BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780562|ref|YP_003064975.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] (77 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done >gi|146276213|ref|YP_001166372.1| iojap-like protein [Rhodobacter sphaeroides ATCC 17025] gi|145554454|gb|ABP69067.1| iojap-like protein [Rhodobacter sphaeroides ATCC 17025] Length = 164 Score = 87.8 bits (217), Expect = 5e-16, Method: Composition-based stats. Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 + + + V+ +++ KAEDI I+ RS + D MVI SGRS++ VA Sbjct: 40 TSTANEPANEPSSEELLQAVLASVEDDKAEDIVQIDLR-GRSDMADYMVICSGRSSRQVA 98 Query: 64 SIADNLISYLKKK 76 +I++ L+ +K++ Sbjct: 99 AISEKLMDRVKQQ 111 >gi|90421687|ref|YP_530057.1| Iojap-related protein [Rhodopseudomonas palustris BisB18] gi|90103701|gb|ABD85738.1| Iojap-related protein [Rhodopseudomonas palustris BisB18] Length = 141 Score = 84.0 bits (207), Expect = 7e-15, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 1/73 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 A+T L D + ++ L ++KAE+ I+ +S D MV+ SGRS +HV Sbjct: 17 ASTPVAVLTARPDADETLKLILSRLDDMKAEETVTIDLR-GKSAFSDYMVVTSGRSNRHV 75 Query: 63 ASIADNLISYLKK 75 ++A+N++ LK+ Sbjct: 76 GAVAENVVKGLKE 88 >gi|154246003|ref|YP_001416961.1| iojap-like protein [Xanthobacter autotrophicus Py2] gi|154160088|gb|ABS67304.1| iojap-like protein [Xanthobacter autotrophicus Py2] Length = 142 Score = 83.6 bits (206), Expect = 9e-15, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + +A V L++ K+EDI I+ ++ I D MVI SGRS +HV ++A++LI Sbjct: 31 RALPDAEEILALVTARLEDDKSEDIVSIDLR-GKTSIADYMVIASGRSQRHVGAVAEHLI 89 Query: 71 SYLK 74 LK Sbjct: 90 EALK 93 >gi|217976835|ref|YP_002360982.1| iojap-like protein [Methylocella silvestris BL2] gi|217502211|gb|ACK49620.1| iojap-like protein [Methylocella silvestris BL2] Length = 146 Score = 83.2 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q + + T++ L + KAEDI I+ ++ + D M+I +GRS+ HV ++AD +I Sbjct: 30 QPRPDAGTLVRTILTALDDAKAEDIVSIDL-HGKTTLADVMIIATGRSSTHVGALADRVI 88 Query: 71 SYLKK 75 K Sbjct: 89 KAFKD 93 >gi|148252024|ref|YP_001236609.1| hypothetical protein BBta_0417 [Bradyrhizobium sp. BTAi1] gi|146404197|gb|ABQ32703.1| hypothetical protein BBta_0417 [Bradyrhizobium sp. BTAi1] Length = 148 Score = 83.2 bits (205), Expect = 1e-14, Method: Composition-based stats. Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T ALQ D + T++ L+++KAE+ I+ +S D MVI +GRS +HV S Sbjct: 26 THDAALQAQPDADKTLRTILSRLEDMKAEETVTIDL-HGKSAYSDYMVITTGRSNRHVGS 84 Query: 65 IADNLISYLKK 75 IA+N+ LK+ Sbjct: 85 IAENVAKGLKE 95 >gi|294675636|ref|YP_003576251.1| iojap-related protein [Rhodobacter capsulatus SB 1003] gi|294474456|gb|ADE83844.1| iojap-related protein [Rhodobacter capsulatus SB 1003] Length = 158 Score = 82.8 bits (204), Expect = 2e-14, Method: Composition-based stats. Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + A+ D +A V+ L + KAEDI I+ RS I D+MVI SGRS++ V +IA+ Sbjct: 43 NVTDAETSDQVLALVLSSLDDDKAEDIVSIDLR-GRSSIADHMVICSGRSSRQVGAIAEK 101 Query: 69 LISYLKK 75 L LK+ Sbjct: 102 LTERLKE 108 >gi|221236481|ref|YP_002518918.1| iojap protein family [Caulobacter crescentus NA1000] gi|220965654|gb|ACL97010.1| iojap protein family [Caulobacter crescentus NA1000] Length = 181 Score = 82.4 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 23/74 (31%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 ++TE L + + +++ L + KA+DI HI+ T +S + D++++ SGRS +HV Sbjct: 56 SSTESPGLSPVLDVKALERLILDRLDDDKAQDIVHIDLTD-KSSVADSLIVASGRSHRHV 114 Query: 63 ASIADNLISYLKKK 76 ++AD+++ LK+ Sbjct: 115 GALADHILRALKEN 128 >gi|146284095|ref|YP_001174248.1| iojap-related protein [Pseudomonas stutzeri A1501] gi|145572300|gb|ABP81406.1| iojap-related protein [Pseudomonas stutzeri A1501] Length = 119 Score = 82.1 bits (202), Expect = 3e-14, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + L++LK +DI I+ ++ + D M+I SG S++HV S+A+N++ K Sbjct: 2 QTEALVQLAVAALEDLKGQDITTIDV-QGKTSVTDYMIIASGSSSRHVKSLAENVLEKAK 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|92116143|ref|YP_575872.1| Iojap-related protein [Nitrobacter hamburgensis X14] gi|91799037|gb|ABE61412.1| Iojap-related protein [Nitrobacter hamburgensis X14] Length = 120 Score = 81.3 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + ++ + V+ L+++KAE+ I+ RS D MVI +GRS +HV ++A+N+ Sbjct: 4 KARPDVEETLKLVLSRLEDMKAEETVTIDLR-GRSAFSDYMVIATGRSNRHVGAVAENVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 KGLKE 67 >gi|327482412|gb|AEA85722.1| iojap-related protein [Pseudomonas stutzeri DSM 4166] Length = 114 Score = 80.5 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + L++LK +DI I+ ++ + D M+I SG S++HV S+A+N++ K++ Sbjct: 1 MVQLAVAALEDLKGQDITTIDV-QGKTSVTDYMIIASGSSSRHVKSLAENVLEKAKEQ 57 >gi|149377639|ref|ZP_01895377.1| uncharacterized plant Iojap protein [Marinobacter algicola DG893] gi|149358112|gb|EDM46596.1| uncharacterized plant Iojap protein [Marinobacter algicola DG893] Length = 137 Score = 80.5 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L+++KA+D+ I+ R+ + D MV+ G S +HV S+AD+++S K Sbjct: 23 QAEQLKELVVGALEDVKAQDVSIIDVR-GRTSVTDYMVLACGTSNRHVKSLADSVLSEAK 81 Query: 75 KK 76 ++ Sbjct: 82 EQ 83 >gi|115522296|ref|YP_779207.1| iojap-like protein [Rhodopseudomonas palustris BisA53] gi|115516243|gb|ABJ04227.1| iojap-like protein [Rhodopseudomonas palustris BisA53] Length = 120 Score = 80.5 bits (198), Expect = 8e-14, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 AL+ D + ++ L ++KAE+ I+ +S D MV+ SGRS +HV ++A+N Sbjct: 2 ALKARPDADDALKLILSRLDDMKAEETVTIDLR-GKSAFSDYMVVTSGRSNRHVGALAEN 60 Query: 69 LISYLKK 75 ++ LK+ Sbjct: 61 VVKGLKE 67 >gi|226942984|ref|YP_002798057.1| iojap-like protein [Azotobacter vinelandii DJ] gi|226717911|gb|ACO77082.1| iojap-related protein [Azotobacter vinelandii DJ] Length = 117 Score = 79.7 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + ++ L++LKA+DI I+ ++ + D MV+ SG S +HV S+A+N++ +K + Sbjct: 4 EQLVQLAIDALEDLKAKDITVIDVR-GKTSVTDFMVVASGTSGRHVKSLAENVLEKVKAQ 62 Query: 77 N 77 + Sbjct: 63 D 63 >gi|192288594|ref|YP_001989199.1| iojap-like protein [Rhodopseudomonas palustris TIE-1] gi|192282343|gb|ACE98723.1| iojap-like protein [Rhodopseudomonas palustris TIE-1] Length = 150 Score = 79.7 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 18/70 (25%), Positives = 41/70 (58%), Gaps = 1/70 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + + A ++ + ++ L ++KAE+ I+ +S + D +V+ +GR+ +HV +I Sbjct: 29 DTSQFKAAPDAEATLKLILSRLDDMKAEETVTIDLR-GKSAMFDYVVVTTGRANRHVGAI 87 Query: 66 ADNLISYLKK 75 A+N++ LK+ Sbjct: 88 AENVVKALKQ 97 >gi|182679845|ref|YP_001833991.1| iojap-like protein [Beijerinckia indica subsp. indica ATCC 9039] gi|182635728|gb|ACB96502.1| iojap-like protein [Beijerinckia indica subsp. indica ATCC 9039] Length = 128 Score = 79.7 bits (196), Expect = 1e-13, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 T + + + TV+ L++ KAEDI I+ ++ I D M+I SGRS HV +IAD+L+ Sbjct: 11 STEPDIGAVVRTVLTSLEDSKAEDIVAIDL-HGKTTIADAMIIASGRSNTHVGAIADHLL 69 Query: 71 SYLKK 75 LK Sbjct: 70 KVLKD 74 >gi|298293389|ref|YP_003695328.1| iojap-like protein [Starkeya novella DSM 506] gi|296929900|gb|ADH90709.1| iojap-like protein [Starkeya novella DSM 506] Length = 137 Score = 79.4 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +A V+ L++ KAEDI IE ++ I D MV+ SGRS +HV +IA++L+ LK Sbjct: 21 DAEEMLALVLARLEDDKAEDIVSIELR-GKTTIADYMVVASGRSQRHVGAIAEHLVEALK 79 >gi|49074330|gb|AAT49396.1| PA4005 [synthetic construct] Length = 119 Score = 79.4 bits (195), Expect = 2e-13, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ L++LKA+DI ++ ++ + D MVI G S++ V S+ADN+++ K Sbjct: 2 QTEQLVQVAIDALEDLKAQDIVTLDVRD-KTSVTDYMVIACGSSSRQVKSLADNVLTKAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|260431773|ref|ZP_05785744.1| putative iojap family protein [Silicibacter lacuscaerulensis ITI-1157] gi|260415601|gb|EEX08860.1| putative iojap family protein [Silicibacter lacuscaerulensis ITI-1157] Length = 120 Score = 79.0 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 Q+ + + V+ L + KAED+ I+ +S + D MVI SGRST+ V+++++ Sbjct: 2 MAQSQPISEKLLERVLSSLSDDKAEDVVQIDLR-GKSSVADYMVIASGRSTRQVSAMSEK 60 Query: 69 LISYLKKK 76 L +K++ Sbjct: 61 LTDRIKQE 68 >gi|152983872|ref|YP_001346490.1| hypothetical protein PSPA7_1104 [Pseudomonas aeruginosa PA7] gi|150959030|gb|ABR81055.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] Length = 118 Score = 78.6 bits (193), Expect = 2e-13, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ L++LKA+DI ++ ++ + D MVI G S++ V S+ADN+++ K Sbjct: 2 QTEQLVQLAIDALEDLKAQDIVTLDVRD-KTSVTDYMVIACGSSSRQVKSLADNVLTKAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|156934842|ref|YP_001438758.1| hypothetical protein ESA_02690 [Cronobacter sakazakii ATCC BAA-894] gi|156533096|gb|ABU77922.1| hypothetical protein ESA_02690 [Cronobacter sakazakii ATCC BAA-894] Length = 184 Score = 78.6 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ + +LK +DI I+ +S I D M+I +G S++HV SIAD+++ +K Sbjct: 83 KALQDFVIDKIDDLKGQDIIAIDV-KGKSSITDCMIICTGTSSRHVMSIADHVVQESRK 140 >gi|15599200|ref|NP_252694.1| hypothetical protein PA4005 [Pseudomonas aeruginosa PAO1] gi|107103520|ref|ZP_01367438.1| hypothetical protein PaerPA_01004590 [Pseudomonas aeruginosa PACS2] gi|116052043|ref|YP_789114.1| hypothetical protein PA14_12030 [Pseudomonas aeruginosa UCBPP-PA14] gi|218889714|ref|YP_002438578.1| hypothetical protein PLES_09711 [Pseudomonas aeruginosa LESB58] gi|254236897|ref|ZP_04930220.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|254242689|ref|ZP_04936011.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|296387442|ref|ZP_06876941.1| iojap-related protein [Pseudomonas aeruginosa PAb1] gi|9950197|gb|AAG07392.1|AE004817_16 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] gi|115587264|gb|ABJ13279.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14] gi|126168828|gb|EAZ54339.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|126196067|gb|EAZ60130.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|218769937|emb|CAW25698.