKGLVNNMARDPQGNDRDQAKAVVAGEGDVAIMNTYY 235

Query: 229 PGFYLLNYGQDDYVAA----LF-----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISP 279
            G  L +  +++   A    +F     + G ++ I   A    SK  + AQ+ M+FM  P
Sbjct: 236 MGLMLNSEDEEEKKVAEQLGVFFPNQDTTGTHVNISGIAMTKASKNTENAQKLMEFMSEP 295

Query: 280 SFQRILPTTNWMYPVVDISMPD 301
           S Q    + N+ YPV +   P+
Sbjct: 296 SAQEKFASVNYEYPVNESVEPN 317


>gi|118474194|ref|YP_891325.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter fetus subsp. fetus 82-40]
 gi|118413420|gb|ABK81840.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter fetus subsp. fetus 82-40]
          Length = 335

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 127/292 (43%), Gaps = 30/292 (10%)

Query: 25  GLPAKPVL----TVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRME 80
           GL A  +L     +YT   + AD+    KI  AFE+K   ++K    +    L+ KL +E
Sbjct: 9   GLLASAMLASEVNLYTARHYDADQ----KIYDAFEKKTGIKVKAT-QAKASELIKKLEIE 63

Query: 81  GENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFI 138
           G +S+AD+ +  D   +  A++ G+  K N +  +  +P  ++  D  +          +
Sbjct: 64  GASSSADLFITADVGNLYSAKQKGVLQKVNSEYLEKTIPQNLRDIDSQWFAVTKRARVIV 123

Query: 139 YDKRQITQPP---KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG---DNSAQV 192
           Y K +        KN+++L NS    K++    R+ T G    L    I     + + ++
Sbjct: 124 YSKDRFDPAKMGLKNYEDLGNSNLKGKLLI---RSGTAGYNTTLIASLIAHNGEEKTLEL 180

Query: 193 WKKIATKTATVTKGW-TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA-----LF 246
            K I +  A   KG   +       GE D  L  +   G  L +   +D  AA     +F
Sbjct: 181 SKSIVSNFARAPKGGDRDQIKAIFAGEGDVALVNTYYIGLMLNSPKANDVDAAKSIGIIF 240

Query: 247 ----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
               S G ++ I   A    SK  + A +FM+F++SP  Q I+   N+ YPV
Sbjct: 241 PDQDSYGTHVNISGVALTKASKNRENAIKFMEFLLSPEAQEIITNINYEYPV 292


>gi|223040699|ref|ZP_03610968.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter rectus RM3267]
 gi|222878063|gb|EEF13175.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter rectus RM3267]
          Length = 333

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/279 (25%), Positives = 122/279 (43%), Gaps = 24/279 (8%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + +Y+   + AD     ++ + FE+K   ++       G  L+ KL +EG++SAADI + 
Sbjct: 20  VNIYSARHYDADN----ELYKLFEQKTGIKVNATQAKAG-ELIKKLEVEGDSSAADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA--FIYDKRQITQPPK 149
            D      A+  G+      +  +  +P ++ D+    +     A   +YDKR     PK
Sbjct: 75  ADAGNFYTAKSKGVLQSVKSETLEKIVPEQYRDNDGQWFAISKRARIIVYDKRDFD--PK 132

Query: 150 NFDELINSTKP---WKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT-ATVTK 205
              +  + TKP    K++ +   T+     LL  I +  G ++A  W +   K  A   K
Sbjct: 133 GIKDYEDLTKPELKGKLLIRSA-TAPYSKSLLAAIIEADGKDAAAKWAEGTLKNLARDPK 191

Query: 206 GWTESYGFFL-KGESDFVLSYSTSPGFYLLNYGQDDYVAA-----LF----SEGHYLQIE 255
           G        +  GE D  +  +   G  L +   +D  AA     +F    + G ++ I 
Sbjct: 192 GGDRDQAKAIYAGEGDVAVMNTYYIGLMLTSPKAEDVEAAKNLGIIFPNQDNRGTHVNIS 251

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
             A    +K  + A +FM+FM+SP  Q+IL   N+ YP+
Sbjct: 252 GIALTKAAKNKENAVKFMEFMVSPEAQKILAGINFEYPI 290


>gi|258646864|ref|ZP_05734333.1| ABC transporter, periplasmic substrate-binding protein [Dialister
           invisus DSM 15470]
 gi|260404303|gb|EEW97850.1| ABC transporter, periplasmic substrate-binding protein [Dialister
           invisus DSM 15470]
          Length = 348

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 128/300 (42%), Gaps = 23/300 (7%)

Query: 50  IKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF-AK 108
           +   FE+    ++  + +S G   L+++R E  N  A +  G   +   +A+K GL  A 
Sbjct: 56  VASEFEKDTGIKVNFVRMSGG-ETLSRIRAEKNNPQASVWYGGSADSFIMAKKEGLLEAY 114

Query: 109 SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKR----QITQPPKNFDELINSTKPWKII 164
            + +A ++K   K  D  +     GYL FI D R       QPP ++D+L+      +I+
Sbjct: 115 KSPNAEKIKPEFKDADGYWTGIYQGYLGFILDGRYFDEHKLQPPTSWDDLLKPEFTGQIV 174

Query: 165 YQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTKGWTESYGFFLKGESDFVL 223
             +P +++ G  ++  I +  G+     +  K+  +    TK           GE+   +
Sbjct: 175 MGNPGSASTGYVVVSAIVQSMGEEKGMEYLAKLNKQVKQYTKAGAAPARSAALGEAAIGI 234

Query: 224 SYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQR 283
           +Y  + G  L+  G  +   +L  EG   ++   A +  +   + A++F+ + ++   Q 
Sbjct: 235 TYLHN-GIRLIKEGNTNVRLSLPEEGTAYELGAVAIIKNAPDMEAAKKFVDWALTKKAQE 293

Query: 284 ILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQW--------ISSWQNAV 335
           I    N  Y    ++ P+       P+++++F   +   Y  QW        + +W  AV
Sbjct: 294 IGQHNN-SYQF--LTNPEA----NPPEEAMKFKDAKLIDYNFQWSGDNRARLLEAWNKAV 346


>gi|57168653|ref|ZP_00367785.1| iron transport protein [Campylobacter coli RM2228]
 gi|305432718|ref|ZP_07401878.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter
           [Campylobacter coli JV20]
 gi|57019934|gb|EAL56614.1| iron transport protein [Campylobacter coli RM2228]
 gi|304444227|gb|EFM36880.1| iron (Fe3+) ABC superfamily ATP binding cassette transporter
           [Campylobacter coli JV20]
          Length = 334

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/294 (24%), Positives = 124/294 (42%), Gaps = 22/294 (7%)

Query: 17  VISYCTLD-GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
           + S C L   L     L +Y+   + AD     +I + FE K   ++     +    L+ 
Sbjct: 4   IFSLCLLGFSLLGAAELNIYSARHYDAD----FQIIKKFEEKTGIKVNHTQ-AKASELIK 58

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFA--KSNIDASQLKLPIKWDDDIFVPYDYG 133
           +L +EG NS ADI +  D + +  A+ +GL +  KS      +   ++  D  +      
Sbjct: 59  RLSLEGSNSPADIFITADISNLTEAKNSGLLSPVKSKYLEDTIPAHLRDKDGEWFAITKR 118

Query: 134 YLAFIYDKRQIT--QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ 191
                Y+K   T     KN+++L       +I+ +   T+     LL  I    GD +A+
Sbjct: 119 ARIIAYNKNANTDISKMKNYEDLAKPEFKGQIVMRSA-TAPYSKTLLASIIANDGDENAK 177

Query: 192 VWKK-IATKTATVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAA 244
           VW K +    AT  KG           GE+ F +  +   G    +    D      +  
Sbjct: 178 VWAKGVLDNLATKPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGI 237

Query: 245 LF----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           +F    + G ++ I   A    SK  + A++FM+FM++P  Q+IL  +N+ +P+
Sbjct: 238 IFPNQDNRGTHINISGIAMTKSSKNQEAAKKFMEFMLTPEIQKILTDSNYEFPI 291


>gi|260431831|ref|ZP_05785802.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415659|gb|EEX08918.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Silicibacter lacuscaerulensis ITI-1157]
          Length = 337

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/285 (22%), Positives = 115/285 (40%), Gaps = 27/285 (9%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAA 86
           A+  L +Y+   +  DE    ++   FE     ++  I G +D   L+ ++  EG NS A
Sbjct: 21  AEGELNLYSSRHYDTDE----RLYTDFEEATGIKINRIEGKAD--ELIARMEAEGANSPA 74

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI--YDKRQI 144
           D++L  D + +  A+  GL    + D  + ++P    D+    + +   A I  YDK  +
Sbjct: 75  DVLLTVDTSRLARAKNAGLLQAVDSDVLEERIPANLQDEDNQWFGFSQRARIIFYDKNDV 134

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTAT 202
           T PP  + +L N      +  +   T+T    LL  I   +G   A+ W    +A     
Sbjct: 135 TNPPATYLDLANPEYKGLVCIR-SSTNTYNQTLLASIITHHGAEKAKEWAAGVVANMARD 193

Query: 203 VTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD--------DYVAALF----SEGH 250
              G T+     + GE +  +S S    ++     +D        D +   F    +EG 
Sbjct: 194 PQGGDTDQLRGIVSGECEIAVSNSY---YFARALRKDVKGLSDSIDMIGIQFPSQDAEGA 250

Query: 251 YLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           ++ +  A     +     A +F++++ S   Q      N  YP V
Sbjct: 251 HMNLSGAGVAAHAPHKDAAIKFLEYLASDQAQVYFSHGNDEYPAV 295


>gi|260223370|emb|CBA33868.1| Iron deficiency-induced protein A [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 328

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 119/294 (40%), Gaps = 33/294 (11%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           VL VY+   +  D     ++  AF +    ++K +  +D   +L +L+ EG  S AD++L
Sbjct: 7   VLNVYSARHYPGD----VQLYSAFTQATGIQIKRVD-ADDAGILQRLKAEGTASPADVIL 61

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGY----LAFIYDKRQI 144
             D + +  A   GLFA     A    +P  ++        Y YG+       +Y+K ++
Sbjct: 62  LVDASRLWRAEVDGLFAPVKSKALDTAIPAQLRGKTSAEGTYWYGFSTRARVIVYNKARV 121

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTAT 202
           ++   +  E ++  K   ++     +    L L   + +  G  + + W K  ++     
Sbjct: 122 SKENVDTYEELSDPKNKGLLCTRSGSHPYNLSLFGAMNEHLGSAATETWLKGLVSNMARN 181

Query: 203 VTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY---------VAALF----SEG 249
              G T+       GE    L+ +    +YL    + D          V  +F    S G
Sbjct: 182 PVGGDTDQIKATASGECGVALTNT----YYLARLMRSDKPEDRAVMDKVGVVFPNQSSWG 237

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV---VDISMP 300
            ++ I   A    SK P  AQ+F++F+ SP  Q      N  +PV   + IS P
Sbjct: 238 THVNIAGGAMAKNSKNPAYAQQFLEFLASPQAQEYFANGNNEWPVAKGIKISNP 291


>gi|307152612|ref|YP_003887996.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7822]
 gi|306982840|gb|ADN14721.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7822]
          Length = 347

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 114/261 (43%), Gaps = 29/261 (11%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           F ++   ++ LI  ++   L+ +++ EG NS ADI++  D   +  A + GLF   N   
Sbjct: 55  FTKQTGIKVNLIE-AEADPLIERIKSEGRNSPADILITVDAARLWRAYQAGLFTPVNSKI 113

Query: 114 SQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPPK--NFDELINSTKPWKIIYQDPR 169
            Q K+P  ++     +  +       +Y+K ++ +P +  ++D+L N     K++ +   
Sbjct: 114 LQQKIPANLREPKGHWFAFSERLRVIMYNKNRV-KPSQLSSYDDLANPKWKGKVVSRS-S 171

Query: 170 TSTLGLGLLLWIQKIYGDNSAQVWKK-----IATKTATVTKGWTESYGFFLKGESDFVLS 224
           +ST     + W+    G+ +A+ W +      A       KG  E+      G +D  L+
Sbjct: 172 SSTYNQSFVAWLIATRGEAAAEKWCRGFVANFARPPQGNDKGQIEAVA---AGAADLTLA 228

Query: 225 YSTSPGFYLLNYGQD---------DYVAALF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQ 274
            +    +YL +Y  D           V   F  +G ++ +  A  L  +     A +F++
Sbjct: 229 NT----YYLASYANDKDPAKRAIYQQVGVFFPPKGVHVNVSGAGVLKTAPNRDAAIKFLE 284

Query: 275 FMISPSFQRILPTTNWMYPVV 295
           ++++P  Q      N  YPVV
Sbjct: 285 YLVTPEAQNFFAQGNNEYPVV 305


>gi|212710447|ref|ZP_03318575.1| hypothetical protein PROVALCAL_01509 [Providencia alcalifaciens DSM
           30120]
 gi|212686867|gb|EEB46395.1| hypothetical protein PROVALCAL_01509 [Providencia alcalifaciens DSM
           30120]
          Length = 332

 Score = 56.2 bits (134), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 130/301 (43%), Gaps = 43/301 (14%)

Query: 10  GIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQ---AFERKCNCELKLIG 66
           GI M  G+   C L  + ++  LTVYT        G G   KQ    +E++   ++ +  
Sbjct: 20  GIAMSLGL--SCALFSVSSQ-ALTVYT-------AGPGAMAKQLAAGYEKQTGVKVDVFQ 69

Query: 67  LSDGVALLNKLRMEGENSAADIVLGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDDD 125
            + G  ++ +L  E  N  AD+++    +  +DL +K  L A  + +A   K+P ++   
Sbjct: 70  ATTG-KVMARLEAEQANPRADVLISASWDTALDLQQKGWLLAYESPNAE--KVPAQFKTP 126

Query: 126 IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIY 185
            +V      L  +++ +  T  PK++ +L       K+   DP  S   L LLL +Q   
Sbjct: 127 YYVAQGISALGIVWNSKSGTPTPKDWADLAQPAFKDKVTMPDPALSGASLDLLLGLQNAK 186

Query: 186 GDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA-A 244
            + +  ++ ++      ++    ++    L+G    V             +G  DYVA  
Sbjct: 187 SEAAWTLFSELKANGMVISGPNAQALTPVLQGAKAAV-------------FGAVDYVAYG 233

Query: 245 LFSEGHYLQI-------EVAAQ----LVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYP 293
             +EG  +++        +A +    L  SKQ + A+ F+ +++SP  Q+I+    W+ P
Sbjct: 234 SIAEGESIEVIFPSSGTAIAPRPMMILKSSKQQEEAKAFIDYVLSPDGQKIV-ADAWLMP 292

Query: 294 V 294
            
Sbjct: 293 A 293


>gi|163739372|ref|ZP_02146783.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Phaeobacter gallaeciensis BS107]
 gi|163743633|ref|ZP_02151009.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Phaeobacter gallaeciensis 2.10]
 gi|161383104|gb|EDQ07497.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Phaeobacter gallaeciensis 2.10]
 gi|161387442|gb|EDQ11800.1| iron uptake protein A1 [Phaeobacter gallaeciensis BS107]
          Length = 338

 Score = 56.2 bits (134), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 117/281 (41%), Gaps = 27/281 (9%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           L +Y+   +  DE    ++   FE      +  I G +D   L+ ++  EG NS ADI+L
Sbjct: 26  LNLYSSRHYDTDE----RLYSDFEEATGITINRIEGKAD--ELIARMSAEGANSPADILL 79

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D + +  A+  GL    + D  + ++P  ++  D+ +  +        +DK  +  PP
Sbjct: 80  TVDTSRLARAKNEGLLQAIDSDTLEARVPGYLQDADNQWFGFSQRARIIFFDKADVATPP 139

