BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780561|ref|YP_003064974.1| thiamine transporter substrate binding subunit [Candidatus Liberibacter asiaticus str. psy62] (338 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780561|ref|YP_003064974.1| thiamine transporter substrate binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 338 Score = 697 bits (1800), Expect = 0.0, Method: Compositional matrix adjust. Identities = 338/338 (100%), Positives = 338/338 (100%) Query: 1 MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60 MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC Sbjct: 1 MKKFARIVVGIMMITGVISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNC 60 Query: 61 ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120 ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI Sbjct: 61 ELKLIGLSDGVALLNKLRMEGENSAADIVLGFDNNLIDLARKTGLFAKSNIDASQLKLPI 120 Query: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW Sbjct: 121 KWDDDIFVPYDYGYLAFIYDKRQITQPPKNFDELINSTKPWKIIYQDPRTSTLGLGLLLW 180 Query: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD Sbjct: 181 IQKIYGDNSAQVWKKIATKTATVTKGWTESYGFFLKGESDFVLSYSTSPGFYLLNYGQDD 240 Query: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP 300 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP Sbjct: 241 YVAALFSEGHYLQIEVAAQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDISMP 300 Query: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL 338 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL Sbjct: 301 DVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAVSRL 338 >gi|254780279|ref|YP_003064692.1| dihydrodipicolinate reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Score = 27.3 bits (59), Expect = 0.41, Method: Compositional matrix adjust. Identities = 9/40 (22%), Positives = 23/40 (57%) Query: 258 AQLVRSKQPQLAQEFMQFMISPSFQRILPTTNWMYPVVDI 297 A +V+S L F+ F++ + + +LP +W + ++++ Sbjct: 120 APIVKSSNMSLGINFLGFLVETAAEYLLPAKDWDFEILEM 159 >gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 26.6 bits (57), Expect = 0.59, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 21/42 (50%) Query: 151 FDELINSTKPWKIIYQDPRTSTLGLGLLLWIQKIYGDNSAQV 192 D+ N+ WKI+Y D T + L++WI D++ + Sbjct: 23 IDDTPNNLGSWKIVYADFMTVLMAFFLVMWIINATDDDTKKA 64 >gi|254780359|ref|YP_003064772.1| GTP cyclohydrolase II protein (riboflavin biosynthesis) [Candidatus Liberibacter asiaticus str. psy62] Length = 210 Score = 26.2 bits (56), Expect = 0.87, Method: Compositional matrix adjust. Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 5/55 (9%) Query: 18 ISYCTLDGLPAKPVLTVYTYNSFVADEGAGPKIKQAFERKCNCELKLIGLSDGVA 72 + C + GLP V+ V D+G K KQ E +LK+I + D +A Sbjct: 154 VDLCKITGLPPIAVIC-----ELVNDDGTIKKGKQVIEFSKKYDLKIISVQDLIA 203 >gi|254780753|ref|YP_003065166.1| peptide chain release factor 2 [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Score = 22.7 bits (47), Expect = 9.8, Method: Compositional matrix adjust. Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 5/46 (10%) Query: 290 WMYPVVDISMPDVYQAIRIPQKSLRFNAEETTRYRNQWISSWQNAV 335 W+YPVVD S+ I I + R + + Q +++ +AV Sbjct: 210 WVYPVVDDSIE-----IEISESDCRIDTYRASGAGGQHVNTTDSAV 250 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.321 0.137 0.414 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 217,882 Number of Sequences: 1233 Number of extensions: 8901 Number of successful extensions: 15 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 6 length of query: 338 length of database: 328,796 effective HSP length: 74 effective length of query: 264 effective length of database: 237,554 effective search space: 62714256 effective search space used: 62714256 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 39 (19.6 bits)