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58] Length = 118 Score = 78.6 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ L++LKA+DI ++ ++ + D MVI G S++ V S+ADN+++ K Sbjct: 2 QTEQLVQVAIDALEDLKAQDIVTLDVRD-KTSVTDYMVIACGSSSRQVKSLADNVLTKAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|89052868|ref|YP_508319.1| Iojap-related protein [Jannaschia sp. CCS1] gi|88862417|gb|ABD53294.1| Iojap-related protein [Jannaschia sp. CCS1] Length = 153 Score = 78.6 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 QTA + + ++ L + KAED+ I+ +S I D MV+ SGRST+ V+++A+ L+ Sbjct: 31 QTAYSSEELLERILTSLTDDKAEDVVQIDLR-GKSSIGDYMVVASGRSTRQVSAMAEKLV 89 Query: 71 SYLK 74 LK Sbjct: 90 DKLK 93 >gi|85705944|ref|ZP_01037040.1| hypothetical protein ROS217_09105 [Roseovarius sp. 217] gi|85669532|gb|EAQ24397.1| hypothetical protein ROS217_09105 [Roseovarius sp. 217] Length = 121 Score = 77.8 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ +A ++ L + KAEDI I+ ++ +CD MVI SGRS++ V++IA+ L+ LK Sbjct: 8 DSEAQLAAILTSLDDDKAEDIVQIDLR-GKTAMCDYMVICSGRSSRQVSAIAEKLMDRLK 66 Query: 75 K 75 + Sbjct: 67 Q 67 >gi|144897645|emb|CAM74509.1| Iojap-related protein [Magnetospirillum gryphiswaldense MSR-1] Length = 113 Score = 77.4 bits (190), Expect = 5e-13, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ V L + KAEDI ++ ++ + D+MVI +G S++ V ++AD+L+ LK Sbjct: 2 TAEELVSLVYTSLDDGKAEDISVVDLR-GKTSMADHMVIATGNSSRQVGAMADHLMEKLK 60 >gi|126738197|ref|ZP_01753918.1| Iojap-related protein [Roseobacter sp. SK209-2-6] gi|126720694|gb|EBA17399.1| Iojap-related protein [Roseobacter sp. SK209-2-6] Length = 143 Score = 77.4 bits (190), Expect = 5e-13, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 A +T + ++ L + KAED+ I+ ++ I D MVI SGRST+ VA++++ Sbjct: 23 SAAKTRPTNTVLLERILSSLDDDKAEDVVQIDLR-GKTAIADFMVIASGRSTRQVAAMSE 81 Query: 68 NLISYLKKK 76 L LK++ Sbjct: 82 KLTDRLKQE 90 >gi|308273471|emb|CBX30073.1| Uncharacterized protein yqeL [uncultured Desulfobacterium sp.] Length = 141 Score = 77.4 bits (190), Expect = 5e-13, Method: Composition-based stats. Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M+ TEK++L+ + + + ++ + KAEDI ++ + + D +I +G S + Sbjct: 1 MIYMTEKESLKGEEEITALFDLYIKAVLGKKAEDIVLLDLR-GLTSLADAFIICTGMSNR 59 Query: 61 HVASIADNLISYLKK 75 V +IAD++ YLKK Sbjct: 60 QVTAIADSIERYLKK 74 >gi|307942944|ref|ZP_07658289.1| putative iojap-like protein [Roseibium sp. TrichSKD4] gi|307773740|gb|EFO32956.1| putative iojap-like protein [Roseibium sp. TrichSKD4] Length = 127 Score = 77.4 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 1/72 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 +T Q +D + TV+ L + KAEDI ++ +S + D+M++VSGRS +HV Sbjct: 2 STPHQTTVGSDLAADLLDTVLTSLDDSKAEDITTLDIA-GKSSLADHMIVVSGRSHRHVG 60 Query: 64 SIADNLISYLKK 75 +IAD+L+ LK+ Sbjct: 61 AIADHLLRALKE 72 >gi|254451541|ref|ZP_05064978.1| iojap protein family [Octadecabacter antarcticus 238] gi|198265947|gb|EDY90217.1| iojap protein family [Octadecabacter antarcticus 238] Length = 162 Score = 77.4 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A DS +A V++ L + K EDI I+ +S + D MVI SGRS++ V+++A+ Sbjct: 34 MSVQAPTADSTLAAVLKSLDDDKGEDIVQIDL-HGKSEMGDYMVIASGRSSRQVSAMAEK 92 Query: 69 LISYLKK 75 L LK+ Sbjct: 93 LTDRLKQ 99 >gi|254247615|ref|ZP_04940936.1| Iojap-related protein [Burkholderia cenocepacia PC184] gi|124872391|gb|EAY64107.1| Iojap-related protein [Burkholderia cenocepacia PC184] Length = 167 Score = 77.4 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 40/74 (54%), Gaps = 5/74 (6%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +A+T +++ + +++ L+++KA+DI TS + + D +V+ SG S + Sbjct: 13 IASTIPESM----DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVVVASGTSNRQ 67 Query: 62 VASIADNLISYLKK 75 ++A N+ +K+ Sbjct: 68 TKALASNVRDKVKE 81 >gi|121534063|ref|ZP_01665888.1| iojap-like protein [Thermosinus carboxydivorans Nor1] gi|121307166|gb|EAX48083.1| iojap-like protein [Thermosinus carboxydivorans Nor1] Length = 407 Score = 77.4 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V + KA DI ++ S + D VI S ++ V +IADN+ L+++ Sbjct: 10 ELVAAAASDKKARDIVILDV-QGISPVTDYFVICSANTSTQVQAIADNIEEKLEEQ 64 >gi|299135460|ref|ZP_07028650.1| iojap-like protein [Afipia sp. 1NLS2] gi|298589868|gb|EFI50073.1| iojap-like protein [Afipia sp. 1NLS2] Length = 131 Score = 77.4 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 L+ D + ++ L ++KAED I+ +S I D MV+ +GR +HV +IA+N+ Sbjct: 14 LKARPDADETLTLILSRLDDMKAEDTITIDLR-GKSSITDYMVVTTGRVNRHVGAIAENV 72 Query: 70 ISYLKK 75 LK+ Sbjct: 73 AKGLKE 78 >gi|288941861|ref|YP_003444101.1| iojap-like protein [Allochromatium vinosum DSM 180] gi|288897233|gb|ADC63069.1| iojap-like protein [Allochromatium vinosum DSM 180] Length = 120 Score = 77.4 bits (190), Expect = 7e-13, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 LD V++ L ++KA DI ++ ++ + D M+I SG S +HV +IA+ + K Sbjct: 2 QLDQLKQLVLDTLDDMKARDIQVLDVR-GKTAVTDFMIIASGTSDRHVKAIAETVAFRAK 60 Query: 75 K 75 Sbjct: 61 D 61 >gi|126665214|ref|ZP_01736197.1| uncharacterized plant Iojap protein [Marinobacter sp. ELB17] gi|126630584|gb|EBA01199.1| uncharacterized plant Iojap protein [Marinobacter sp. ELB17] Length = 141 Score = 77.4 bits (190), Expect = 7e-13, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L+++KA+D+ I+ R+ + D MV+ SG S +H+ ++A++++ K Sbjct: 25 QAEQLKDLVINALEDVKAQDLSVIDVRE-RTGVTDFMVLASGTSNRHLKALANSVVVDAK 83 Query: 75 KK 76 ++ Sbjct: 84 EQ 85 >gi|225175150|ref|ZP_03729146.1| iojap-like protein [Dethiobacter alkaliphilus AHT 1] gi|225169326|gb|EEG78124.1| iojap-like