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTKG 206
           K + +L +     ++  +   T+T    LL  I   +G+ +A  W K  +A        G
Sbjct: 140 KTYLDLADPAYKGQVCIR-SSTNTYNQTLLASIVTHHGEEAATDWAKGVVANMARAPQGG 198

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNYGQD--------DYVAALF----SEGHYLQI 254
            T+     + GE +  +  S    ++  +  +D        D +  +F    +EG ++ +
Sbjct: 199 DTDQLRGIVSGECEIAVGNSY---YFARSIRKDVKGLSADRDMIGWVFPAQDAEGAHMNL 255

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
                 V +     A +F++++ S   Q+     N  YP V
Sbjct: 256 SGGGVAVNAPNKDNAVKFLEYLASDQAQQYFSAGNDEYPAV 296


>gi|149201951|ref|ZP_01878925.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. TM1035]
 gi|149144999|gb|EDM33028.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. TM1035]
          Length = 338

 Score = 56.2 bits (134), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/262 (20%), Positives = 106/262 (40%), Gaps = 25/262 (9%)

Query: 52  QAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA--KS 109
           +AF ++   ++  I   +   L+ +++ EG NS AD+ +  D   +  A   GL     S
Sbjct: 41  EAFTKETGIKINRIEGKE-AELIERMKAEGANSPADVFMTVDVGNVSRAVDEGLLQPFSS 99

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPR 169
           ++  S +   ++  D+++           Y K ++  PP+ ++EL +     +I  +   
Sbjct: 100 DLIESNVAANLRHPDNLWTGLSQRSRIIFYAKDRVETPPQTYEELADPKYQGQICIRS-S 158

Query: 170 TSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYST 227
           ++     LL  I +++G+ +A+ W    +A        G T+     + GE D  +S + 
Sbjct: 159 SNVYNQSLLASIIEVHGEEAAKEWAAGIVANMARAPEGGDTDQLRGIVSGECDIAVSNT- 217

Query: 228 SPGFYLLNYGQDDYVAALFS--------------EGHYLQIEVAAQLVRSKQPQLAQEFM 273
               Y    G    V  L S               G ++ +  A   V +  P+ A   +
Sbjct: 218 ----YYFARGLAGDVDGLTSGIDGIGWVWPNQEDRGAHMNLVAAGIAVNAPNPEEALALL 273

Query: 274 QFMISPSFQRILPTTNWMYPVV 295
           +F+ S + Q      N  YPV+
Sbjct: 274 EFLASETAQEQFANGNNEYPVL 295


>gi|255322404|ref|ZP_05363550.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter showae RM3277]
 gi|255300777|gb|EET80048.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter showae RM3277]
          Length = 333

 Score = 55.5 bits (132), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 121/277 (43%), Gaps = 20/277 (7%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + +Y+   + AD     ++ + FE+K   ++       G  L+ KL +EG +SAADI + 
Sbjct: 20  VNIYSARHYDADS----ELYKLFEQKTGIKVNATQAKAG-ELIKKLEVEGGSSAADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA--FIYDKRQIT-QPP 148
            D      A+  G+      +  +  +P ++ D+    +     A   +YDKR    +  
Sbjct: 75  ADAGNFYTAKTKGVLQAVKSETLEKIVPQQYRDNDSQWFAISKRARVIVYDKRDFNPKGI 134

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKT-ATVTKGW 207
           K++++L       K++ +   T+     LL  I +  G ++A  W +   K  A   KG 
Sbjct: 135 KDYEDLAKPELKGKLLIRSA-TAPYSKSLLAAIIEADGKDAATKWAEGTLKNLARDPKGG 193

Query: 208 TESYGFFL-KGESDFVLSYSTSPGFYLLNYGQDDYVAA-----LF----SEGHYLQIEVA 257
                  +  GE D  +  +   G  L +   +D  AA     +F    + G ++ I   
Sbjct: 194 DRDQAKAIYAGEGDVAVMNTYYIGLMLTSPKAEDVEAAKNLGIIFPNQDNRGTHVNISGI 253

Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           A    +K  + A +FM+FM+SP  Q+IL   N+ YP+
Sbjct: 254 ALTKAAKNKENAVKFMEFMVSPEAQKILAGINFEYPI 290


>gi|254466777|ref|ZP_05080188.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Rhodobacterales bacterium Y4I]
 gi|206687685|gb|EDZ48167.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Rhodobacterales bacterium Y4I]
          Length = 338

 Score = 54.7 bits (130), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 116/282 (41%), Gaps = 29/282 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           L +Y+   +  DE    ++   FE      +  I G +D   L+ ++  EGENS ADI++
Sbjct: 26  LNIYSSRHYDTDE----QLYSEFEEATGITINRIEGNAD--ELIARMTAEGENSPADILI 79

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D + +  A+  G+      D  + ++P  ++ +D+ +  +        Y+K  +  PP
Sbjct: 80  TVDTSRLTRAKDAGVLQSIESDVLEARVPGYLQDEDNQWFGFSQRARIIFYNKDAVANPP 139

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTKG 206
             + +L +     K+  +  + +T    LL  I   +G ++A+ W +  +A        G
Sbjct: 140 LTYLDLADPAYKGKVCIRSSK-NTYNQTLLASIVTHHGADAARNWAEGVVANMARDPQGG 198

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNY---------GQDDYVAALF----SEGHYLQ 253
            T+     + GE D  ++ S    +Y                D +  LF    +EG ++ 
Sbjct: 199 DTDQIRGLVSGECDIAVANS----YYFARAIRTDVKGVSENRDQIGWLFPSQNTEGAHMN 254

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           +      + +     A +F++++ S S Q      N  YP V
Sbjct: 255 LSGGGVAMHAPNKDNAIKFLEYLASDSAQAYFSAGNDEYPAV 296


>gi|288958084|ref|YP_003448425.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
 gi|288910392|dbj|BAI71881.1| iron(III) transport system substrate-binding protein [Azospirillum
           sp. B510]
          Length = 340

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/296 (21%), Positives = 123/296 (41%), Gaps = 26/296 (8%)

Query: 17  VISYCTLDGLPAKP-VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALL 74
           V + C L     +   + VY    +  D      I + F +    ++ ++ G  D   L+
Sbjct: 10  VFAVCALSAFDVQAQEVNVYNSRHYNTDR----TIYETFTKATGIKVNIVEGNHD--ELI 63

Query: 75  NKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA-SQLKLPIKWDDDIFVPYDYG 133
            +L+ EG +S AD+++  D   +  A K GL A  +  A   +K+P    D     +   
Sbjct: 64  QRLKSEGASSPADLLITVDAGRLAAAAKDGLLAPVSSPALEAVKVPANLRDPDGAWWGLS 123

Query: 134 YLA--FIYDKRQITQPPKNFDELINSTKP-WKI-IYQDPRTSTLGLGLLLWIQKIYGDNS 189
             A   +Y + ++   P+   +  +  KP WK  +     T +  L L   + +  G+  
Sbjct: 124 SRARIIVYARDRVK--PERIKDYEDLAKPEWKHRVLTRSGTHSYSLALTASMVEALGEEK 181

Query: 190 AQVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY-----V 242
            + W K  +A        G T+       GE D  ++ +   G  +++  Q+D      +
Sbjct: 182 TEEWVKGLVANLARPPQGGDTDQIKAVAVGEGDVAIANTYYVGKMIVSAKQEDREVASKI 241

Query: 243 AALF----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
             LF    + G ++ +  A  +  S+ P+ A++ +++++SP  QR     N  YPV
Sbjct: 242 GVLFPNQDNRGTHVNLSGAGVVKSSRNPENARKLLEYLLSPEAQRQFADGNMEYPV 297


>gi|170079102|ref|YP_001735740.1| iron transport protein [Synechococcus sp. PCC 7002]
 gi|169886771|gb|ACB00485.1| iron transport protein [Synechococcus sp. PCC 7002]
          Length = 363

 Score = 53.9 bits (128), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 70/319 (21%), Positives = 125/319 (39%), Gaps = 53/319 (16%)

Query: 16  GVISYCTLDGLPAKPV---LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVA 72
           G     T  G P+      + +Y+   + +D     ++ +AF      E+ LI  SD   
Sbjct: 29  GATDTTTDPGAPSSEATGEINLYSSRHYDSD----AELYEAFSEATGIEVNLIEGSDD-E 83

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF--AKSNIDASQLKLPIKWDDDIFVPY 130
           LL ++R EGENS AD+++  D   +  A++ GL    +S +  S +   ++  D+ +   
Sbjct: 84  LLERIRTEGENSPADVLITVDVARLWRAQQDGLLQPTESEVLTSAIPENLRSSDNTWFGL 143

Query: 131 DYGYLAFIYDKRQITQPP-KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNS 189
                  +Y+   +       +++L +     ++     R+S+            Y  N 
Sbjct: 144 TKRARIIVYNTETVDPAELSTYEDLADPKWEGRVCV---RSSS----------NTY--NQ 188

Query: 190 AQVWKKIATKTATVTKGWTESY--GFFLKGE-SDFVLSYSTSPGFYLLNYGQDDYVAALF 246
           + V  KI  K A  T+ W +     F  + E +D     + + G   +      YVA L 
Sbjct: 189 SLVAAKIVEKGAEATEEWVQGLVANFAREPEGNDTAQIQAVASGVCDVALVNSYYVARLR 248

Query: 247 SE------------------------GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQ 282
           +                         G ++ I  A  +  +   + AQEF++FM++P  Q
Sbjct: 249 ASEDPQDQEIVANIGAFFPNQNEGEGGTHINISGAGIIANAPNVEAAQEFLEFMVTPEAQ 308

Query: 283 RILPTTNWMYPVVDISMPD 301
            I    N  YPVVD   P+
Sbjct: 309 EIFANNNNEYPVVDTVAPN 327


>gi|83950453|ref|ZP_00959186.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius nubinhibens ISM]
 gi|83838352|gb|EAP77648.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius nubinhibens ISM]
          Length = 318

 Score = 53.5 bits (127), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 103/241 (42%), Gaps = 24/241 (9%)

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF--AKSNIDASQLKLPIKWDDDIFVPY 130
           L+ +L  EG+NS AD+ +  D   +  A + G+    +S++ A+ +   ++  ++++   
Sbjct: 41  LIARLSAEGDNSPADVFITVDIGRMGRAEEAGVLQAVESDVIANAVPKHLRDPENMWFGV 100

Query: 131 DYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
                   Y K ++  PP++++EL + +   +I  +  + +     LL  + +  G+ +A
Sbjct: 101 SQRARIIFYAKDRVENPPRSYEELADPSLKGQICIRSSK-NIYNQSLLASLIEANGEEAA 159

Query: 191 QVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS- 247
           + W    +A        G T+     + GE D  ++      +Y L  G D  V  L S 
Sbjct: 160 KDWAAGIVANMARDPEGGDTDQLRGLVSGECDIAVANH----YYFLR-GYDKDVEGLTSG 214

Query: 248 -------------EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
                         G +L +  AA    +   + A+ F++F+ S   Q+   + N  YP 
Sbjct: 215 IDGIGWVWPNQSDRGAHLNLAAAAMTKSAPNAEAAKTFLEFLTSEFAQQHFASQNNEYPA 274

Query: 295 V 295
           V
Sbjct: 275 V 275


>gi|300718849|ref|YP_003743652.1| ABC transporter substrate-binding protein [Erwinia billingiae
           Eb661]
 gi|299064685|emb|CAX61805.1| ABC transporter, substrate-binding protein [Erwinia billingiae
           Eb661]
          Length = 324

 Score = 53.5 bits (127), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 115/274 (41%), Gaps = 28/274 (10%)

Query: 31  VLTVYTYNSFVADEGAGP-----KIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSA 85
            LTVYT         AGP     K+   +E++   ++ +   + G  ++ +L  E  N  
Sbjct: 28  ALTVYT---------AGPGSLAKKLAAGYEKQTGVKVNIFQATTG-KVMARLEAEQANPL 77

Query: 86  ADIVLGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQI 144
           AD+++    +   DL  +  L    + +A+  K+P     D +V      L  +++ +  
Sbjct: 78  ADVLISASWDTAEDLQHRGWLLPYQSANAA--KVPDALKSDAYVAQGISALGIVWNTKSG 135

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVT 204
           T  PK + +L       K+   DP  S   L LL+ +Q   GD + Q++ K+      ++
Sbjct: 136 TPEPKEWADLTTPAFKDKVTTPDPSMSGASLDLLIGLQNGMGDGAWQLFDKLKANGMVIS 195

Query: 205 KGWTESYGFFLKGESDFVLSYSTSPGFYLLNYG--QD-DYVAALFSEGHYLQIEVAAQLV 261
               ++    L+G    V           ++YG  QD + +  +F E   +       ++
Sbjct: 196 GPNAQALTPVLQGAKAAVFG-----AVDYVSYGSIQDGEAIKVIFPESGTVVAPRPMMIL 250

Query: 262 RSKQPQL-AQEFMQFMISPSFQRILPTTNWMYPV 294
           +S Q    A+ F+ +++SP  Q ++    W+ P 
Sbjct: 251 KSTQHAADAKAFIDYVLSPEGQELV-AAAWLMPA 283


>gi|322832847|ref|YP_004212874.1| extracellular solute-binding protein family 1 [Rahnella sp. Y9602]
 gi|321168048|gb|ADW73747.1| extracellular solute-binding protein family 1 [Rahnella sp. Y9602]
          Length = 333

 Score = 53.1 bits (126), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 66/322 (20%), Positives = 138/322 (42%), Gaps = 30/322 (9%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGP-----KIKQAFER 56
           K F+R   G+M     +S     G      LT+YT         AGP     K+   +E+
Sbjct: 11  KTFSRTKTGVMTAM-TLSLAMAAG--NAQALTLYT---------AGPGSLAKKLAAGYEK 58

Query: 57  KCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD-NNLIDLARKTGLFAKSNIDASQ 115
           +   ++ +   + G  ++ +L  E  N  ADI++    +   DL ++  L    + +A+Q
Sbjct: 59  QTGVKVDVFQATTG-KVMARLEAEQANPRADILISASWDTATDLEQRGWLLEYQSPNAAQ 117

Query: 116 LKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGL 175
           +  P ++    +V      L  +++ +  T  PK++ +L       K+   DP  S   L
Sbjct: 118 V--PAQFKTPYYVAQGISALGIVWNTKSGTTEPKDWGDLAKPEFKDKVTTPDPSLSGASL 175

Query: 176 GLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLN 235
            LL+ +Q  +   + ++++ +      +     ++    L+G    V        +  + 
Sbjct: 176 DLLIGLQNAHAQQAWKLFEDLKANGMIIAGPNAQALTPVLQGAKAAVFGAVDYVSYASMQ 235

Query: 236 YGQDDYVAALF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
            G+   V  +F S G  +       L  S+QP+ A+ F+ + +SP  Q+++    W+ P 
Sbjct: 236 DGES--VKVIFPSSGTVIAPRPMMILKSSQQPKEAKAFIDYALSPEGQKLV-ADAWLMPA 292

Query: 295 ---VDISMPDVYQAIR-IPQKS 312
              +D   P ++++++ +P+ S
Sbjct: 293 RTDIDAKRP-LFKSLKLLPEAS 313


>gi|99079965|ref|YP_612119.1| extracellular solute-binding protein [Ruegeria sp. TM1040]
 gi|99036245|gb|ABF62857.1| extracellular solute-binding protein family 1 [Ruegeria sp. TM1040]
          Length = 336

 Score = 53.1 bits (126), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 65/320 (20%), Positives = 130/320 (40%), Gaps = 37/320 (11%)

Query: 11  IMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSD 69
           I + T VI+        A  V+ +Y+   +  DE    ++   FE      +  I G +D
Sbjct: 3   IKVFTTVIAASLATTAVADGVVNLYSSRHYDTDE----RLYTDFEEATGITINRIEGKAD 58

