PSIBLAST alignment of GI: 254780561 and protein with PDB id: 1qvs

>gi|38492940|pdb|1QVS|A Chain A, Crystal Structure Of Haemophilus Influenzae H9a Mutant Holo Ferric Ion-Binding Protein A Length = 309
 Score =  108 bits (270), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 55/306 (17%), Positives = 101/306 (33%), Gaps = 14/306 (4%)

Query: 32  LTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVALLNKLRMEGENSAADIVLG 91
           +TVY   +    + A   + +AFE++   ++ L        L  +L+ EG+ + AD+   
Sbjct: 2   ITVYNGQA----KEAATAVAKAFEQETGIKVTL-NSGKSEQLAGQLKEEGDKTPADVFYT 56

Query: 92  FDNNLIDLARKTGLFAKSNIDASQLKLP---IKWDDDIFVPYDYGYLAFIYDKRQITQPP 148
                     + GL A  +    Q              ++         +YD  ++++  
Sbjct: 57  EQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKD 116

Query: 149 KNFDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQVWKKIATKTATVTKGWT 208
                L  +T  WK       TS   L  ++ + K+ GD  A  W K   +   +    +
Sbjct: 117 MEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNS 176

Query: 209 ESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD-----YVAALFSEGHYLQIEVAAQLVRS 263
            +      GE    L  +          G ++     Y       G  +    AA L  S
Sbjct: 177 VALQAVENGEVPAALINNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKAS 236

Query: 264 KQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRY 323
           K    AQ+F+ F+ S   Q  L      YP+    +   +      +      +  T + 
Sbjct: 237 KNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSP-FNLEPYEKLEAPVVSATTAQD 295

Query: 324 RNQWIS 329
           +   I 
Sbjct: 296 KEHAIK 301