protein [Dethiobacter alkaliphilus AHT 1] Length = 125 Score = 77.4 bits (190), Expect = 7e-13, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ + V E +E KA DI ++ S++ D VI SG S V +IADN++ + Sbjct: 3 QDVEKLVNLVEEAAEEKKANDITILDVGK-VSVVADYFVIASGGSRTQVYAIADNIMEKM 61 Query: 74 KK 75 K+ Sbjct: 62 KE 63 >gi|209883755|ref|YP_002287612.1| iojap protein family [Oligotropha carboxidovorans OM5] gi|209871951|gb|ACI91747.1| iojap protein family [Oligotropha carboxidovorans OM5] Length = 131 Score = 77.0 bits (189), Expect = 7e-13, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + D ++ ++ L ++KAE+ I+ +S + D MVI +GR +HV +IA++++ Sbjct: 15 KARPDADETLSLILSRLDDMKAEETITIDLR-GKSPLTDYMVITTGRVNRHVGAIAEDVV 73 Query: 71 SYLKK 75 LK+ Sbjct: 74 KGLKE 78 >gi|154251929|ref|YP_001412753.1| iojap-like protein [Parvibaculum lavamentivorans DS-1] gi|154155879|gb|ABS63096.1| iojap-like protein [Parvibaculum lavamentivorans DS-1] Length = 168 Score = 77.0 bits (189), Expect = 7e-13, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +A V+E L E KAED+ I+ T ++ I D+MV+ SGRS +HV ++AD+L+ LK+ Sbjct: 56 SSEMLALVLESLDEDKAEDVVSIDLT-GKTPIADHMVVASGRSQRHVGAVADHLVRRLKE 114 >gi|325920736|ref|ZP_08182642.1| iojap-related protein [Xanthomonas gardneri ATCC 19865] gi|325548788|gb|EGD19736.1| iojap-related protein [Xanthomonas gardneri ATCC 19865] Length = 136 Score = 77.0 bits (189), Expect = 8e-13, Method: Composition-based stats. Identities = 28/79 (35%), Positives = 50/79 (63%), Gaps = 6/79 (7%) Query: 4 NTEKQALQTA-----DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRS 58 T+ Q ++T+ + + +ATV E ++ELKA+D+ I+ +S +CD MV+ SG S Sbjct: 2 TTQAQVIKTSIPNPPPSVPALLATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVASGTS 60 Query: 59 TKHVASIADNLISYLKKKN 77 T+HV SIA+ ++ + K+ + Sbjct: 61 TRHVKSIAEEVVKFAKRLD 79 >gi|311693494|gb|ADP96367.1| Iojap-related protein [marine bacterium HP15] Length = 116 Score = 77.0 bits (189), Expect = 8e-13, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L+++KA+DI I+ R+ + D MV+ SG S +HV S+AD+++ K Sbjct: 2 QAEQLKDLVINALEDVKAQDISVIDVRD-RTSVTDFMVLASGTSNRHVKSLADSVVVEAK 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|159185376|ref|NP_355707.2| hypothetical protein Atu2777 [Agrobacterium tumefaciens str. C58] gi|159140627|gb|AAK88492.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 162 Score = 77.0 bits (189), Expect = 8e-13, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D D + TV+ L++ KAEDI ++ +S + D MV+VSGRS +HV++I ++L+ + Sbjct: 48 DAADHALETVLASLEDSKAEDIVSLDIA-GKSALADYMVVVSGRSNRHVSAICEHLLKDM 106 Query: 74 KKK 76 K + Sbjct: 107 KDE 109 >gi|149202886|ref|ZP_01879857.1| hypothetical protein RTM1035_19126 [Roseovarius sp. TM1035] gi|149143432|gb|EDM31468.1| hypothetical protein RTM1035_19126 [Roseovarius sp. TM1035] Length = 121 Score = 76.7 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ +A ++ L + KAED+ I+ ++ +CD MVI SGRS++ V++IA+ L+ LK Sbjct: 8 DSEAQLAAILTSLDDDKAEDVVQIDLR-GKTAMCDYMVICSGRSSRQVSAIAEKLMDRLK 66 Query: 75 K 75 + Sbjct: 67 Q 67 >gi|254465477|ref|ZP_05078888.1| iojap family protein [Rhodobacterales bacterium Y4I] gi|206686385|gb|EDZ46867.1| iojap family protein [Rhodobacterales bacterium Y4I] Length = 126 Score = 76.7 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 22/68 (32%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A Q+ + + ++ L + KAED+ I+ ++ I D MV+ SGRST+ VA++++ Sbjct: 2 AAQSQPTSEQLLERILSSLSDDKAEDVVQIDLR-GKTSIGDYMVLASGRSTRQVAAMSEK 60 Query: 69 LISYLKKK 76 L+ LK++ Sbjct: 61 LMDRLKQE 68 >gi|194366680|ref|YP_002029290.1| iojap-like protein [Stenotrophomonas maltophilia R551-3] gi|194349484|gb|ACF52607.1| iojap-like protein [Stenotrophomonas maltophilia R551-3] Length = 137 Score = 76.7 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%) Query: 1 MLANTEKQALQ-----TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVS 55 M T+ Q ++ + +A+V + ++LKA+D I+ RS + D MV+VS Sbjct: 1 MSNQTQPQTIKVDLPSPPPSVPELLASVRQATEDLKAKDPVEIDVR-GRSSVADYMVVVS 59 Query: 56 GRSTKHVASIADNLISYLKKKN 77 G ST+HV SIAD ++ + KK + Sbjct: 60 GTSTRHVKSIADEVVRFAKKID 81 >gi|83648485|ref|YP_436920.1| hypothetical protein HCH_05845 [Hahella chejuensis KCTC 2396] gi|83636528|gb|ABC32495.1| uncharacterized plant Iojap protein [Hahella chejuensis KCTC 2396] Length = 117 Score = 76.7 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ V++ L+++KA+DI ++ R+ + D MVI SG S +HV SIADN+I+ +K Sbjct: 2 ETENLKEIVIKALEDIKAKDISVLDVKD-RTSVTDYMVIASGTSNRHVKSIADNVIAEVK 60 >gi|56695141|ref|YP_165488.1| iojap-related protein [Ruegeria pomeroyi DSS-3] gi|56676878|gb|AAV93544.1| iojap-related protein [Ruegeria pomeroyi DSS-3] Length = 128 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 1/70 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K Q + + ++ L + KAED+ I+ ++ + D MVI SGRST+ V+++A Sbjct: 8 KMMAQGTYTSEQLLDRILTSLNDDKAEDLVQIDLR-GKTSMGDYMVIASGRSTRQVSAMA 66 Query: 67 DNLISYLKKK 76 + L+ LK + Sbjct: 67 EKLVQRLKDE 76 >gi|161524156|ref|YP_001579168.1| iojap-like protein [Burkholderia multivorans ATCC 17616] gi|189351087|ref|YP_001946715.1| iojap domain protein [Burkholderia multivorans ATCC 17616] gi|221199602|ref|ZP_03572646.1| iojap domain protein [Burkholderia multivorans CGD2M] gi|221205498|ref|ZP_03578513.1| iojap domain protein [Burkholderia multivorans CGD2] gi|221211680|ref|ZP_03584659.1| iojap domain protein [Burkholderia multivorans CGD1] gi|160341585|gb|ABX14671.1| iojap-like protein [Burkholderia multivorans ATCC 17616] gi|189335109|dbj|BAG44179.1| iojap domain protein [Burkholderia multivorans ATCC 17616] gi|221169041|gb|EEE01509.1| iojap domain protein [Burkholderia multivorans CGD1] gi|221174336|gb|EEE06768.1| iojap domain protein [Burkholderia multivorans CGD2] gi|221180887|gb|EEE13290.1| iojap domain protein [Burkholderia multivorans CGD2M] Length = 149 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +V+ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVVVASGTSNRQTKALASNVREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|332559334|ref|ZP_08413656.1| iojap-like protein [Rhodobacter sphaeroides WS8N] gi|332277046|gb|EGJ22361.1| iojap-like protein [Rhodobacter sphaeroides WS8N] Length = 109 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V+ L + KAEDI I+ RS + D MVI SGRS++ VA+I++ L+ +K++ Sbjct: 2 QAVLASLDDDKAEDIVQIDLR-GRSDMADYMVICSGRSSRQVAAISEKLMDRVKQQ 56 >gi|312115759|ref|YP_004013355.1| iojap-like protein [Rhodomicrobium vannielii ATCC 17100] gi|311220888|gb|ADP72256.1| iojap-like protein [Rhodomicrobium vannielii ATCC 17100] Length = 158 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S V++ L++ KA DI I+ ++ I D M++ SGRS +HV +IAD L+ LK+ Sbjct: 48 SLAHLVVDALEDAKAVDIITIDV-EGKTSIADYMIVASGRSQRHVGAIADQLMDKLKE 104 >gi|83746485|ref|ZP_00943536.1| iojap protein family [Ralstonia solanacearum UW551] gi|83726816|gb|EAP73943.1| iojap protein family [Ralstonia solanacearum UW551] Length = 241 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 33 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAVSVRDAVK 91 Query: 75 K 75 + Sbjct: 92 E 92 >gi|118589434|ref|ZP_01546840.1| hypothetical protein SIAM614_07813 [Stappia aggregata IAM 12614] gi|118438134|gb|EAV44769.1| hypothetical protein SIAM614_07813 [Stappia aggregata IAM 12614] Length = 127 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 ++ QA + + TV+ L + KAED+ +E +S + D MVIVSGRS +HV Sbjct: 2 SSPLQASVGKELAADLLDTVLTSLDDSKAEDVVTLEIA-GKSSLADYMVIVSGRSHRHVG 60 Query: 64 SIADNLISYLK 74 +IAD+L+ LK Sbjct: 61 AIADHLLKDLK 71 >gi|71276305|ref|ZP_00652583.1| Iojap-related protein [Xylella fastidiosa Dixon] gi|71900281|ref|ZP_00682417.1| Iojap-related protein [Xylella fastidiosa Ann-1] gi|170730506|ref|YP_001775939.1| hypothetical protein Xfasm12_1380 [Xylella fastidiosa M12] gi|71162913|gb|EAO12637.1| Iojap-related protein [Xylella fastidiosa Dixon] gi|71729929|gb|EAO32024.1| Iojap-related protein [Xylella fastidiosa Ann-1] gi|167965299|gb|ACA12309.1| conserved hypothetical protein [Xylella fastidiosa M12] Length = 148 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L ++TV E ++ LKA+DI I+ +S + D +VI SG ST+HV SIAD ++ + Sbjct: 28 PSLPILLSTVHEAVETLKAKDIVKIDVR-GKSSVADYLVIASGTSTRHVKSIADEVVKFA 86 Query: 74 KKKN 77 K+ N Sbjct: 87 KRLN 90 >gi|15966916|ref|NP_387269.1| hypothetical protein SMc03780 [Sinorhizobium meliloti 1021] gi|307301688|ref|ZP_07581447.1| iojap-like protein [Sinorhizobium meliloti BL225C] gi|307316289|ref|ZP_07595733.1| iojap-like protein [Sinorhizobium meliloti AK83] gi|15076189|emb|CAC47742.1| Hypothetical protein SMc03780 [Sinorhizobium meliloti 1021] gi|306898129|gb|EFN28871.1| iojap-like protein [Sinorhizobium meliloti AK83] gi|306903386|gb|EFN33975.1| iojap-like protein [Sinorhizobium meliloti BL225C] Length = 163 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V+E L++ KAE+I I+ +S + D MV+VSGRS +HV +IAD+LI+ LK Sbjct: 55 LQLVLESLEDSKAENIVTIDIA-GKSALGDFMVVVSGRSNRHVMAIADHLITDLKD 109 >gi|83944748|ref|ZP_00957114.1| iojap-related protein [Oceanicaulis alexandrii HTCC2633] gi|83851530|gb|EAP89385.1| iojap-related protein [Oceanicaulis alexandrii HTCC2633] Length = 129 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 26/72 (36%), Positives = 40/72 (55%), Gaps = 1/72 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 + + + A A V+ L + KAED+ I+ T +S + D MVI SGRS +HV Sbjct: 8 EADSDSGELAQSTQDLEALVLNALDDDKAEDVVAIDLT-GKSSVTDVMVIASGRSNRHVG 66 Query: 64 SIADNLISYLKK 75 ++AD+L+ LK Sbjct: 67 AMADHLVRKLKD 78 >gi|54310013|ref|YP_131033.1| hypothetical protein PBPRA2888 [Photobacterium profundum SS9] gi|90414084|ref|ZP_01222067.1| hypothetical protein P3TCK_25815 [Photobacterium profundum 3TCK] gi|46914452|emb|CAG21231.1| Conserved hypothetical protein [Photobacterium profundum SS9] gi|90324879|gb|EAS41407.1| hypothetical protein P3TCK_25815 [Photobacterium profundum 3TCK] Length = 105 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ + +LKA+DI I+ +S I D MV+ +G S +HVASIAD++ K Sbjct: 2 QTQELHDLIVDKVDDLKAQDIVTIDVR-GKSSITDFMVVCTGTSNRHVASIADHVDKETK 60 >gi|207743796|ref|YP_002260188.1| hypothethical protein [Ralstonia solanacearum IPO1609] gi|206595196|emb|CAQ62123.1| hypothetical protein RSIPO_01979 [Ralstonia solanacearum IPO1609] Length = 230 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 22 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAVSVRDAVK 80 Query: 75 K 75 + Sbjct: 