Query: 70  GVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVP 129
              L+ +++ EG NS AD+++  D + ++ A+  G+    + D  + ++P    D     
Sbjct: 59  --ELVARMQAEGANSPADVLITVDTSRLERAKNAGVLQSIDSDILEERIPANLQDSDNQW 116

Query: 130 YDYGYLAFI--YDKRQITQPPKNFDELINSTKPW--KIIYQDPRTSTLGLGLLLWIQKIY 185
           + +   A I  YDK  +  PP ++ +L    KP    ++     ++     LL  I + +
Sbjct: 117 FGFSQRARIVFYDKTDVANPPADYMDL---AKPEYKGMVCHRSSSNVYSQTLLSAIIENH 173

Query: 186 GDNSAQVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA 243
           G+ +A+ W +  +A        G T+     + GE D  ++ +    +Y     + D   
Sbjct: 174 GEEAARDWAEGIVANFARDPQGGDTDQLRGLISGECDVSIANT----YYFARALRKDVKG 229

Query: 244 -------------ALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNW 290
                        A  +EG ++ +  A     +   + A +F++++ S   Q      N 
Sbjct: 230 LSAEIEKIGVAFPAQDAEGAHMNLSGAGVAAHAPNRENAIKFLEYLASDQAQEYFSGGND 289

Query: 291 MYPVVDISMPDVYQAIRIPQ 310
            +P V    P V ++  + Q
Sbjct: 290 EFPAV----PGVSKSESVAQ 305


>gi|317407140|gb|EFV87139.1| ABC transporter substrate binding protein [Achromobacter
           xylosoxidans C54]
          Length = 309

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 115/269 (42%), Gaps = 18/269 (6%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQ---AFERKCNCELKLIGLSDGVALLNKLRMEGENSAAD 87
            LTVYT        G G  IKQ    F+ K   ++ +   + G  ++ +L  E  N  AD
Sbjct: 14  ALTVYT-------AGPGGLIKQLAAGFQEKTGIKVDVFQATTG-KVMARLEAESANPRAD 65

Query: 88  IVLGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQ 146
           +++    +   DL ++  L A  + +A+Q+  P ++    +V      L  +++ R  T 
Sbjct: 66  VLISASWDTAQDLDQRGWLLAYESPNAAQV--PARFKAPTYVAQGISALGIVWNSRSGTP 123

Query: 147 PPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKG 206
            P+++ +L       ++   DP  S   L LLL +Q   G+ + ++++ +      ++  
Sbjct: 124 EPRDWSDLTGPQFKQQVTTPDPALSGASLDLLLGLQSAQGEAAWKLFETLRDNGMAISGP 183

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF-SEGHYLQIEVAAQLVRSKQ 265
             ++    L+G    V        +  +  G+   +  +F S G  +       L  +K 
Sbjct: 184 NAQALTPVLQGAKAAVFGAVDYVSYASVEKGES--IKVIFPSSGTAIAPRPMMILKTTKA 241

Query: 266 PQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           P  A++F+ +++S   QR +    W+ P 
Sbjct: 242 PDQARQFIDYVLSEDGQRAV-ADAWLMPA 269


>gi|302525701|ref|ZP_07278043.1| 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate
           binding protein [Streptomyces sp. AA4]
 gi|302434596|gb|EFL06412.1| 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate
           binding protein [Streptomyces sp. AA4]
          Length = 344

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 86/196 (43%), Gaps = 22/196 (11%)

Query: 5   ARIVVGIMMITGVISYC--TLDGLPAKPVLTVYT-------YNSFVADEGAGPKIKQAFE 55
           A IV  +  + G++S C  T  G      +TVYT       YN+  A+          F+
Sbjct: 6   ATIVALVATLAGLLSACGGTAGGASGDQTVTVYTADGLEDWYNARFAE----------FK 55

Query: 56  RKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA-S 114
           ++    ++ +  +    +++++  E  N+ AD+++      +  A K GL A S      
Sbjct: 56  QQTGITVQAV-TAGSAEVVSRVGKEKANTQADVLVTLPP-FVQQAAKEGLLAASAPKGVD 113

Query: 115 QLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLG 174
           Q+    K     +      YL+FIY+ +Q    PK +++L++     K+ Y  P  +  G
Sbjct: 114 QVPAAQKDPQGRYYALMNNYLSFIYNPQQANPAPKTWNDLLDPKYKGKLQYSTPGEAGDG 173

Query: 175 LGLLLWIQKIYGDNSA 190
             +LL  Q ++GD  A
Sbjct: 174 TAVLLQAQHVFGDQGA 189


>gi|254462263|ref|ZP_05075679.1| extracellular solute-binding protein, family 1 [Rhodobacterales
           bacterium HTCC2083]
 gi|206678852|gb|EDZ43339.1| extracellular solute-binding protein, family 1 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 338

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/289 (21%), Positives = 115/289 (39%), Gaps = 28/289 (9%)

Query: 25  GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENS 84
           G  A+  + +Y+   +  DE    ++   FE      +  I    G  L+ +L++EG+NS
Sbjct: 18  GTYAEGEVNLYSSRHYDTDE----RLYSDFEELTGITVNRI-EGKGDELIARLKIEGKNS 72

Query: 85  AADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI--YDKR 142
            AD++L  D + ++ A++ G+      D    ++P    D     + +   A I  YDK 
Sbjct: 73  PADVILTVDTSRLERAKEAGVLQSIESDILDARVPSSLQDSDNQWFGFSQRARIIFYDKN 132

Query: 143 QITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKT 200
            +  PP ++  L +S K   ++     ++     LL  I + +G+  A  W +  +    
Sbjct: 133 DVANPPLDYLSLADS-KYQGMVCHRSSSNVYSQTLLSAIIENHGEEKAGEWAEGMVINFA 191

Query: 201 ATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA--------------ALF 246
                G T+     + GE D     S S  +Y     + D                 A  
Sbjct: 192 REPQGGDTDQLRALVSGECDI----SVSNTYYFARALRKDVQGLSSEEVANIGWIFPAQN 247

Query: 247 SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           +EG ++ +        +   + A +F++++ S S Q+     N  YP V
Sbjct: 248 AEGAHMNLSGGGVAAHAPNRENAIKFLEYLSSNSAQQYFSGGNDEYPSV 296


>gi|163761127|ref|ZP_02168204.1| extracellular solute-binding protein, family 1 [Hoeflea
           phototrophica DFL-43]
 gi|162281678|gb|EDQ31972.1| extracellular solute-binding protein, family 1 [Hoeflea
           phototrophica DFL-43]
          Length = 343

 Score = 52.8 bits (125), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 66/305 (21%), Positives = 123/305 (40%), Gaps = 29/305 (9%)

Query: 11  IMMITGVISYCTLDGLPAKPV--LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLS 68
           ++ +   +S      LPA     + +Y+   +  DE    ++   F      ++ LI   
Sbjct: 8   LLALLASVSMFAGTALPAHAEGEVNIYSSRHYDTDE----RLYSDFTDATGIKVNLIEAK 63

Query: 69  DGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA--KSNIDASQLKLPIKWDDDI 126
           D   L+ +L+ EG NS AD+ +  D   I  A + GL A  +S + A ++   ++  D  
Sbjct: 64  DD-ELIERLKAEGANSPADVFITVDAGRIWRADQAGLLAPVQSEVLAERIPEALRHPDGH 122

Query: 127 FVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG 186
           +           YDK ++++PP+ + +L +     ++  +   T+   L LL       G
Sbjct: 123 WFGVSTRARVIFYDKDKVSEPPQTYADLADPKYKGQVCARSG-TNIYMLSLLASQIAHNG 181

Query: 187 DNSAQVWKK-IATKTATVTKGW-TESYGFFLKGESDFVLSYSTSPGFYLLNY------GQ 238
           + +A+ W + +    A   +G  T+       GE    LS +    +Y +        G 
Sbjct: 182 EEAAKAWAQGLKDNLAREPQGGDTDQLRGIASGECAIALSNT----YYFVRAITGSVEGL 237

Query: 239 DDYVAAL-------FSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWM 291
            D V  +          G ++ I   A    +   + A +FM+++ S S Q      N  
Sbjct: 238 SDAVERIGIVFPDQGGNGTHVNISGVALTAHAPHAENAVKFMEYLTSESAQSYFANGNNE 297

Query: 292 YPVVD 296
           YPVV+
Sbjct: 298 YPVVE 302


>gi|56698111|ref|YP_168483.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Ruegeria pomeroyi DSS-3]
 gi|56679848|gb|AAV96514.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Ruegeria pomeroyi DSS-3]
          Length = 349

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 116/286 (40%), Gaps = 29/286 (10%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAA 86
           A+  L +Y+   +  DE    ++   FE      +  I G +D   L+ +++ EG NS A
Sbjct: 33  AEGELNLYSSRHYDTDE----RLYTDFEEATGIRINRIEGKAD--ELIARMQAEGANSPA 86

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA--FIYDKRQI 144
           D++L  D + +  A++ GL    +    + ++P    D     + +   A  + YDK  +
Sbjct: 87  DVLLTVDTSRLARAKEAGLLQAIDSAVLEDRIPANLQDSDNQWFGFSQRARLYFYDKAGV 146

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTAT 202
           + PP  + +L +     ++  +   T+T    LL  I   +G++ A+ W +  +A     
Sbjct: 147 SAPPATYLDLADPAYKGQVCIR-SSTNTYNQTLLAAIITHHGEDVARDWAESVVANMARE 205

Query: 203 VTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNY---------GQDDYVAALF----SEG 249
              G T+     + GE    +S S    +Y             G+ D +   F    +EG
Sbjct: 206 PQGGDTDQLRGIVSGECGIAVSNS----YYFARALRSDVKGLSGEIDKIGIAFPSQDAEG 261

Query: 250 HYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
            ++ +        +     A +F++++ S   Q      N  YP V
Sbjct: 262 AHMNLSGGGVAAHAPNRDNAVKFLEYLASDQAQVYFSNGNDEYPAV 307


>gi|78213103|ref|YP_381882.1| putative iron ABC transporter, substrate binding protein
           [Synechococcus sp. CC9605]
 gi|78197562|gb|ABB35327.1| putative iron ABC transporter, substrate binding protein
           [Synechococcus sp. CC9605]
          Length = 334

 Score = 52.4 bits (124), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/306 (22%), Positives = 125/306 (40%), Gaps = 46/306 (15%)

Query: 17  VISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNK 76
           V S+  L  + AK V  VY+   +  D  A    KQ F  +   +++LI  + G++L+ +
Sbjct: 11  VASFAALPSVEAKEV-RVYSGRHYNTDRAA---YKQ-FSDETGIKVRLIEAT-GISLVER 64

Query: 77  LRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLA 136
           L+ EGENS AD++L  D   I+ A + GL    +    Q  +P ++ D    P +  +  
Sbjct: 65  LKREGENSNADVILLVDAARINNAAEAGLLQPVSSSELQSNVPSRYRD----PSNR-WFG 119

Query: 137 FIYDKRQITQPP--------KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDN 188
           F    R I   P        K + +L N     K+  +  R +     L+     + G N
Sbjct: 120 FTRRVRAIIVNPNVVDPKTIKTYSDLANPALKEKLCLRK-RKNVYNQSLVADQIILKGKN 178

Query: 189 SAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSP-GFYLLNY----------- 236
           +A VW K   K  +           +  G+   + +      G  L+N+           
Sbjct: 179 AASVWVKGMVKNVSQP---------YFGGDVSLIRAVGQGKCGVGLVNHYYLARMQAGAS 229

Query: 237 GQDDY-----VAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWM 291
           G++D      +  +     ++ I  A     +K    A +F++F+ SP   R++    + 
Sbjct: 230 GKNDQKVTSNIELVMPNPAHVNISAAGVAKSAKNKAEAIQFIEFISSPKGSRLIAGPTFE 289

Query: 292 YPVVDI 297
           YP+ ++
Sbjct: 290 YPLKNL 295


>gi|114704630|ref|ZP_01437538.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Fulvimarina pelagi HTCC2506]
 gi|114539415|gb|EAU42535.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Fulvimarina pelagi HTCC2506]
          Length = 354

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/281 (19%), Positives = 114/281 (40%), Gaps = 25/281 (8%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + +Y+   +  DE    ++   FE +    +  I   D   L+ ++  EG+NS AD+VL 
Sbjct: 42  VNLYSSRHYDTDE----RLYSDFEEQTGITINRI-EGDADELIARIEAEGDNSPADVVLT 96

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDD--DIFVPYDYGYLAFIYDKRQITQPPK 149
            D + ++ A+  G+      +  + ++P ++ D  + +  +      F Y+K  +  PP+
Sbjct: 97  VDTSRLERAKGAGILQPVESETLEERIPDQYQDTENEWFGFSLRSRIFFYNKDDVQNPPQ 156

Query: 150 NFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTKGW 207
            + +L N      I  +    +     LL  I +  G  +A+ W +  +         G 
Sbjct: 157 TYADLANDEYKGMICIR-SSGNVYNQTLLASIIENQGKEAAREWAQGVVDNLARDPQGGD 215

Query: 208 TESYGFFLKGESDFVLSYSTSPGFYLLNYGQD--------DYVAALF----SEGHYLQIE 255
           T+     + GE D  +S +    ++      D        D +  +F    + G ++ + 
Sbjct: 216 TDQLRGLVSGECDIAVSNTY---YFARALASDVEGVSSGADQIGWVFPNQDTTGAHVNLS 272

Query: 256 VAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD 296
                  S   + A  F++++ S S Q+     N  YPVV+
Sbjct: 273 GGGVAANSPNRENAVAFLEYLASDSAQQYFAAGNNEYPVVE 313


>gi|57505756|ref|ZP_00371682.1| iron transport protein [Campylobacter upsaliensis RM3195]
 gi|57016029|gb|EAL52817.1| iron transport protein [Campylobacter upsaliensis RM3195]
          Length = 334

 Score = 52.0 bits (123), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 119/299 (39%), Gaps = 32/299 (10%)

Query: 17  VISYCTLD-GLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLN 75
           + S C L   L     L +Y+   + AD     +I + FE K   ++     +    L+ 
Sbjct: 4   IFSLCLLGFSLLGAAELNIYSARHYDAD----FQIIKKFEEKTGIKINHTQ-AKASELIK 58

Query: 76  KLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYL 135
           +L +EG NS ADI +  D + +  A+  GL +  +    +  +P    D      D  + 
Sbjct: 59  RLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEKFIPAHLRDK-----DKKWF 113

Query: 136 AFIYDKRQIT---------QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG 186
           A     R I             KN+++L       +I+ +   T+     LL  I    G
Sbjct: 114 AITKRARIIAYNKNANIDISKMKNYEDLAKPEFKGEIVMRSA-TAPYSKTLLASIIANDG 172

Query: 187 DNSAQVWKK-IATKTATVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY--- 241
           +  A+ W K +    AT  KG           GE+ F +  +   G    +    D    
Sbjct: 173 NKKAKAWAKGVLENLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVG 232

Query: 242 --VAALF----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
             +  +F    + G ++ I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 233 NSLGIIFPNQDNRGAHINISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|153952205|ref|YP_001397430.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939651|gb|ABS44392.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. doylei 269.97]
          Length = 334

 Score = 51.6 bits (122), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYDAD----FEIMKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFMT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +   +  GL +  +    +  +P    D      D  + AF    R I       
Sbjct: 75  GDISNLTEVKNLGLLSPVSSKYLEEFIPAHLKDK-----DKEWFAFAKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L       +I  +   T+     LL  I    G+ +A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKPEFKGEIAMRSA-TAPYSKTLLASIIANDGNKNAKTWAKGVLDNLA 188

Query: 202 TVTKGWTESYG-FFLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARLVFAGEAKFAIMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK   +A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDVAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|254502107|ref|ZP_05114258.1| Bacterial extracellular solute-binding protein, putative [Labrenzia
           alexandrii DFL-11]
 gi|222438178|gb|EEE44857.1| Bacterial extracellular solute-binding protein, putative [Labrenzia
           alexandrii DFL-11]
          Length = 343

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 60/281 (21%), Positives = 115/281 (40%), Gaps = 27/281 (9%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           L +Y+   +  DE    ++   FE +   ++  I G +D   LL ++  EG+NS ADI+L
Sbjct: 31  LNLYSSRHYDTDE----RLYSDFEEQSGIKINRIEGKAD--ELLTRMEAEGQNSPADILL 84

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D + ++ A+  GL         + +LP  ++ DD+ +  +        YDK ++ +PP
Sbjct: 85  TVDTSRLERAKGMGLLQSVESPVLEQRLPGYVQDDDNQWFGFSQRARIIFYDKEKVAEPP 144

Query: 149 KNFDELINSTKPWKIIYQDPR---TSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATV 203
           + + +L +      I  +      T T+   L+  +    G+ + + W    +       
Sbjct: 145 RTYQDLADPKYKGMICIRSSSNVYTQTITAALIEHL----GEEAVKDWATAVVGNFARDP 200

Query: 204 TKGWTESYGFFLKGESDFVLSYSTSPGFYLLN--YGQDDYVAALF-------SEGHYLQI 254
             G T+     + GE    +S +   G  L     G  D VA +        + G ++ +
Sbjct: 201 QGGDTDQLRGIVSGECAIAMSNTYYFGRALRKPVKGLSDDVAKIGWVFPNQDNIGAHMNL 260

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
                   S   + A +F++++ S   Q+     N  YP V
Sbjct: 261 SGGGVAKHSPNKENAIKFLEYLASDQAQQYFSAGNDEYPAV 301


>gi|126738244|ref|ZP_01753965.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. SK209-2-6]
 gi|126720741|gb|EBA17446.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. SK209-2-6]
          Length = 338

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/316 (20%), Positives = 122/316 (38%), Gaps = 39/316 (12%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAA 86
           A+  L +Y+   +  DE    ++   FE      +  I G +D   L+ +++ EG NS A
Sbjct: 22  AEGELNLYSSRHYDTDE----RLYSDFEEATGITINRIEGKAD--ELIARMQAEGANSPA 75

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFI--YDKRQI 144
           D++L  D + +  A+  G+      D  + ++P    D     +     A I  YDK  +
Sbjct: 76  DVLLTVDTSRLARAKNAGILQSIESDTLEARVPAYLQDSDNQWFGLSQRARIIFYDKNDL 135

Query: 145 TQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTAT 202
             PP+ + +L +     K+  +   ++T    LL  I   +G+  A  W    +A     
Sbjct: 136 KNPPRTYLDLADPAYAGKVCIRS-SSNTYNQTLLASIVTHHGEEKAAEWADGVVANMARA 194

Query: 203 VTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNY-----GQDDYVAALF----SEGHYLQ 253
              G T+     + GE +  +  S      +  +        D +  +F    +EG ++ 
Sbjct: 195 PQGGDTDQLRGLVSGECEIAVGNSYYFARSIRKHVKGVSDSRDMIGWIFPAQDAEGAHMN 254

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV------------------ 295
           +  A     +   + A +F++++ S   Q      N  YP V                  
Sbjct: 255 LSGAGVAAHAPNRENAIKFLEYLASDQAQEYFSAGNDEYPGVPGVGLAPSIAALGHFKPD 314

Query: 296 DISMPDVYQAIRIPQK 311
           D+S+ +V + I   QK
Sbjct: 315 DVSLAEVAKNIPTAQK 330


>gi|238927175|ref|ZP_04658935.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas flueggei ATCC 43531]
 gi|238884957|gb|EEQ48595.1| Fe3+ ABC superfamily ATP binding cassette transporter, binding
           protein [Selenomonas flueggei ATCC 43531]
          Length = 337

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 70/335 (20%), Positives = 136/335 (40%), Gaps = 15/335 (4%)

Query: 5   ARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKL 64
           A +++G+  I  ++   T+   PA     V  YN    D  A   I + F+ +   +++L
Sbjct: 12  AALLLGVNFI--LVGCGTVRQDPADDENLVVVYNCGTEDWTA--PIAKEFQEETGIQVRL 67

Query: 65  IGLSDGVALLNKLRMEGENSAADIVLG-FDNNLIDLARKTGLFAKSNIDASQLKLPIKWD 123
           +  S   AL+ ++R E EN   D++ G  ++  I LA     +     DA +     +  
Sbjct: 68  VSDSSD-ALMTRVRTEQENPRGDVLWGGMEDTYIFLASYLERYEYPEKDALRGNFSCEGA 126

Query: 124 DDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
               +  D   +A+  D       P  + +L+N      I   DP  S     +L+ +  
Sbjct: 127 AFCSMTMDPYVIAYNTDLVDAEHAPAGWSDLLNPQFRGHIALADPTKSISSYDVLITMMD 186

Query: 184 IYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNY-GQDDYV 242
           + G +SA + +        VT    E     +K  +D     + +P   +L Y     ++
Sbjct: 187 VLGGDSAVISRMADQLDGRVTSTSAEQ----IKALADGAYMVTATPEQAVLKYRAAGAHI 242

Query: 243 AALF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP- 300
             ++  EG  +     A +  +   + A++F+ F++S      L          D+S P 
Sbjct: 243 QIVYPQEGTRVSSTGIAVIKNAPHMENAKKFLNFVMSRQVHERLGVYERRSARADVSAPP 302

Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335
           ++     I  +  RF+A     +R++++S W+ AV
Sbjct: 303 NLLPLAEI--RCTRFDARRAVAFRDEFLSKWRAAV 335


>gi|57237180|ref|YP_178192.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni RM1221]
 gi|57165984|gb|AAW34763.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni RM1221]
 gi|315057612|gb|ADT71941.1| Ferric iron ABC transporter, iron-binding protein [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 334

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYNAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIA 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKKAKAWAKGVLENLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|304392918|ref|ZP_07374849.1| iron uptake protein A1 [Ahrensia sp. R2A130]
 gi|303294916|gb|EFL89285.1| iron uptake protein A1 [Ahrensia sp. R2A130]
          Length = 344

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 102/241 (42%), Gaps = 22/241 (9%)

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDY 132
           L+ +++ EG NS AD++L  D   ++ A+  G+   +     + ++P    D     + +
Sbjct: 66  LIERMKAEGANSPADVLLTVDTTRLERAKTAGVLQSTESAVLEERIPANLQDADNQWFGF 125

Query: 133 GYLA--FIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
              A  F YDK  +T+PP+ +  L +     ++ ++   T+     LL  + + +G  +A
Sbjct: 126 SQRARIFFYDKADVTEPPQTYVALADPKYKGQVCHRSS-TNVYTQTLLSAVIENHGAEAA 184

Query: 191 QVWKK-IATKTATVTKGW-TESYGFFLKGESDFVLS----YSTS--------PGFYLLNY 236
           + W + +    A   +G  T+     + GE D  +S    ++ S        P     N 
Sbjct: 185 KAWAQGVVDNFAREPQGGDTDQLRGLVSGECDISVSNTYYFARSIRKDVKGLPADARENI 244

Query: 237 GQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQ--EFMQFMISPSFQRILPTTNWMYPV 294
           G   +V    +E     + ++   V    P  A   +F++++ S S Q+     N  YP 
Sbjct: 245 G---FVFPKMTETAGAHVNLSGGGVAKNSPNKANAVKFLEYLASDSAQQYFSAGNDEYPA 301

Query: 295 V 295
           V
Sbjct: 302 V 302


>gi|149928062|ref|ZP_01916310.1| putative iron binding protein component of ABC iron transporter
           [Limnobacter sp. MED105]
 gi|149823250|gb|EDM82486.1| putative iron binding protein component of ABC iron transporter
           [Limnobacter sp. MED105]
          Length = 344

 Score = 51.6 bits (122), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/307 (21%), Positives = 130/307 (42%), Gaps = 32/307 (10%)

Query: 7   IVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIG 66
           I V I  + GV +    +    + V+ +Y+   +  DE    K+ + F ++    +K + 
Sbjct: 9   ISVSIAGLIGVSAAAQAN----EKVINLYSARHYSTDE----KMYEDFTKQTGIAIKRLE 60

Query: 67  LSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF--AKSNIDASQLKLPIKWDD 124
           L D  ALL ++R EG  S AD+VL  D   +  A++ GLF   KS + + ++      ++
Sbjct: 61  LGD-EALLERMRSEGARSPADVVLLVDAARLATAQQDGLFQPVKSKVLSEKIPAQFTGEN 119

Query: 125 DIFVPYDYGYLAFIYDKRQIT-QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQK 183
            ++  +       +Y+K  +  +  +N+++L       K+  +      + L L+  +  
Sbjct: 120 GLWHAFSARSRVIVYNKANVDPKLAQNYEDLAKPALKGKVCTRTGSHPYM-LSLMSSMIS 178

Query: 184 IYGDNSAQVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFY---LLNYG- 237
             G+  A+ W +  +A    +   G T+       GE    L+ S    +Y   LLN   
Sbjct: 179 HLGEKGAETWAQGVVANMARSPKGGDTDQIRAVASGECGVALTNS----YYWVRLLNSSK 234

Query: 238 -QDDYVAALF--------SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTT 288
            +D  V +          S G ++ +   A    +   + A +F++++ S S Q+     
Sbjct: 235 PEDKEVVSKVGFIWPNQSSYGVHMNVSGGAVAKNAPNREGAIKFLEYLASDSAQKYFANG 294

Query: 289 NWMYPVV 295
           N  +P V
Sbjct: 295 NNEWPTV 301


>gi|86149659|ref|ZP_01067889.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839927|gb|EAQ57186.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 334

 Score = 51.2 bits (121), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYNAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNTN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLENLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|86151205|ref|ZP_01069420.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|205356575|ref|ZP_03223338.1| putative iron uptake ABC transport system periplasmic iron binding
           protein [Campylobacter jejuni subsp. jejuni CG8421]
 gi|85841552|gb|EAQ58799.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 260.94]
 gi|205345580|gb|EDZ32220.1| putative iron uptake ABC transport system periplasmic iron binding
           protein [Campylobacter jejuni subsp. jejuni CG8421]
          Length = 334

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYNAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLENLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|86153893|ref|ZP_01072096.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88597262|ref|ZP_01100497.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|148926341|ref|ZP_01810025.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|218561854|ref|YP_002343633.1| putative iron-uptake ABC transporter,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|85842854|gb|EAQ60066.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni HB93-13]
 gi|88190323|gb|EAQ94297.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359560|emb|CAL34344.1| putative iron-uptake ABC transport system,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni NCTC 11168]
 gi|145844733|gb|EDK21838.1| putative iron-uptake ABC transport system periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni CG8486]
 gi|284925467|gb|ADC27819.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni IA3902]
 gi|315929092|gb|EFV08323.1| extracellular solute-binding protein, family 1 [Campylobacter
           jejuni subsp. jejuni 305]
          Length = 334

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYNAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNTN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLENLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|222824508|ref|YP_002576082.1| ABC transporter, periplasmic binding protein [Campylobacter lari
           RM2100]
 gi|222539729|gb|ACM64830.1| ABC transporter, periplasmic binding protein [Campylobacter lari
           RM2100]
          Length = 334

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 118/280 (42%), Gaps = 26/280 (9%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           LT+Y++  + AD+G    I + F+ K    + ++  +    L  +L +EG+NS AD+ + 
Sbjct: 21  LTIYSHRHYDADKG----IFKLFQEKTGISVNVV-QAKANELAKRLEVEGKNSKADLFMT 75

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKL----PIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
            D   ++  R   LF   ++ + +L+      ++  ++ +  +       I  K +I   
Sbjct: 76  ADAGNLEQVRTNNLFV--SVSSPELEKLSPKELRGKNNEWYAFTTRARIIIVSKDRIKDG 133

Query: 148 P-KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTATVTK 205
             K +++L +     K++ +    +   + LL  +    G   A+ W + IA   A   K
Sbjct: 134 EIKTYEDLADPKFKGKVLVRSS-NNVYNISLLSAMIDTLGKEKAKEWAQGIANNLARTPK 192

Query: 206 GWTES--YGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA-----LF----SEGHYLQI 254
           G         + K E D  +S S   G    +    D  AA     +F      G ++ +
Sbjct: 193 GGDRDQIRAIYAK-EGDVAISNSYYLGHLANSKNPKDVEAANSVKVIFPNQDDRGTHINV 251

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
                L  SK    A +F++FM+S   Q IL   N+ YPV
Sbjct: 252 SGIGVLKTSKNKDAAVKFIEFMLSKEAQEILTNQNYEYPV 291


>gi|315927786|gb|EFV07112.1| extracellular solute-binding protein, family 1 [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 328

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 14  LNIYSARHYNAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 68

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 69  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNTN 123

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 124 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLENLA 182

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 183 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 242

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 243 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 285


>gi|60594117|pdb|1Y4T|A Chain A, Ferric Binding Protein From Campylobacter Jejuni
 gi|60594118|pdb|1Y4T|D Chain D, Ferric Binding Protein From Campylobacter Jejuni
 gi|255917854|pdb|3E13|X Chain X, Iron Reconstituted Ferric Binding Protein From
           Campylobacter Jejuni
          Length = 322

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 4   LNIYSARHYNAD----FEIIKKFEEKTGIKVNHT-QAKASELIKRLSLEGSNSPADIFIT 58

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 59  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNTN 113

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 114 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLENLA 172

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 173 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 232

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 233 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 275


>gi|259417604|ref|ZP_05741523.1| extracellular solute-binding protein, family 1 [Silicibacter sp.
           TrichCH4B]
 gi|259346510|gb|EEW58324.1| extracellular solute-binding protein, family 1 [Silicibacter sp.
           TrichCH4B]
          Length = 336

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 124/303 (40%), Gaps = 33/303 (10%)

Query: 13  MITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGV 71
           + T VI+        A  V+ +Y+   +  DE    ++   FE      +  I G +D  
Sbjct: 5   VFTTVIAASLATTAVADGVVNLYSSRHYDTDE----RLYSDFEEATGITINRIEGKAD-- 58

Query: 72  ALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYD 131
            L+ +++ EG NS AD+++  D + ++ A+  G+    +    + ++P    D     + 
Sbjct: 59  ELIARIQAEGANSPADVLITVDTSRLERAKDAGVLQSIDSKVLEERIPANLQDSDNQWFG 118

Query: 132 YGYLAFI--YDKRQITQPPKNFDELINSTKPW--KIIYQDPRTSTLGLGLLLWIQKIYGD 187
           +   A I  YDK  +T PP  + +L    KP    ++     ++     LL  I + +G+
Sbjct: 119 FSQRARIVFYDKADVTNPPATYMDL---AKPEYKGMVCHRSSSNVYSQTLLSAIIENHGE 175

Query: 188 NSAQVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY---- 241
             A+ W +  +A        G T+     + GE D  ++ +    +Y     + D     
Sbjct: 176 EEARKWAEGIVANFARDPQGGDTDQLRGLISGECDVSIANT----YYFARALRKDVKGLS 231

Query: 242 -----VAALF----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMY 292
                +  +F    +EG ++ +  A     +   + A +F++++ S   Q+     N  +
Sbjct: 232 ADIEKIGVVFPAQDAEGAHMNLSGAGVAANAPNRENAIKFLEYLASDQAQQYFSGGNDEF 291

Query: 293 PVV 295
           P V
Sbjct: 292 PAV 294


>gi|149915720|ref|ZP_01904245.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. AzwK-3b]
 gi|149810302|gb|EDM70147.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. AzwK-3b]
          Length = 340

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 96/242 (39%), Gaps = 26/242 (10%)

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDY 132
           L+ +++ EG+NS AD+ L  D      A + G+    + D    ++P    D   + +  
Sbjct: 63  LIARMQAEGDNSPADVFLTVDVGRASRAEEAGVLQAFSSDVIDERIPPHLRDPENMWFGV 122