81 E 81 >gi|86137129|ref|ZP_01055707.1| iojap-related protein [Roseobacter sp. MED193] gi|85826453|gb|EAQ46650.1| iojap-related protein [Roseobacter sp. MED193] Length = 143 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++ L + KAED+ I+ ++ I D MVI +GRS++ VA IA+ L LK++ Sbjct: 34 LLERILSSLDDDKAEDVVQIDLR-GKTAIADFMVIATGRSSRQVAGIAEKLTDRLKQE 90 >gi|238758033|ref|ZP_04619214.1| hypothetical protein yaldo0001_9120 [Yersinia aldovae ATCC 35236] gi|238703787|gb|EEP96323.1| hypothetical protein yaldo0001_9120 [Yersinia aldovae ATCC 35236] Length = 139 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 38 KALQEFVIDKLDDLKGQDITTLDV-QGKSSITDYMIICTGTSTRHVMALADNLVQE 92 >gi|188990941|ref|YP_001902951.1| hypothetical protein xccb100_1545 [Xanthomonas campestris pv. campestris str. B100] gi|167732701|emb|CAP50895.1| conserved hypothetical protein, Iojap-family [Xanthomonas campestris pv. campestris] Length = 141 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + +ATV E ++ELKA+D+ I+ +S +CD MV+ SG ST+HV SIA+ ++ + Sbjct: 20 PSVPALLATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVASGTSTRHVKSIAEEVVKFA 78 Query: 74 KKKN 77 K+ + Sbjct: 79 KRLD 82 >gi|75674644|ref|YP_317065.1| Iojap-related protein [Nitrobacter winogradskyi Nb-255] gi|74419514|gb|ABA03713.1| Iojap-related protein [Nitrobacter winogradskyi Nb-255] Length = 123 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + ++ + ++ L+++KAED I RS D MV+V+GRS +HV +IA+ + Sbjct: 7 EAQPDVEQTLRLILSRLEDMKAEDAVTIGLR-GRSAFSDYMVVVTGRSNRHVGAIAETVA 65 Query: 71 SYLKK 75 LK Sbjct: 66 RGLKD 70 >gi|71898466|ref|ZP_00680638.1| Iojap-related protein [Xylella fastidiosa Ann-1] gi|71731779|gb|EAO33838.1| Iojap-related protein [Xylella fastidiosa Ann-1] Length = 148 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L ++TV E ++ LKA+DI I+ +S + D +VI SG ST+HV SIAD ++ + Sbjct: 28 PSLPILLSTVHEAVETLKAKDIVKIDVR-GKSSVADYLVIASGTSTRHVKSIADEVVKFA 86 Query: 74 KKKN 77 K+ N Sbjct: 87 KRLN 90 >gi|260425550|ref|ZP_05779530.1| conserved domain protein [Citreicella sp. SE45] gi|260423490|gb|EEX16740.1| conserved domain protein [Citreicella sp. SE45] Length = 123 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +ATV++ L + KAED+ I+ ++ +CD+MVI SGRS++ V SIAD L LK Sbjct: 10 TSEQILATVLKILDDNKAEDVVQIDLR-GKTSVCDHMVICSGRSSRQVVSIADKLAEDLK 68 Query: 75 KK 76 + Sbjct: 69 HE 70 >gi|15838771|ref|NP_299459.1| hypothetical protein XF2180 [Xylella fastidiosa 9a5c] gi|9107320|gb|AAF84979.1|AE004031_11 conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 148 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 39/64 (60%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L ++TV E ++ LKA+DI I+ +S + D +VI SG ST+HV SIAD ++ + Sbjct: 28 PSLPILLSTVHEAVETLKAKDIVKIDVR-GKSSVADYLVIASGTSTRHVKSIADEVVKFA 86 Query: 74 KKKN 77 K N Sbjct: 87 KHLN 90 >gi|227358528|ref|ZP_03842853.1| family protein of plant Iojap protein [Proteus mirabilis ATCC 29906] gi|227161239|gb|EEI46313.1| family protein of plant Iojap protein [Proteus mirabilis ATCC 29906] Length = 108 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T +++ L++ KA+DI ++ +S + D M+I +G S +H+ S+ADNL+ Sbjct: 2 TLLQGSELQQFIIDKLEDSKAQDIIALDVR-GKSSVTDYMIICTGTSNRHLMSVADNLVD 60 Query: 72 YLKK 75 ++ Sbjct: 61 DCRE 64 >gi|150398208|ref|YP_001328675.1| iojap-like protein [Sinorhizobium medicae WSM419] gi|150029723|gb|ABR61840.1| iojap-like protein [Sinorhizobium medicae WSM419] Length = 166 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V+E L++ KAE+I I+ +S + D MV+VSGRS +HV +IAD+LI+ LK Sbjct: 58 LQLVLESLEDSKAENIVTIDIA-GKSALGDFMVVVSGRSNRHVMAIADHLITDLKD 112 >gi|310815124|ref|YP_003963088.1| iojap family protein [Ketogulonicigenium vulgare Y25] gi|308753859|gb|ADO41788.1| iojap family protein [Ketogulonicigenium vulgare Y25] Length = 169 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 27/58 (46%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + VM L + KAE+I I+ RS + D MVI SGRST+ VASIA+ L LK+ Sbjct: 59 QLLDAVMASLDDDKAEEIVQIDLR-GRSSMGDYMVIASGRSTRQVASIAEKLADRLKQ 115 >gi|28199121|ref|NP_779435.1| hypothetical protein PD1234 [Xylella fastidiosa Temecula1] gi|182681848|ref|YP_001830008.1| iojap-like protein [Xylella fastidiosa M23] gi|28057219|gb|AAO29084.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] gi|182631958|gb|ACB92734.1| iojap-like protein [Xylella fastidiosa M23] Length = 148 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L ++TV E ++ LKA+DI I+ +S + D +VI SG ST+HV SIAD ++ + Sbjct: 28 PSLPILLSTVHEAVETLKAKDIVKIDVR-GKSSVADYLVIASGTSTRHVKSIADEVVKFA 86 Query: 74 KKKN 77 K+ N Sbjct: 87 KRLN 90 >gi|329890929|ref|ZP_08269272.1| hypothetical protein BDIM_26380 [Brevundimonas diminuta ATCC 11568] gi|328846230|gb|EGF95794.1| hypothetical protein BDIM_26380 [Brevundimonas diminuta ATCC 11568] Length = 144 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ L + KA+DI I+ +S + D M++ SGRS +HV +IAD+L+ K+ Sbjct: 30 ATELEQAILAKLDDDKAQDIVLIDLR-GKSPMTDAMIVASGRSHRHVGAIADHLLRLFKE 88 >gi|13473415|ref|NP_104982.1| hypothetical protein mll4005 [Mesorhizobium loti MAFF303099] gi|14024164|dbj|BAB50768.1| mll4005 [Mesorhizobium loti MAFF303099] Length = 125 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + I TV+ L++ KAE+I I+ +S + D MV+ SGRS +HV+++AD+L Sbjct: 7 ISVNDAVSRAINTVLASLEDSKAENIVSIDI-QGKSSLGDYMVVASGRSHRHVSAVADHL 65 Query: 70 ISYLKK 75 + LK Sbjct: 66 LKALKD 71 >gi|260574133|ref|ZP_05842138.1| iojap-like protein [Rhodobacter sp. SW2] gi|259023599|gb|EEW26890.1| iojap-like protein [Rhodobacter sp. SW2] Length = 147 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +A V+ L + KAE++ I+ RS + D MVI SGRS++ VA+I++ L+ LK Sbjct: 34 TSEDLLAHVLASLDDDKAEEVVQIDLR-GRSDMADYMVICSGRSSRQVAAISEKLVDRLK 92 >gi|190575348|ref|YP_001973193.1| hypothetical protein Smlt3481 [Stenotrophomonas maltophilia K279a] gi|190013270|emb|CAQ46904.