Query: 133 GYLAFI--YDKRQITQPPKNFDELINSTKPWK-IIYQDPRTSTLGLGLLLWIQKIYGDNS 189
              A I  Y K ++  PP+ ++EL +    WK  I     ++   L LL  +  ++G+ +
Sbjct: 123 SQRARIIFYAKDRVENPPRTYEELADPK--WKDTICIRSGSNIYNLSLLAGLIDVHGEEA 180

Query: 190 AQVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS 247
           A+ W    +A        G T+     + GE D  +S      +Y L  G +  V  L S
Sbjct: 181 ARDWASGVLANMARPPQGGDTDQLRGIVSGECDIAVSNQ----YYYLR-GFEGEVEGLTS 235

Query: 248 --------------EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYP 293
                          G ++ +  AA+   +     A + ++F  S   Q      N  YP
Sbjct: 236 GLDNLGFVWPNQGDRGAHVNLSTAAKAANAPNSDEADQLLEFFTSDFAQAHFAGQNNEYP 295

Query: 294 VV 295
            V
Sbjct: 296 AV 297


>gi|237793897|ref|YP_002861449.1| spermidine/putrescine transport system permease protein
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum Ba4 str. 657]
 gi|229263495|gb|ACQ54528.1| spermidine/putrescine transport system permease protein
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum Ba4 str. 657]
          Length = 614

 Score = 50.8 bits (120), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 89/358 (24%), Positives = 150/358 (41%), Gaps = 44/358 (12%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TG+    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 264 VKKILSFIVILLMVTGI--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 316

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   S
Sbjct: 317 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLS 374

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +F++L +S  K   +I  DP
Sbjct: 375 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFNDLWDSQFKNSMVILDDP 434

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKK---IATKTATVTKGWTES-YGFFLKGESDFVLS 224
           R   +GL L      I   N  ++ K    +      V    +ES     + GES     
Sbjct: 435 RV-MIGLALQKNGYSINTKNPKELQKAKEDLIKLMPNVKAFDSESPKTLLINGESSIGYV 493

Query: 225 YSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFM----ISPS 280
           + T    YL      +    L  EG   Q +      ++K  +LA+EF+ F+    +S  
Sbjct: 494 WGTEA--YLAKLENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIYKPEVSAQ 551

Query: 281 FQRILPTTN---WMYPVVDIS-MPDVYQAIRIPQKSLRFN------AEETTRYRNQWI 328
                P  N     YP++D + + D+  A+  P++++  N       E T  Y + WI
Sbjct: 552 VSEEFPYANPNKAAYPLMDKNKLNDI--AVYPPREAIEGNELIQDVGETTKLYDDIWI 607


>gi|315931985|gb|EFV10938.1| extracellular solute-binding protein, family 1 [Campylobacter
           jejuni subsp. jejuni 327]
          Length = 328

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 14  LNIYSARHYDAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 68

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 69  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 123

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 124 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLDNLA 182

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 183 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 242

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 243 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 285


>gi|88608833|ref|YP_505908.1| iron-binding protein [Neorickettsia sennetsu str. Miyayama]
 gi|88601002|gb|ABD46470.1| iron-binding protein [Neorickettsia sennetsu str. Miyayama]
          Length = 335

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/253 (21%), Positives = 108/253 (42%), Gaps = 22/253 (8%)

Query: 69  DGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFV 128
           D   L+++++ EG N++AD+ L  D   + LA   GL    +    +  LP +  D  + 
Sbjct: 56  DATKLISRMKSEGVNTSADVFLAADVINLALAEAEGLLQCISSTVLENALPPELRDCYWF 115

Query: 129 PYDYGYLAFIYDKRQITQPP-KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
                    +Y K ++     +N+++L +S    +++ +    S     L+  +    G+
Sbjct: 116 GLTRRMAVIVYSKERVDPSEIRNYEDLADSKWKDRLLLRSS-NSPYNRSLIASVILANGE 174

Query: 188 NSAQVW-KKIATKTATVTKGW-TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD----- 240
             A+ W K I    A    G  T+       GE D  +  S    +YL      D     
Sbjct: 175 EKAEAWIKGIVRNMARPPYGGDTDQIKGVASGEGDLTVVNS----YYLARILSSDKETHK 230

Query: 241 ----YVAALF----SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMY 292
                V  +F    + G ++ I  A     +K  + A++F+++M++   Q++  + N+ Y
Sbjct: 231 KVAQRVGVIFPNQENRGTFVNISGAGVAKNAKHKENAKKFLEYMVTEEAQKLYVSRNYEY 290

Query: 293 PVV-DISMPDVYQ 304
           PVV  + +P++ +
Sbjct: 291 PVVASVEIPEILK 303


>gi|318041954|ref|ZP_07973910.1| ABC-type Fe3+ transport system, periplasmic component
           [Synechococcus sp. CB0101]
          Length = 346

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/276 (22%), Positives = 114/276 (41%), Gaps = 21/276 (7%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           + VY+   +  D+    ++ + F  +   ++KL+   D  AL+ ++R EG+NS AD+++ 
Sbjct: 37  IGVYSGRHYNTDK----ELYRQFTARTGIKVKLLEAKDD-ALIERVRSEGKNSPADVLVL 91

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDI---FVPYDYGYLAFIYDKRQITQPP 148
            D   +D A   GLF  +        +P    D     F       +A +  K       
Sbjct: 92  VDAARLDKATDLGLFRPTRSTTLMRDVPANLRDSQGRWFGLTRRVRVAAVNPKLVNPASI 151

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           + + +L N     K+  +D + S     L+     + GD +A  W  +   T+ VTK + 
Sbjct: 152 RTYADLANPALKGKLCLRDSK-SVYNQSLVADQMILRGDAAAAQW--VKGMTSNVTKPYF 208

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNY------GQDDYVAA----LFSEGHYLQIEVAA 258
            S    ++  ++          +Y+         G D  +A+    +F    ++ I  A 
Sbjct: 209 TSDTPLIRAIANGQCGVGLVNTYYVARMLSGDSGGADKALASKLKVVFPNPAHVNISGAG 268

Query: 259 QLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
            +  SK P  AQ+ ++F+ SPS  R     N  YP+
Sbjct: 269 VVKTSKNPAAAQKLIEFLASPSGGRGYAEANNEYPL 304


>gi|157414489|ref|YP_001481745.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81116]
 gi|157385453|gb|ABV51768.1| iron transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|307747132|gb|ADN90402.1| Iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni M1]
          Length = 334

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYDAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLDNLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|159038208|ref|YP_001537461.1| extracellular solute-binding protein [Salinispora arenicola
           CNS-205]
 gi|157917043|gb|ABV98470.1| extracellular solute-binding protein family 1 [Salinispora
           arenicola CNS-205]
          Length = 347

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 65/138 (47%), Gaps = 7/138 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK-SNID 112
           FE++    +++I    G  ++++L+ E  N  AD+V+      I  A   GL    +   
Sbjct: 58  FEKQTGIAVQMIEAGSG-EVVSRLQKEKANVQADLVVTL-PPYIQKADADGLLQPYTPAG 115

Query: 113 ASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTST 172
           A Q    +    D +VP    YL FIY+  ++   P  FD+L++ T   K+ Y  P  + 
Sbjct: 116 ADQ----VTGATDTYVPLVDNYLCFIYNPDKVDTAPTTFDDLLSPTFAKKLQYSTPGQAG 171

Query: 173 LGLGLLLWIQKIYGDNSA 190
            G  +LL +Q I G + A
Sbjct: 172 DGTAVLLHLQHILGKDKA 189


>gi|283955621|ref|ZP_06373114.1| putative iron-uptake ABC transport system,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792846|gb|EFC31622.1| putative iron-uptake ABC transport system,periplasmic iron-binding
           protein [Campylobacter jejuni subsp. jejuni 1336]
          Length = 334

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 115/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYDAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGNNSPADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G   A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKAEFKGEIVMRSA-TAPYSKTLLASIIANDGSKEAKAWAKGVLENLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFY-----LLNYGQDDYVAALF----SEGHY 251
           T  KG           GE+ F +  +   G       L +    + +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNLKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK    A++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAAKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|227327528|ref|ZP_03831552.1| ABC transporter substrate binding protein [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 326

 Score = 50.4 bits (119), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 114/267 (42%), Gaps = 14/267 (5%)

Query: 31  VLTVYTYNSFVADEGA-GPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIV 89
            LT+YT     A  GA   K+   +E++   ++ +   + G  ++ +L  E  N  ADI+
Sbjct: 30  ALTLYT-----AGPGALAKKLAAGYEKQTGVKVDVFQATTG-KVMARLEAEQANPRADIL 83

Query: 90  LGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
           +    +   DL ++  L    + +A+   +P ++    +V      L  +++ +  T  P
Sbjct: 84  ISASWDTATDLQQRGWLLEFDSPNAA--TVPAQFKTPFYVAQGISALGIVWNSKSGTPEP 141

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
           K++++L       K+   DP  S   L LL+ +Q    D + +++ ++      +     
Sbjct: 142 KDWNDLTKPEFKDKVTTPDPALSGASLDLLIGLQNAEKDKAWEMFDRLKANGMIIAGPNA 201

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALF-SEGHYLQIEVAAQLVRSKQPQ 267
           ++    L+G    V        +  +  G+   +  +F S G  +       L  SK  Q
Sbjct: 202 QALTPVLQGAKAAVFGAVDYVSYGSMESGES--IKVIFPSSGTVIAPRPMMILKSSKNQQ 259

Query: 268 LAQEFMQFMISPSFQRILPTTNWMYPV 294
            A++F+ +M+SP  Q+ +    W+ P 
Sbjct: 260 QAKDFINYMLSPEGQKAV-AEAWLMPA 285


>gi|187921185|ref|YP_001890217.1| family 1 extracellular solute-binding protein [Burkholderia
           phytofirmans PsJN]
 gi|187719623|gb|ACD20846.1| extracellular solute-binding protein family 1 [Burkholderia
           phytofirmans PsJN]
          Length = 407

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 89/224 (39%), Gaps = 19/224 (8%)

Query: 128 VPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGD 187
           V    GY A  + K  I  P  +++         KI  Q P T+T GL  L+ + +  G 
Sbjct: 189 VATGIGYNADAFKKANIPAP-DSWNVFTEKRLDGKIAIQ-PITNTYGLHTLIMLARANGG 246

Query: 188 NSAQVWKKIATKTATVTK---GWTESYGFF--LKGESDFVLS-YSTSPGFYLLNYGQDDY 241
           +   + K  A    +V+     W  + G    L    D +L+ Y +     L   G   +
Sbjct: 247 SENDINKGFAVMVKSVSPNVLSWASTSGELDSLMQSGDVILAPYGSGRAMALRKTG---F 303

Query: 242 VAALF--SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISM 299
              L    EG       A  LV + QP+L+Q+F+Q+++SP  QR+      + PV     
Sbjct: 304 PLKLVYPKEGAVALQAAACVLVENSQPELSQQFVQYLLSPEVQRLQAENIGLGPVNKTVK 363

Query: 300 PDVYQAIRIP------QKSLRFNAEETTRYRNQWISSWQNAVSR 337
            +   A  +P       K    N +   ++R +W   W  +V R
Sbjct: 364 LNADVAANVPYGPEQISKLTTVNWDVINQHRTEWTGRWNRSVER 407


>gi|50120285|ref|YP_049452.1| ABC transporter substrate binding protein [Pectobacterium
           atrosepticum SCRI1043]
 gi|49610811|emb|CAG74256.1| ABC transporter substrate binding protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 326

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 124/291 (42%), Gaps = 21/291 (7%)

Query: 7   IVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGA-GPKIKQAFERKCNCELKLI 65
           I++GI      +S   + G  +   LT+YT     A  GA   K+   +E++   ++ + 
Sbjct: 13  IIMGI-----ALSLAAVTG--SAHALTLYT-----AGPGALAKKLAAGYEKQTGVKVDVF 60

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDD 124
             + G  ++ +L  E  N  AD+++    +   DL ++  L    + +A+   +P ++  
Sbjct: 61  QATTG-KVMARLEAEQANPRADVLISASWDTATDLQQRGWLLEFDSPNAA--TVPAQFKT 117

Query: 125 DIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKI 184
             +V      L  +++ +  T  PK++++L       K+   DP  S   L LL+ +Q  
Sbjct: 118 PFYVAQGISALGIVWNSKSGTPEPKDWNDLTKPEFKDKVTTPDPALSGASLDLLIGLQNA 177

Query: 185 YGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA 244
             D + +++ ++      +     ++    L+G    V        +  +  G+   +  
Sbjct: 178 EKDKAWEMFDRLKANGMIIAGPNAQALTPVLQGAKTAVFGAVDYVSYGSMESGES--IKV 235

Query: 245 LF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           +F S G  +       L  SK  Q A++F+ +M+SP  Q+ +    W+ P 
Sbjct: 236 IFPSSGTVIAPRPMMILKSSKNQQQAKDFINYMLSPEGQKAV-AEAWLMPA 285


>gi|319946702|ref|ZP_08020936.1| spermidine/putrescine ABC superfamily ATP binding cassette
           transporter, binding protein [Streptococcus australis
           ATCC 700641]
 gi|319746750|gb|EFV99009.1| spermidine/putrescine ABC superfamily ATP binding cassette
           transporter, binding protein [Streptococcus australis
           ATCC 700641]
          Length = 356

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 86/195 (44%), Gaps = 30/195 (15%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAK----------PVLTVYTYNSFVADEGAGPKI 50
           MKK    ++GI+++  V++     GL A+            L +Y +  ++      P++
Sbjct: 1   MKKLYSFLLGIVVVILVLA-----GLSARLEAKTNPKDSDKLVIYNWGDYI-----DPEL 50

Query: 51  KQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG--------FDNNLIDLARK 102
            + F ++   +++        A+  K++  G  +A DI +          D NL++   K
Sbjct: 51  LEEFTKETGVQVQYNTFDSNEAMYTKIKQGG--TAYDIAIPSEYMIAKMMDENLLEKLDK 108

Query: 103 TGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWK 162
           + L    NID   L L    D+   VPY +G L  IY+ + + + P+++++L        
Sbjct: 109 SKLKGLDNIDPRFLDLDFDPDNQYSVPYFWGTLGIIYNSKMVDKAPEHWEDLWRPEYKND 168

Query: 163 IIYQDPRTSTLGLGL 177
           I+  D     +G+GL
Sbjct: 169 IMMYDGAREVMGIGL 183


>gi|257059333|ref|YP_003137221.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
 gi|256589499|gb|ACV00386.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8802]
          Length = 350

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 117/283 (41%), Gaps = 30/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           + VY+   +  D     ++ + F R+   ++ LI G +D   L+ +++ EG+NS ADI++
Sbjct: 37  VNVYSSRHYNTDS----RLYENFTRQTGIKVNLIEGEAD--PLIERIKSEGKNSKADILI 90

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D   +  A + G+FA  N    Q K+P  ++     +  +       +Y K ++    
Sbjct: 91  TVDAGRLWRADQAGIFAPVNSKILQQKIPASLRHPKGHWFGFSKRLRVIMYSKARVNPSQ 150

Query: 149 -KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTK 205
              +++L N     K+I +   T+     L  W+  + G  + + W +  +A    +   
Sbjct: 151 LSTYEDLANPKWKGKVITRSS-TNIYSQSLCSWMIAVNGQGATEKWCRGLVANFARSPQG 209

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNY--GQDDYVAALFSE-----------GHYL 252
             T        G +D  L  +    +YL N    +D+   A+  +           G ++
Sbjct: 210 NDTAQIEALAAGVADLALVNT----YYLANLIDSKDEKKRAIGQQVGVFFPNQKGRGTHV 265

Query: 253 QIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
            I     +  +     A +F+++++SP  Q      N  YPVV
Sbjct: 266 NISGGGLVKTAPNRNAAVKFLEYLVSPQAQTFFAQGNLEYPVV 308


>gi|323698941|ref|ZP_08110853.1| extracellular solute-binding protein family 1 [Desulfovibrio sp.
           ND132]
 gi|323458873|gb|EGB14738.1| extracellular solute-binding protein family 1 [Desulfovibrio
           desulfuricans ND132]
          Length = 343

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 113/266 (42%), Gaps = 13/266 (4%)

Query: 46  AGPKI-KQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTG 104
            GP+I  Q FE     +++ + +S G  +L +LR E  N  AD+  G  ++    A+K G
Sbjct: 47  GGPEIIAQQFEAATGIKVEFLTMSSG-EVLTRLRAEKANPGADVWFGGGSDAFIQAKKEG 105

Query: 105 LFAK-SNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT----QPPKNFDELINSTK 159
           L A     +AS++    K  D  +       + F+ +K ++     + P  +DEL +   
Sbjct: 106 LTAPFKAPNASRVDKAFKDPDGYWTGVSLVVVGFLANKDRLAGKGLEVPMTWDELASPDY 165

Query: 160 PWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA-QVWKKIATKTATVTKGWTESYGFFLKGE 218
             ++   +  TS      +  I +I G+ +      K+      +TK  +      L GE
Sbjct: 166 RDEVSASNLNTSGTAYTTVSGILQIKGEKAGWPFLDKLYANIPFLTKSGSAPGKMALSGE 225

Query: 219 SDFVLSYSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVR-SKQPQLAQEFMQFMI 277
             F +  +  P   L N   D  +A ++     L       +V  ++ P+ A +F+ + +
Sbjct: 226 --FAVGIAPDP-HILANKNPDAPLAVVYPTDGVLAWPSPVSIVAGARHPENAGKFVDWCL 282

Query: 278 SPSFQRILPTTNWMYPVVDIS-MPDV 302
           SP  Q++L   +   P  D+  +P V
Sbjct: 283 SPEGQKVLMQASPRVPTTDVEPLPGV 308


>gi|299538510|ref|ZP_07051793.1| Fe3+ ABC transporter substrate-binding protein [Lysinibacillus
           fusiformis ZC1]
 gi|298726097|gb|EFI66689.1| Fe3+ ABC transporter substrate-binding protein [Lysinibacillus
           fusiformis ZC1]
          Length = 341

 Score = 50.1 bits (118), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 122/299 (40%), Gaps = 43/299 (14%)

Query: 31  VLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVL 90
           VLTVY+       +G    I+QAFE K   ++++   + G  +L++L  E  N  ADIV+
Sbjct: 43  VLTVYS----AGPDGLAANIQQAFEEKTGIKVEMFQGTTG-KILSRLEAEKNNPVADIVV 97

Query: 91  GFDNNLIDLARKTGLFAKSNI---DASQLKLPIKWD----DDIFVPYDYGYLAFIYDKRQ 143
                L  +A   GL A   +   +A++ K  I  D    D  F  Y    L   Y+ + 
Sbjct: 98  -----LASVASMDGLKATDQLQSYEAAKNKERINSDWSDQDGYFYGYSASALGIAYNTKN 152

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQ--------VWKK 195
            TQ P ++ +L  +    KI   DP  S   +  L      YG  +A+         WKK
Sbjct: 153 TTQAPTDWSDLATADWQNKINIPDPSLSGSAVDFL------YGYTAAEKTAWSTIDSWKK 206

Query: 196 IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNY---GQDDYVAALF-SEGHY 251
              +     K   E+    + GE +     +T  G   + Y      + V  ++ + G  
Sbjct: 207 NGLQVNGANK---EALDAVITGEKN-----ATIAGVDYMAYKAKADGEPVEIIYPTSGTV 258

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQ 310
           +       L  ++  + AQ ++ F++S   Q+++     +    DI++ +      IPQ
Sbjct: 259 VSPRAVGILKDAQHVESAQAYIDFLLSDEGQKLVADAYLLPGNKDIAVKNRAALDEIPQ 317


>gi|85703671|ref|ZP_01034775.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. 217]
 gi|85672599|gb|EAQ27456.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseovarius sp. 217]
          Length = 338

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 95/241 (39%), Gaps = 24/241 (9%)

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFA--KSNIDASQLKLPIKWDDDIFVPY 130
           L+ +++ EG NS AD+ +  D   I  A   GL     S++  + +   ++  D+++   
Sbjct: 61  LIERMKAEGANSPADVFMTVDVGNISRAVDEGLLQPFDSDLIETNVAANLRHPDNLWTGL 120

Query: 131 DYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
                   Y K ++  PP+ ++EL +     +I  +   ++     LL  I +++G+  A
Sbjct: 121 SQRSRIIFYAKDRVDAPPQTYEELADPKYKGQICIRS-SSNVYNQSLLASIIEVHGEEVA 179

Query: 191 QVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAALFS- 247
           + W +  +A        G T+     + GE D  +S +     Y    G    V  L S 
Sbjct: 180 KDWAEGIVANMARAPEGGDTDQLRGIVSGECDIAVSNT-----YYFARGLAGDVDGLTSG 234

Query: 248 -------------EGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
                         G ++ +  A     +  P  A   ++F+ S + Q      N  +PV
Sbjct: 235 IDGIGWVWPNQDDRGAHMNLVAAGITAHAPNPDEAIALLEFLASETAQAQFANANNEFPV 294

Query: 295 V 295
           +
Sbjct: 295 L 295


>gi|218246286|ref|YP_002371657.1| family 1 extracellular solute-binding protein [Cyanothece sp. PCC
           8801]
 gi|218166764|gb|ACK65501.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           8801]
          Length = 350

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/283 (20%), Positives = 117/283 (41%), Gaps = 30/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           + VY+   +  D     ++ + F R+   ++ LI G +D   L+ +++ EG+NS ADI++
Sbjct: 37  VNVYSSRHYNTDS----RLYENFTRQTGIKVNLIEGEAD--PLIERIKSEGKNSKADILI 90

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D   +  A + G+FA  N    Q K+P  ++     +  +       +Y K ++    
Sbjct: 91  TVDAGRLWRADQAGIFAPVNSKILQQKIPASLRHPKGHWFGFSKRLRVIMYSKARVNPSQ 150

Query: 149 -KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTK 205
              +++L N     K+I +   T+     L  W+  + G  + + W +  +A    +   
Sbjct: 151 LSTYEDLANPKWKGKVITRSS-TNIYSQSLCSWMIAVNGQGATEKWCRGLVANFARSPQG 209

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNY--GQDDYVAALFSE-----------GHYL 252
             T        G +D  L  +    +YL N    +D+   A+  +           G ++
Sbjct: 210 NDTAQIEALAAGVADLALVNT----YYLANLIDSKDEKKRAIGQQVGVFFPNQKGRGTHV 265

Query: 253 QIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
            I     +  +     A +F+++++SP  Q      N  YPVV
Sbjct: 266 NISGGGLVKTAPNRNAAVKFLEYLVSPQAQTFFAQGNLEYPVV 308


>gi|148378565|ref|YP_001253106.1| spermidine/putrescine ABC transporter permease [Clostridium
           botulinum A str. ATCC 3502]
 gi|153932323|ref|YP_001382953.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum A str. ATCC 19397]
 gi|153936910|ref|YP_001386501.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum A str. Hall]
 gi|148288049|emb|CAL82117.1| spermidine/putrescine transport system permease protein
           [Clostridium botulinum A str. ATCC 3502]
 gi|152928367|gb|ABS33867.1| spermidine/putrescine transport system permease protein
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum A str. ATCC 19397]
 gi|152932824|gb|ABS38323.1| spermidine/putrescine transport system permease protein
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum A str. Hall]
          Length = 613

 Score = 49.7 bits (117), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 131/302 (43%), Gaps = 42/302 (13%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TGV    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 263 VKKTLSFIVILLMVTGV--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 315

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   +
Sbjct: 316 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLA 373

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +FD+L +S  K   +I  DP
Sbjct: 374 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFDDLWDSEFKNSMVILDDP 433

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           R   +GL L    +  Y  NS    K++      + K       F  +     +++   S
Sbjct: 434 RV-MIGLALQ---KNGYSINSKNP-KELQKAKEDLIKLMPNVKAFDSESPKTLLINGEAS 488

Query: 229 PGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV-----------RSKQPQLAQEFMQFMI 277
            G+    +G + Y+A L  E   L++ +  + V           ++K  +LA+EF+ F+ 
Sbjct: 489 IGYV---WGTEAYLAKL--ENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIY 543

Query: 278 SP 279
            P
Sbjct: 544 KP 545


>gi|168181504|ref|ZP_02616168.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum Bf]
 gi|182675446|gb|EDT87407.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum Bf]
          Length = 614

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 124/295 (42%), Gaps = 28/295 (9%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TG+    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 264 VKKILSFIVILLMVTGI--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 316

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   S
Sbjct: 317 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLS 374

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +F++L +S  K   +I  DP
Sbjct: 375 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFNDLWDSQFKNSMVILDDP 434

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKK---IATKTATVTKGWTES-YGFFLKGESDFVLS 224
           R   +GL L      I   N  ++ K    +      V    +ES     + GES     
Sbjct: 435 RV-MIGLALQKNGYSINTKNPKELQKAKEDLIKLMPNVKAFDSESPKTLLINGESSIGYV 493

Query: 225 YSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISP 279
           + T    YL      +    L  EG   Q +      ++K  +LA+EF+ F+  P
Sbjct: 494 WGTEA--YLAKLENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIYKP 546


>gi|218437787|ref|YP_002376116.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7424]
 gi|218170515|gb|ACK69248.1| extracellular solute-binding protein family 1 [Cyanothece sp. PCC
           7424]
          Length = 348

 Score = 49.7 bits (117), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/282 (20%), Positives = 121/282 (42%), Gaps = 28/282 (9%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   +  D     ++   F ++   ++ L+  ++   L+ +++ EG NS ADI++ 
Sbjct: 37  LNLYSSRHYNTDR----RLYDNFTKQTGIKVNLVE-AEADPLIERIKSEGRNSPADILIT 91

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP- 148
            D   +  A++ G+FA  N    Q K+P  ++     +  +       +Y+K+++     
Sbjct: 92  VDAGRLWRAQQEGIFAPVNSRILQQKIPSYLREPKGHWYGFSKRLRVIMYNKKRVNPSQL 151

Query: 149 KNFDELINSTKPWKIIYQDPRTSTL-GLGLLLWIQKIYGDNSAQVW-KKIATKTATVTKG 206
            ++D+LIN    W+       +S +       W+    G+ +A+ W + +    A   +G
Sbjct: 152 SSYDDLINPR--WRSKVVSRSSSNIYSQSFTAWLVATRGEAAAEKWCRGLVGNFARPPQG 209

Query: 207 WTES-YGFFLKGESDFVLSYSTSPGFYLLNYGQD---------DYVAALF--SEGHYLQI 254
             ++       G +D  L+ +    +YL  Y  D         + V   F    G ++ I
Sbjct: 210 NDKAQIEAVAAGMADLALANT----YYLAGYASDKDPAKRAIYEQVGVFFPTGRGAHVNI 265

Query: 255 EVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVD 296
             A  +  +   + A +F++++ +P  Q      N  YPVV+
Sbjct: 266 SGAGLIKTAPNREAAIKFLEYLATPEAQNFFAQGNNEYPVVE 307


>gi|253687615|ref|YP_003016805.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754193|gb|ACT12269.1| extracellular solute-binding protein family 1 [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 326

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 126/300 (42%), Gaps = 24/300 (8%)

Query: 7   IVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGA-GPKIKQAFERKCNCELKLI 65
           I++GI      +S   + G  +   LT+YT     A  GA   K+   +E++   ++ + 
Sbjct: 13  IIMGI-----ALSLAAVTG--SAHALTLYT-----AGPGALAKKLAAGYEKQTGVKVDVF 60

Query: 66  GLSDGVALLNKLRMEGENSAADIVLGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDD 124
             + G  ++ +L  E  N  AD+++    +   DL ++  L    + +A+   +P ++  
Sbjct: 61  QATTG-KVMARLEAEQANPRADVLISASWDTATDLQQRGWLLEFDSPNAA--TVPAQFKT 117

Query: 125 DIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKI 184
             +V      L  +++ +  T  PK++++L       K+   DP  S   L LL+ +Q  
Sbjct: 118 PFYVAQGISALGIVWNSKSGTPEPKDWNDLTKPEFKDKVTTPDPALSGASLDLLIGLQNA 177

Query: 185 YGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVAA 244
             D +  ++ ++      +     ++    L+G    V        +  +  G+   +  
Sbjct: 178 EKDKAWDMFDRLKANGMIIAGPNAQALTPVLQGAKAAVFGAVDYVSYGSMESGES--IKV 235

Query: 245 LF-SEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV---VDISMP 300
           +F S G  +       L  SK  Q A++F+ +M+SP  Q+ +    W+ P    VD   P
Sbjct: 236 IFPSSGTVIAPRPMMILKSSKNQQQAKDFINYMLSPEGQKAV-AEAWLMPARQDVDAKRP 294


>gi|302534648|ref|ZP_07286990.1| 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate
           binding protein [Streptomyces sp. C]
 gi|302443543|gb|EFL15359.1| 2-aminoethylphosphonate ABC transporter, 2-aminoethylphosphonate
           binding protein [Streptomyces sp. C]
          Length = 361

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 75/159 (47%), Gaps = 5/159 (3%)

Query: 31  VLTVYTYNSFVADEGAG--PKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADI 88
           V+TVY+ +   +D+G G   K+   F +K   E+K +    G  +   +R E  N+ AD+
Sbjct: 44  VVTVYSADGLKSDKGDGWYDKVFAEFTKKTGIEVKYVEGGSGEMVQRAVR-EKTNTQADV 102

Query: 89  VLGFDNNLIDLARKTGLF-AKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQP 147
           ++      I  A   GL  A +   + ++    K  D  +      Y  F+Y+K+++ Q 
Sbjct: 103 LITLPP-FIQQADGKGLLQAYAPQGSDKVNGADKAADGKWTSVVNNYFGFVYNKKELGQA 161

Query: 148 PKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYG 186
           PK ++EL+++    K+ Y  P  +  G  +L+     +G
Sbjct: 162 PKTWEELLDAKYKGKLQYSTPGVAGDGTAVLIKAMHDFG 200


>gi|261339897|ref|ZP_05967755.1| putative ABC transporter, substrate-binding protein [Enterobacter
           cancerogenus ATCC 35316]
 gi|288317807|gb|EFC56745.1| putative ABC transporter, substrate-binding protein [Enterobacter
           cancerogenus ATCC 35316]
          Length = 322

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 120/302 (39%), Gaps = 47/302 (15%)

Query: 32  LTVYTYNSFVADEGAGP-----KIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAA 86
           LTVYT         AGP      +   FE+K   ++ +   + G  ++ +L  E  N  A
Sbjct: 28  LTVYT---------AGPGSLAKNLANGFEQKTGVKVDIFQATTG-KVMARLEAEQANPQA 77

Query: 87  DIVLGFD-NNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT 145
           DI++    +   DL ++  L    +++A  +   +K  D  +V      L  +++ +  T
Sbjct: 78  DILISASWDTAEDLHKRGWLLPYQSVNAQHVPADLKSVD--YVAQGVSALGIVWNTKSGT 135

Query: 146 QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTK 205
             PK + +L       K+   DP  S   L LL+ +Q   GDN   ++  +      V+ 
Sbjct: 136 PEPKEWRDLTTDAFRDKVTTPDPALSGASLDLLIGLQNGMGDNVWALFDALKKNGMVVSG 195

Query: 206 GWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDYVA-ALFSEGHYLQIEVAAQ----- 259
              ++    ++G    V             +G  DYV+    S+G  L++   A      
Sbjct: 196 PNAQAVTPVMQGAKAAV-------------FGAVDYVSYGNISQGESLKVIFPASGTVIA 242

Query: 260 ------LVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV---VDISMPDVYQAIRIPQ 310
                 L  ++    A+ F+ +++SP  Q ++    W+ P    V    P + +   +P 
Sbjct: 243 PRPMMILKSTRHADEAKAFVDYVLSPEGQAMVADA-WLMPAREDVKAKRPLLNELTVLPT 301

Query: 311 KS 312
           KS
Sbjct: 302 KS 303


>gi|145594541|ref|YP_001158838.1| extracellular solute-binding protein [Salinispora tropica CNB-440]
 gi|145303878|gb|ABP54460.1| extracellular solute-binding protein, family 1 [Salinispora tropica
           CNB-440]
          Length = 345

 Score = 49.3 bits (116), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 65/138 (47%), Gaps = 7/138 (5%)

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAK-SNID 112
           FE++   ++++I    G  ++++L+ E  N  AD+V+      I  A   GL    +   
Sbjct: 56  FEKQTGIKVQMIEAGSG-EVVSRLQKEKANVQADLVVTLPP-YIQKADADGLLQPYTPAG 113

Query: 113 ASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTST 172
           A Q    +    D +VP    YL FIY+  ++   P  FD+L++     K+ Y  P  + 
Sbjct: 114 ADQ----VTGATDTYVPLVNNYLCFIYNPDKVDAAPTTFDDLLSPVFAKKLQYSTPGQAG 169

Query: 173 LGLGLLLWIQKIYGDNSA 190
            G  +LL +Q I G + A
Sbjct: 170 DGTAVLLHLQHILGKDKA 187


>gi|83855163|ref|ZP_00948693.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Sulfitobacter sp. NAS-14.1]
 gi|83843006|gb|EAP82173.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Sulfitobacter sp. NAS-14.1]
          Length = 338

 Score = 49.3 bits (116), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 62/288 (21%), Positives = 120/288 (41%), Gaps = 31/288 (10%)

Query: 28  AKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAA 86
           A+  L +Y+   +  DE    ++   F  +    +  I G +D   LL ++  EG NS A
Sbjct: 22  AEGQLNLYSSRHYDTDE----RLYSDFTEQTGITINRIEGKAD--ELLARMEAEGANSPA 75

Query: 87  DIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKW---DDDIFVPYDYGYLAFIYDKRQ 143
           D+++  D + +  A++ GL    + D  + ++P      D+D F       + F Y K  
Sbjct: 76  DVLITVDTSRLSRAKEMGLLQSVDSDILEERIPSNLQDADNDWFGFSQRARIIF-YSKDA 134

Query: 144 ITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTAT 202
           +  PP+N+ +L +     ++  +   T++    LL  +   YG+  A  W + +    A 
Sbjct: 135 VDNPPQNYLDLADPAYEGQVCIR-SSTNSYNQTLLAALVTHYGEEKATEWAQGVVNNMAR 193

Query: 203 VTKGW-TESYGFFLKGESDFVLSYSTSPGFYLLN---------YGQDDYVAALF--SEGH 250
             +G  T+     + GE +  +S S    +Y                D +  +F   EG+
Sbjct: 194 APQGGDTDQLRGLVSGECEISVSNS----YYFARAIRTEVDGLSADLDKIGLVFPDQEGN 249

Query: 251 YLQIEVAAQLVRSKQPQL--AQEFMQFMISPSFQRILPTTNWMYPVVD 296
              + ++   V +  P    A +F++++ S S Q      N  +P V+
Sbjct: 250 GAHMNLSGAGVAANAPNRDNAVKFLEYLSSDSAQSYFSAGNDEFPAVE 297


>gi|187777658|ref|ZP_02994131.1| hypothetical protein CLOSPO_01250 [Clostridium sporogenes ATCC
           15579]
 gi|187774586|gb|EDU38388.1| hypothetical protein CLOSPO_01250 [Clostridium sporogenes ATCC
           15579]
          Length = 614

 Score = 49.3 bits (116), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 70/300 (23%), Positives = 129/300 (43%), Gaps = 38/300 (12%)

Query: 1   MKKFARIVVGIMMITGV-ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCN 59
           +KK    +V ++M+TG+  +  +      K VL ++ ++ F+        + + FE++ N
Sbjct: 264 VKKALSFIVILLMVTGMGFTIFSNTAKTEKQVLNIFNWSEFLPQS-----VVEQFEKEYN 318

Query: 60  CELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKSNI 111
            ++     S    +L KL   G N   D+V+  D          L+    K  +   +NI
Sbjct: 319 VKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLVQPIDKNNISNLANI 376

Query: 112 DASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDPRT 170
           D + L L     +   +PY +G    + DK +IT+   +FD+L +S  K   +I  DPR 
Sbjct: 377 DENVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFDDLWDSQFKNSMVILDDPRV 436

Query: 171 STLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPG 230
             +GL L    +  Y  NS    K++      + K       F  +     +++   S G
Sbjct: 437 -MIGLALQ---KNGYSINSKNP-KELQKAKEDLIKLMPNVKAFDSESPKTLLINGEASIG 491

Query: 231 FYLLNYGQDDYVAALFSEGHYLQIEVAAQLV-----------RSKQPQLAQEFMQFMISP 279
           +    +G + Y+A L  E   L++ +  + V           ++K  +LA+EF+ F+  P
Sbjct: 492 YV---WGTEAYLAKL--ENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIYKP 546


>gi|322804854|emb|CBZ02407.1| ABC transporter, periplasmic spermidine putrescine-binding protein
           PotD (TC 3.A.1.11.1) / Spermidine Putrescine ABC
           transporter permease component potC (TC_3.A.1.11.1)
           [Clostridium botulinum H04402 065]
          Length = 614

 Score = 49.3 bits (116), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 124/295 (42%), Gaps = 28/295 (9%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TGV    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 264 VKKTLSFIVILLMVTGV--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 316

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   +
Sbjct: 317 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLA 374

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +FD+L +S  K   +I  DP
Sbjct: 375 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFDDLWDSEFKNSMVILDDP 434

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKK---IATKTATVTKGWTES-YGFFLKGESDFVLS 224
           R   +GL L      I   N  ++ K    +      V    +ES     + GE+     
Sbjct: 435 RV-MIGLALQKNGYSINSKNPKELQKAKEDLIKLMPNVKAFDSESPKTLLINGEASIGYV 493

Query: 225 YSTSPGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISP 279
           + T    YL      +    L  EG   Q +      ++K  +LA+EF+ F+  P
Sbjct: 494 WGTEA--YLAKLENPNLEVVLTKEGIIPQYDNFVIPKKAKNKKLAEEFINFIYKP 546


>gi|86139327|ref|ZP_01057896.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. MED193]
 gi|85823830|gb|EAQ44036.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Roseobacter sp. MED193]
          Length = 338

 Score = 49.3 bits (116), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 110/282 (39%), Gaps = 29/282 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           L +Y+   +  DE    ++   FE      +  I G +D   L+ ++  EG NS ADI+L
Sbjct: 26  LNLYSSRHYDTDE----RLYSDFEDATGITINRIEGKAD--ELIARMSAEGANSPADILL 79

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D + +  A+  G+      D  + ++P  ++  D+ +  +        YDK  +T PP
Sbjct: 80  TVDTSRLARAKNAGILQSVKSDLLEARVPGYLQDADNQWFGFSQRARIIFYDKNDVTNPP 139

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK--IATKTATVTKG 206
           + + +L +     +I  +   ++T    LL  I   +G   A  W    +A        G
Sbjct: 140 RTYLDLADPAYQGQICIRS-SSNTYNQTLLASIVTHHGAEKALEWADGVVANMARAPQGG 198

Query: 207 WTESYGFFLKGESDFVLSYSTSPGFYLLN---------YGQDDYVAALFSE----GHYLQ 253
            T+     + GE +  +  S    +Y              Q D +  +F      G ++ 
Sbjct: 199 DTDQLRGIVSGECEIAVGNS----YYFARTIRKNVKGVSDQRDMIGWVFPSQNTVGAHMN 254

Query: 254 IEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           +  A     +     A +F++++ S   Q+     N  YP V
Sbjct: 255 LSGAGVAAHAPNRDNAVKFLEYLASDQAQQYFSAGNDEYPSV 296


>gi|166368409|ref|YP_001660682.1| iron transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166090782|dbj|BAG05490.1| iron transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 351

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 119/284 (41%), Gaps = 32/284 (11%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           L +Y+   +  D     ++   F R+   ++ L+ G +D   L+ +++ EG NS ADI+L
Sbjct: 38  LNLYSSRHYNTDR----RLYDNFTRQTGIKINLVEGEAD--PLIERIKSEGSNSPADILL 91

Query: 91  GFDNNLIDLARKTGLFAKSNIDASQLKLP--IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
             D   +  A + G+FA  N      ++P  ++     +  +       +Y+K ++   P
Sbjct: 92  TVDAGRLWRADQQGIFAPVNSRILTQRIPANLRHPKGHWFGFSKRLRVIMYNKDRVN--P 149

Query: 149 KNFDELINSTKP-WK-IIYQDPRTSTLGLGLLLWIQKIYGDNSAQVW-KKIATKTATVTK 205
           +  D   + T P WK  +     ++        W+  I G+ +A+ W + +    A   +
Sbjct: 150 REIDSYADLTNPKWKGKVVTRSSSNIYSQSFTAWLIDIQGEAAAEKWCRGLVANFARSPQ 209

Query: 206 GWTESY-GFFLKGESDFVLSYSTSPGFYLLNYGQD---------DYVAALFSE----GHY 251
           G  ++       G +D  L+ +    +YL  Y ++         D V  +F +    G +
Sbjct: 210 GNDKAQIEAVAAGIADLALANT----YYLAGYAEEKDPAKRAIYDQVGVIFPDQAGRGTH 265

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV 295
           + I     +  +   + A +F++++ S   Q      N  YPVV
Sbjct: 266 VNISGGGLIKTAPNRESAIKFLEYLSSNEAQNFFAKGNREYPVV 309


>gi|326939401|gb|AEA15297.1| ABC transporter substrate-binding protein [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 341

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 132/327 (40%), Gaps = 29/327 (8%)

Query: 1   MKKFARI---VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFV----ADEGAGPKIKQA 53
           MKKF+ +    V  ++ + V++ C+     A       T    V      +G   KI++ 
Sbjct: 1   MKKFSSLKSLFVCTLLFSAVVTGCSSKTGNADAKSKNTTEKKIVVYSAGPKGLAEKIQKD 60

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNI-- 111
           FE+K   ++++   + G  +L ++  E +N   D+V+     L  L    GL  +     
Sbjct: 61  FEKKTGIKVEMFQGTTG-KILARMEAEKKNPVVDVVV-----LASLPAMEGLKKEGQTLA 114

Query: 112 --DASQL-KLPIKWDDD--IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQ 166
             +A Q  KL  +W DD   +  Y    L  +Y+ + +   P+++ ++       K+   
Sbjct: 115 YKEAKQADKLRSEWSDDKGHYFGYSASALGIVYNTKNVKTAPEDWSDITKGEWKGKVNLP 174

Query: 167 DPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYS 226
           DP  S   L  +    K  G +   +++++     TV     E+    + G  D V++  
Sbjct: 175 DPALSGSALDFVTGYVKKNGKDGWNLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIA-- 232

Query: 227 TSPGFYLLNY---GQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQ 282
              G   + Y    + + V  ++ + G  +    A  +  SK  + A+EF+ +++S   Q
Sbjct: 233 ---GVDYMTYSAKAKGEPVDIVYPKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQ 289

Query: 283 RILPTTNWMYPVVDISMPDVYQAIRIP 309
           + +     +    DI   +      IP
Sbjct: 290 KQVSKAYLLPGRTDIKAENRPNVEEIP 316


>gi|283955388|ref|ZP_06372887.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 414]
 gi|283793148|gb|EFC31918.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 414]
          Length = 334

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 131/322 (40%), Gaps = 38/322 (11%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS AD+ + 
Sbjct: 20  LNIYSARHYDAD----FEIIKKFEEKTGIKINHTQ-AKASELIKRLSLEGSNSPADVFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L       +I+ +   T+     LL  I    G+ +A+ W K +    A
Sbjct: 130 IDISKMKNYEDLAKPEFKGEIVMRSA-TAPYSKTLLASIIANDGNKNAKAWAKGVLDNLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TSPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVV-DISMPD------VYQ 304
           + I   A    SK  + A++FM+F++SP  Q+IL  +N+ +P+  DI +         ++
Sbjct: 249 INISGIAMTKSSKNQESAKKFMEFVLSPEIQKILTDSNYEFPIRNDIELSQTVKDFGTFK 308

Query: 305 AIRIPQKSLRFNAEETTRYRNQ 326
             +IP   +  N +E  +  +Q
Sbjct: 309 EDQIPVSQIAENIKEAVKIYDQ 330


>gi|42780883|ref|NP_978130.1| ABC transporter, substrate-binding protein, putative [Bacillus
           cereus ATCC 10987]
 gi|42736804|gb|AAS40738.1| ABC transporter, substrate-binding protein, putative [Bacillus
           cereus ATCC 10987]
          Length = 341

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/322 (18%), Positives = 129/322 (40%), Gaps = 19/322 (5%)

Query: 1   MKKFARI---VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFV----ADEGAGPKIKQA 53
           MKKF+ +    V  ++ + V++ C+     A            V      +G   KI++ 
Sbjct: 1   MKKFSSLKSLFVCTLLFSAVVTGCSSKTGNADAKSKTTNEKKIVVYSAGPKGLAEKIQKD 60

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+K   ++++   + G  +L ++  E +N   D+V+      ++  +K G         
Sbjct: 61  FEKKTGIKVEMFQGTTG-KILARMEAEKKNPVVDVVVLASLPAMEGLKKDGQTLAYKEAK 119

Query: 114 SQLKLPIKWDDD--IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTS 171
              KL  +W DD   +  Y    L  +Y+ + +   P++++++       K+   DP  S
Sbjct: 120 QADKLRSEWSDDKGHYFGYSASALGIVYNTKNVKTAPEDWNDITKGEWKGKVNLPDPALS 179

Query: 172 TLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGF 231
              L  +    K  G +   +++++     TV     E+    + G  D V++     G 
Sbjct: 180 GSALDFVTGYVKKNGKDGWNLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIA-----GV 234

Query: 232 YLLNY---GQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
             + Y    + + V  ++ + G  +    A  +  SK  + A+EF+ +++S   Q+ +  
Sbjct: 235 DYMTYSAKAKGEPVDIVYPKSGTVISPRAAGIMKDSKNIEGAKEFIDYLLSDDVQKQISK 294

Query: 288 TNWMYPVVDISMPDVYQAIRIP 309
              +    DI   +      IP
Sbjct: 295 AYLLPGRTDIKAENRPNVEEIP 316


>gi|121612406|ref|YP_999899.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167004863|ref|ZP_02270621.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81-176]
 gi|87250366|gb|EAQ73324.1| iron ABC transporter, periplasmic iron-binding protein
           [Campylobacter jejuni subsp. jejuni 81-176]
          Length = 334

 Score = 48.9 bits (115), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/283 (22%), Positives = 114/283 (40%), Gaps = 31/283 (10%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           L +Y+   + AD     +I + FE K   ++     +    L+ +L +EG NS ADI + 
Sbjct: 20  LNIYSARHYDAD----FEIIKKFEEKTGIKVNHTQ-AKASELIKRLSLEGSNSPADIFIT 74

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQIT------ 145
            D + +  A+  GL +  +    +  +P    D      D  + A     R I       
Sbjct: 75  ADISNLTEAKNLGLLSPVSSKYLEEFIPAHLRDK-----DKEWFAITKRARIIAYNKNAN 129

Query: 146 ---QPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKK-IATKTA 201
                 KN+++L  +    +I+ +   T+     LL  I    G+  A+ W K +    A
Sbjct: 130 IDISKMKNYEDLARAEFKGEIVMRSA-TAPYSKTLLASIIANDGNKEAKAWAKGVLDNLA 188

Query: 202 TVTKGWTESYGF-FLKGESDFVLSYSTSPGFYLLNYGQDDY-----VAALF----SEGHY 251
           T  KG           GE+ F +  +   G    +    D      +  +F    + G +
Sbjct: 189 TNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKNSKNPKDVEVGNSLGIIFPNQDNRGTH 248

Query: 252 LQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
           + I   A    SK     ++FM+FM+SP  Q+IL  +N+ +P+
Sbjct: 249 INISGIAMTKSSKNQDAVKKFMEFMLSPEIQKILTDSNYEFPI 291


>gi|182438490|ref|YP_001826209.1| putative ABC transporter substrate-binding protein [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326779136|ref|ZP_08238401.1| extracellular solute-binding protein family 1 [Streptomyces cf.
           griseus XylebKG-1]
 gi|178467006|dbj|BAG21526.1| putative ABC transporter substrate-binding protein [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|326659469|gb|EGE44315.1| extracellular solute-binding protein family 1 [Streptomyces cf.
           griseus XylebKG-1]
          Length = 351

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 83/193 (43%), Gaps = 16/193 (8%)

Query: 2   KKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAG--PKIKQAFERKCN 59
           +  A  + G+  +T      +     AK V TVY+ +    ++G G   K+ + FE+K  
Sbjct: 6   RALALPLAGVAAVTLTACGGSSAASDAKSV-TVYSADGLKGEKGDGWYDKVFEDFEKKTG 64

Query: 60  CELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLF------AKSNIDA 113
            E+K +    G  ++ +   E  N+ AD+++      I  A   GL           +DA
Sbjct: 65  IEVKYVEGGSG-EMVQRAAREKSNTQADVLVTLPP-FIQQADAKGLLTAYEPKGADQVDA 122

Query: 114 SQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTL 173
           +      KW   +       Y  F+++K+++  PP+ +++L++     K+ Y  P  +  
Sbjct: 123 ADRAADGKWTSVV-----NNYFGFVHNKKELKNPPRTWEDLLDPAYKEKVQYSTPGVAGD 177

Query: 174 GLGLLLWIQKIYG 186
           G  +L+     +G
Sbjct: 178 GTAVLIKALHDFG 190


>gi|163939598|ref|YP_001644482.1| extracellular solute-binding protein [Bacillus weihenstephanensis
           KBAB4]
 gi|163861795|gb|ABY42854.1| extracellular solute-binding protein family 1 [Bacillus
           weihenstephanensis KBAB4]
          Length = 341

 Score = 48.5 bits (114), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/286 (19%), Positives = 118/286 (41%), Gaps = 18/286 (6%)

Query: 4   FARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELK 63
           F+ +V G    TG +     +    K  + VY+       +G   KI++ FE+K   +++
Sbjct: 17  FSAVVTGCSSKTGSVDAKNKNANEKK--IVVYS----AGPKGLAEKIQKDFEKKTGIKVE 70

Query: 64  LIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWD 123
           +   + G  +L ++  E +N   D+V+      ++  +K G            KL  +W 
Sbjct: 71  MFQGTTG-KILARMEAEKKNPVVDVVVLASLPAMEGLKKDGQTLAYKEAKQADKLRSEWS 129

Query: 124 DD--IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWI 181
           DD   +  Y    L  +Y+ + +   P+++ ++       K+   DP  S   L  +   
Sbjct: 130 DDKGHYFGYSASALGIVYNTKNVKTAPEDWSDITKGEWKGKVNLPDPALSGSALDFVTGY 189

Query: 182 QKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNY---GQ 238
            K  G +   +++++     TV     E+    + G  D V++     G   + Y    +
Sbjct: 190 VKKNGQDGWNLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIA-----GVDYMTYSAKAK 244

Query: 239 DDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQR 283
            + V  ++ + G  +    A  +  SK  + A+EF+ +++S   Q+
Sbjct: 245 GEPVDIVYPKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQK 290


>gi|212709913|ref|ZP_03318041.1| hypothetical protein PROVALCAL_00963 [Providencia alcalifaciens DSM
           30120]
 gi|212687425|gb|EEB46953.1| hypothetical protein PROVALCAL_00963 [Providencia alcalifaciens DSM
           30120]
          Length = 341

 Score = 48.5 bits (114), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 81/176 (46%), Gaps = 12/176 (6%)

Query: 16  GVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIK-QAFERKCNCELKLIGLSDGVALL 74
           G  S C      A PV+TVY+ +       +  + +  AF ++   +++ +    G A++
Sbjct: 19  GSTSVC------AAPVVTVYSADGLHDGNNSWYQSQFDAFTQQTGIKVQYVEGGSG-AIV 71

Query: 75  NKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDYGY 134
            +L  E  N  AD+++      I  A KT L AK   +++   + I    + + P    Y
Sbjct: 72  ERLAKERTNPQADVLVTVPP-FIQRAAKTELLAKFTPESA---VSIPNSTEYYTPIVNNY 127

Query: 135 LAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
           L FIY+ + +  PP  ++EL+++    K+ Y  P  +  G  ++L +   +G   A
Sbjct: 128 LTFIYNDKLLKNPPATWNELLDTRFKNKLQYSTPGQAGDGTAVMLQVFHSFGGKDA 183


>gi|118477219|ref|YP_894370.1| ABC transporter substrate-binding protein [Bacillus thuringiensis
           str. Al Hakam]
 gi|118416444|gb|ABK84863.1| ABC transporter, substrate-binding protein [Bacillus thuringiensis
           str. Al Hakam]
          Length = 341

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/322 (18%), Positives = 128/322 (39%), Gaps = 19/322 (5%)

Query: 1   MKKFARI---VVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFV----ADEGAGPKIKQA 53
           MKKF+ +    V  ++ + V++ C+     A            V      +G   KI++ 
Sbjct: 1   MKKFSSLKSLFVCTLLFSAVVTGCSSKTGNADAKSKTTNEKKIVVYSAGPKGLAEKIQKD 60

Query: 54  FERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDA 113
           FE+K   ++++   + G  +L ++  E +N   D+V+      ++  +K G         
Sbjct: 61  FEKKTGIKVEMFQGTTG-KILARMEAEKKNPVVDVVVLASLPAMEGLKKDGQTLAYKEAK 119

Query: 114 SQLKLPIKWDDD--IFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTS 171
              KL  +W DD   +  Y    L  +Y+ + +   P+++ ++       K+   DP  S
Sbjct: 120 QADKLRSEWSDDKGHYFGYSASALGIVYNTKNVKTAPEDWSDITKGEWKGKVNLPDPALS 179

Query: 172 TLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGF 231
              L  +    K  G +   +++++     TV     E+    + G  D V++     G 
Sbjct: 180 GSALDFVTGYVKKNGKDGWNLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIA-----GV 234

Query: 232 YLLNY---GQDDYVAALFSE-GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPT 287
             + Y    + + V  ++ + G  +    A  +  SK  + A+EF+ +++S   Q+ +  
Sbjct: 235 DYMTYSAKAKGEPVDIVYPKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQKQISK 294

Query: 288 TNWMYPVVDISMPDVYQAIRIP 309
              +    DI   +      IP
Sbjct: 295 AYLLPGRTDIKAENRPNVEEIP 316


>gi|168177928|ref|ZP_02612592.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum NCTC 2916]
 gi|226947815|ref|YP_002802906.1| spermidine/putrescine transport system permease
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum A2 str. Kyoto]
 gi|182671055|gb|EDT83029.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum NCTC 2916]
 gi|226842975|gb|ACO85641.1| spermidine/putrescine transport system permease protein
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum A2 str. Kyoto]
          Length = 614

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 131/302 (43%), Gaps = 42/302 (13%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TG+    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 264 VKKTLSFIVILLMVTGM--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 316

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   +
Sbjct: 317 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLA 374

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +FD+L +S  K   +I  DP
Sbjct: 375 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFDDLWDSEFKNSMVILDDP 434

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           R   +GL L    +  Y  NS    K++      + K       F  +     +++   S
Sbjct: 435 RV-MIGLALQ---KNGYSINSKNP-KELQKAKEDLIKLMPNVKAFDSESPKTLLINGEAS 489

Query: 229 PGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV-----------RSKQPQLAQEFMQFMI 277
            G+    +G + Y+A L  E   L++ +  + V           ++K  +LA+EF+ F+ 
Sbjct: 490 IGYV---WGTEAYLAKL--ENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIY 544

Query: 278 SP 279
            P
Sbjct: 545 KP 546


>gi|170755689|ref|YP_001780209.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum B1 str. Okra]
 gi|169120901|gb|ACA44737.1| spermidine/putrescine transport system permease protein
           PotC/spermidine/putrescine-binding periplasmic protein
           PotD [Clostridium botulinum B1 str. Okra]
          Length = 614

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 131/302 (43%), Gaps = 42/302 (13%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TG+    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 264 VKKTLSFIVILLMVTGM--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 316

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   +
Sbjct: 317 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLA 374

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +FD+L +S  K   +I  DP
Sbjct: 375 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFDDLWDSQFKNSMVILDDP 434

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           R   +GL L    +  Y  NS    K++      + K       F  +     +++   S
Sbjct: 435 RV-MIGLALQ---KNGYSINSKNP-KELQKAKEDLIKLMPNVKAFDSESPKTLLINGEAS 489

Query: 229 PGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV-----------RSKQPQLAQEFMQFMI 277
            G+    +G + Y+A L  E   L++ +  + V           ++K  +LA+EF+ F+ 
Sbjct: 490 IGYV---WGTEAYLAKL--ENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIY 544

Query: 278 SP 279
            P
Sbjct: 545 KP 546


>gi|163745506|ref|ZP_02152866.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Oceanibulbus indolifex HEL-45]
 gi|161382324|gb|EDQ06733.1| ferric iron ABC transporter, periplasmic ferric iron-binding
           protein [Oceanibulbus indolifex HEL-45]
          Length = 338

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 106/274 (38%), Gaps = 40/274 (14%)

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDY 132
           LL ++  EG NS AD++L  D + +  A+  GL      D  + ++P    DD    +  
Sbjct: 62  LLARMEAEGANSPADVLLTVDTSRLKRAKDMGLLQAVESDTLEERIPSNLQDDDNQWFGL 121

Query: 133 GYLAFI--YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
              A I  Y+K  +  PP  + +L +     ++  +   T+T    LL  I    G+ +A
Sbjct: 122 SQRARIIFYNKEALDNPPATYKDLADPAYKGQVCIR-SSTNTYNQTLLAAIVTHEGEEAA 180

Query: 191 QVWKK-IATKTATVTKGW-TESYGFFLKGESDFVLSYSTSPGFYLLNYGQDDY--VAALF 246
             W + +    A   +G  T+     + GE D  +S S    +Y     + D   V+A  
Sbjct: 181 TEWAQGVVDNMARAPQGGDTDQLRGIVSGECDIAVSNS----YYFARAIRTDVDGVSADI 236

Query: 247 S---------EGHYLQIEVAAQLVRSKQP--QLAQEFMQFMISPSFQRILPTTNWMYPVV 295
                     EG+   + ++   V    P  + A  F++++ S   Q      N  +P V
Sbjct: 237 DKIGLVWPDQEGNGAHMNLSGGGVAKNAPNRENAVAFLEYLASDQAQVYFSAGNDEFPTV 296

Query: 296 ------------------DISMPDVYQAIRIPQK 311
                             D+++ DV + I   QK
Sbjct: 297 EGVELADSVKQLGEFKADDVNLSDVAENIGTAQK 330


>gi|89052609|ref|YP_508060.1| extracellular solute-binding protein [Jannaschia sp. CCS1]
 gi|88862158|gb|ABD53035.1| extracellular solute-binding protein family 1 [Jannaschia sp. CCS1]
          Length = 339

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 96/241 (39%), Gaps = 23/241 (9%)

Query: 73  LLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPIKWDDDIFVPYDY 132
           L+ ++  EG NS AD+ L  D + +  A   GL    + +    ++P    DD  + + +
Sbjct: 62  LIARMEAEGANSPADVFLTVDTSRLQRAADAGLLQTVDSEVLAERIPANLRDDDGLWFGF 121

Query: 133 GYLAFI--YDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSA 190
              A I  YD   +  PP+ + +L +      + ++   T+     LL  + + YG+ +A
Sbjct: 122 SQRARIIFYDTADVETPPQTYVDLADPAYEGMVCHR-SSTNVYSQTLLSAVIENYGEEAA 180

Query: 191 QVWKK--IATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYL----------LNYGQ 238
           + W    +         G T+     + GE D  +S +    +Y           L+  Q
Sbjct: 181 REWAAGFVNNFARDPQGGDTDQLRGLVSGECDISISNT----YYFARAIRRDVEGLSAEQ 236

Query: 239 DDYVAALFSE----GHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPV 294
            + +  +F +    G ++ +        +     A  F++++ S   Q+     N  YPV
Sbjct: 237 RENIGWVFPDQGGNGAHVNLSGGGMAAHAPNVDAAVAFLEYLASDQAQQYFSAGNDEYPV 296

Query: 295 V 295
           V
Sbjct: 297 V 297


>gi|295318010|gb|ADF98387.1| putative spermidine/putrescine ABC transporter, permease
           protein/spermidine/putrescine-binding protein
           [Clostridium botulinum F str. 230613]
          Length = 614

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 131/302 (43%), Gaps = 42/302 (13%)

Query: 1   MKKFARIVVGIMMITGVISYCTLDGLPAKP---VLTVYTYNSFVADEGAGPKIKQAFERK 57
           +KK    +V ++M+TG+    T+ G  AK    VL ++ ++ F+        + + FE++
Sbjct: 264 VKKTLSFIVILLMVTGM--GFTIFGNTAKTEKQVLNIFNWSEFLPQS-----VIEQFEKE 316

Query: 58  CNCELKLIGLSDGVALLNKLRMEGENSAADIVLGFD--------NNLIDLARKTGLFAKS 109
            N ++     S    +L KL   G N   D+V+  D          LI    K  +   +
Sbjct: 317 YNVKVNYSTFSSNEEMLAKLM--GGNVPYDLVVTSDYAIEIMTKQKLIQPIDKNNVPNLA 374

Query: 110 NIDASQLKLPIKWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINST-KPWKIIYQDP 168
           NID + L L     +   +PY +G    + DK +IT+   +FD+L +S  K   +I  DP
Sbjct: 375 NIDKNVLDLAFDPKNTYSLPYMWGGNNIVIDKTKITKKITSFDDLWDSEFKNSMVILDDP 434

Query: 169 RTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTS 228
           R   +GL L    +  Y  NS    K++      + K       F  +     +++   S
Sbjct: 435 RV-MIGLALQ---KNGYSINSKNP-KELQKAKEDLIKLMPNVKAFDSESPKTLLINGEAS 489

Query: 229 PGFYLLNYGQDDYVAALFSEGHYLQIEVAAQLV-----------RSKQPQLAQEFMQFMI 277
            G+    +G + Y+A L  E   L++ +  + V           ++K  +LA+EF+ F+ 
Sbjct: 490 IGYV---WGTEAYLAKL--ENPNLEVVLTKEGVIPQYDNFVIPKKAKNKKLAEEFINFIY 544

Query: 278 SP 279
            P
Sbjct: 545 KP 546


>gi|159027971|emb|CAO87134.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 351

 Score = 48.1 bits (113), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/284 (20%), Positives = 119/284 (41%), Gaps = 32/284 (11%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLI-GLSDGVALLNKLRMEGENSAADIVL 90
           L +Y+   +  D     ++   F R+   ++ L+ G +D   L+ +++ EG NS ADI+L
Sbjct: 38  LNLYSSRHYNTDR