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a] Length = 136 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 6/79 (7%) Query: 1 MLANTEKQALQ-----TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVS 55 M T+ Q ++ + +A+V + ++LKA+D+ I+ RS + D M++VS Sbjct: 1 MSNQTQPQTIKVDLPSPPPSVPELLASVRQATEDLKAKDLVEIDVR-GRSSVADYMIVVS 59 Query: 56 GRSTKHVASIADNLISYLK 74 G ST+HV SIAD ++ + K Sbjct: 60 GTSTRHVKSIADEVVRFAK 78 >gi|163737192|ref|ZP_02144610.1| Iojap-related protein [Phaeobacter gallaeciensis BS107] gi|163740397|ref|ZP_02147791.1| iojap-related protein [Phaeobacter gallaeciensis 2.10] gi|161386255|gb|EDQ10630.1| iojap-related protein [Phaeobacter gallaeciensis 2.10] gi|161389796|gb|EDQ14147.1| Iojap-related protein [Phaeobacter gallaeciensis BS107] Length = 122 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A ++ D +A V+ L + KAED+ I+ ++ I D+MVI SGRST+ VAS+A+ Sbjct: 2 ATKSQPTSDELLARVLSSLNDDKAEDVVQIDLR-GKTAIGDHMVIASGRSTRQVASMAEK 60 Query: 69 LISYLKKK 76 L LK++ Sbjct: 61 LADRLKQE 68 >gi|313679436|ref|YP_004057175.1| iojap-like protein [Oceanithermus profundus DSM 14977] gi|313152151|gb|ADR36002.1| iojap-like protein [Oceanithermus profundus DSM 14977] Length = 115 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + I + + L++ KAE++ ++ + + D VI +G S H+ ++ D++ Sbjct: 1 MVKTIDAVELITKITQALEDKKAENVVALDLRKVSDSL-DYFVIATGTSQPHLQALQDHV 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 QEKLRE 65 >gi|254251815|ref|ZP_04945133.1| hypothetical protein BDAG_01016 [Burkholderia dolosa AUO158] gi|124894424|gb|EAY68304.1| hypothetical protein BDAG_01016 [Burkholderia dolosa AUO158] Length = 169 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 16/74 (21%), Positives = 39/74 (52%), Gaps = 5/74 (6%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +A+T ++ + +++ L+++KA+DI TS + + D +++ SG S + Sbjct: 13 IASTTTDSM----DIRKLQRVIVDALEDIKAQDIKVFN-TSHLTELFDRVIVASGTSNRQ 67 Query: 62 VASIADNLISYLKK 75 ++A N+ +K+ Sbjct: 68 TKALASNVRDKVKE 81 >gi|146308815|ref|YP_001189280.1| iojap-like protein [Pseudomonas mendocina ymp] gi|145577016|gb|ABP86548.1| iojap-like protein [Pseudomonas mendocina ymp] Length = 122 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + L+E+KA DI I+ ++ I D MVI SG S++ V S+ +N Sbjct: 1 MSKQNMPSEELVKIAVAALEEIKATDITVIDVKD-KTSITDFMVIASGSSSRQVKSLVEN 59 Query: 69 LISYLKKK 76 ++ +K++ Sbjct: 60 VLEKVKEQ 67 >gi|197284328|ref|YP_002150200.1| hypothetical protein PMI0428 [Proteus mirabilis HI4320] gi|194681815|emb|CAR41068.1| conserved hypothetical protein [Proteus mirabilis HI4320] Length = 105 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ L++ KA+DI ++ +S + D M+I +G S +H+ S+ADNL+ ++ Sbjct: 4 SELQQFIIDKLEDSKAQDIIALDVR-GKSSVTDYMIICTGTSNRHLMSVADNLVDDCRE 61 >gi|256419513|ref|YP_003120166.1| iojap-like protein [Chitinophaga pinensis DSM 2588] gi|256034421|gb|ACU57965.1| iojap-like protein [Chitinophaga pinensis DSM 2588] Length = 135 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 18/73 (24%), Positives = 34/73 (46%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 +T K+AL +T+++ ++E K E+I ++ + + D VI S V Sbjct: 8 STRKKALTRLSRESEIFSTIIKAIQEKKGENIVSLDLRQIPEAVADFFVICEANSNTQVR 67 Query: 64 SIADNLISYLKKK 76 +IAD + + K Sbjct: 68 AIADYVEDQVSKH 80 >gi|120555326|ref|YP_959677.1| iojap-like protein [Marinobacter aquaeolei VT8] gi|120325175|gb|ABM19490.1| iojap-like protein [Marinobacter aquaeolei VT8] Length = 116 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L+ +KA+DI I+ R+ + D MV+ SG S +HV S+AD+++ K Sbjct: 2 QAEQLKDLVVNALENIKAQDISVIDVRD-RTSVTDFMVLASGTSNRHVKSLADSVVIEAK 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|254522464|ref|ZP_05134519.1| iojap family protein [Stenotrophomonas sp. SKA14] gi|219720055|gb|EED38580.1| iojap family protein [Stenotrophomonas sp. SKA14] Length = 136 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 6/79 (7%) Query: 1 MLANTEKQALQ-----TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVS 55 M T+ Q ++ + +A+V + ++LKA+D+ I+ RS + D M++VS Sbjct: 1 MSNQTQPQTIKVDLPSPPPSVPELLASVRQATEDLKAKDLVEIDVR-GRSSVADYMIVVS 59 Query: 56 GRSTKHVASIADNLISYLK 74 G ST+HV SIAD ++ + K Sbjct: 60 GTSTRHVKSIADEVVRFAK 78 >gi|254477191|ref|ZP_05090577.1| iojap family protein [Ruegeria sp. R11] gi|214031434|gb|EEB72269.1| iojap family protein [Ruegeria sp. R11] Length = 122 Score = 75.5 bits (185), Expect = 2e-12, Method: Composition-based stats. Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A ++ D +A V+ L + KAED+ I+ ++ I D+MVI SGRST+ VAS+A+ Sbjct: 2 ATKSQPTSDQLLARVLSSLDDDKAEDVVQIDLR-GKTAIGDHMVIASGRSTRQVASMAEK 60 Query: 69 LISYLKK 75 L LK+ Sbjct: 61 LADRLKQ 67 >gi|330505019|ref|YP_004381888.1| iojap-like protein [Pseudomonas mendocina NK-01] gi|328919305|gb|AEB60136.1| iojap-like protein [Pseudomonas mendocina NK-01] Length = 122 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D + + L+E+KA DI I+ ++ I D MVI SG S++ V S+ +N Sbjct: 1 MSKQNMPSDELVKIAVAALEEIKATDITVIDVKD-KTSITDFMVIASGSSSRQVKSLVEN 59 Query: 69 LISYLKKK 76 ++ +K++ Sbjct: 60 VLEKVKEQ 67 >gi|254470649|ref|ZP_05084052.1| iojap family protein [Pseudovibrio sp. JE062] gi|211959791|gb|EEA94988.1| iojap family protein [Pseudovibrio sp. JE062] Length = 111 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A ++ L++ KAEDI ++ +S + D+MV+ SGRS +HV ++AD+L+ LK Sbjct: 1 MLALILNSLEDSKAEDIVSLDLA-GKSALADHMVVASGRSHRHVGAVADHLLRDLK 55 >gi|114765543|ref|ZP_01444651.1| iojap-related protein [Pelagibaca bermudensis HTCC2601] gi|114542136|gb|EAU45168.1| iojap-related protein [Roseovarius sp. HTCC2601] Length = 123 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q+ + +A ++E L + KAED+ I+ ++ +CD MV+ SGRS++ V SIA+ L+ Sbjct: 6 QSEVTSEQILARILESLDDNKAEDVVQIDLR-GKTSVCDQMVVCSGRSSRQVVSIAEKLV 64 Query: 71 SYLK 74 LK Sbjct: 65 EDLK 68 >gi|21243504|ref|NP_643086.1| hypothetical protein XAC2777 [Xanthomonas axonopodis pv. citri str. 306] gi|78048489|ref|YP_364664.1| hypothetical protein XCV2933 [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|289663238|ref|ZP_06484819.1| iojap-like protein [Xanthomonas campestris pv. vasculorum NCPPB702] gi|289668268|ref|ZP_06489343.1| iojap-like protein [Xanthomonas campestris pv. musacearum NCPPB4381] gi|294625529|ref|ZP_06704157.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|294666088|ref|ZP_06731347.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|325926330|ref|ZP_08187662.1| hypothetical protein XPE_1633 [Xanthomonas perforans 91-118] gi|21109065|gb|AAM37622.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri str. 306] gi|78036919|emb|CAJ24612.1| conserved hypothetical protein [Xanthomonas campestris pv. vesicatoria str. 85-10] gi|292600198|gb|EFF44307.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122] gi|292604147|gb|EFF47539.1| conserved hypothetical protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535] gi|325543281|gb|EGD14712.1| hypothetical protein XPE_1633 [Xanthomonas perforans 91-118] Length = 137 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 27/64 (42%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + +ATV E ++ELKA+D+ I+ +S +CD MV+VSG ST+HV SIAD ++ + Sbjct: 17 PSVPALLATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVVSGTSTRHVKSIADEVVKFA 75 Query: 74 KKKN 77 K+ + Sbjct: 76 KRLD 79 >gi|328545766|ref|YP_004305875.1| Iojap-like protein [polymorphum gilvum SL003B-26A1] gi|326415506|gb|ADZ72569.1| Iojap-like protein [Polymorphum gilvum SL003B-26A1] Length = 129 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I TV+ L E KAED+ ++ +S + D MVI SGRS +HV +IAD+L+ LK+ Sbjct: 18 DLIDTVLASLDESKAEDVVSLKIA-GKSPLADYMVIASGRSHRHVGAIADHLLRDLKE 74 >gi|110635782|ref|YP_675990.1| iojap-like protein [Mesorhizobium sp. BNC1] gi|110286766|gb|ABG64825.1| iojap-like protein [Chelativorans sp. BNC1] Length = 150 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D L + T ++ L++ KAE+I I+ +S + D M++ SGRS +HVA+++++LI Sbjct: 35 EDSLSRALETALQSLEDSKAENIVPIDI-QGKSPLADYMIVASGRSHRHVAAVSEHLIRA 93 Query: 73 LKK 75 LK Sbjct: 94 LKD 96 >gi|58582948|ref|YP_201964.1| hypothetical protein XOO3325 [Xanthomonas oryzae pv. oryzae KACC10331] gi|84624795|ref|YP_452167.1| hypothetical protein XOO_3138 [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|166711422|ref|ZP_02242629.1| hypothetical protein Xoryp_08135 [Xanthomonas oryzae pv. oryzicola BLS256] gi|58427542|gb|AAW76579.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] gi|84368735|dbj|BAE69893.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] Length = 138 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 27/62 (43%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + +ATV E ++ELKA+D+ I+ +S +CD MV+VSG ST+HV SIAD ++ + Sbjct: 17 PSVPALLATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVVSGTSTRHVKSIADEVVKFA 75 Query: 74 KK 75 K+ Sbjct: 76 KR 77 >gi|260466731|ref|ZP_05812917.1| iojap-like protein [Mesorhizobium opportunistum WSM2075] gi|259029461|gb|EEW30751.1| iojap-like protein [Mesorhizobium opportunistum WSM2075] Length = 125 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + I TV+ L++ KAE+I I+ +S + D MV+ SGRS +HV+++AD+L+ L Sbjct: 11 DAVSRAIKTVLASLEDSKAENIVSIDI-QGKSSLGDYMVVASGRSHRHVSAVADHLLKAL 69 Query: 74 KK 75 K Sbjct: 70 KD 71 >gi|163745345|ref|ZP_02152705.1| iojap-like protein [Oceanibulbus indolifex HEL-45] gi|161382163|gb|EDQ06572.1| iojap-like protein [Oceanibulbus indolifex HEL-45] Length = 170 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D +A ++ L + KAEDI I+ ++ I D MVI SGRST+ V++IA+ L +K Sbjct: 56 TSDDLLALILSSLNDDKAEDIVQIDLR-GKTAIGDYMVICSGRSTRQVSAIAEKLAQAVK 114 Query: 75 K 75 Sbjct: 115 D 115 >gi|254431379|ref|ZP_05045082.1| iojap family protein [Cyanobium sp. PCC 7001] gi|197625832|gb|EDY38391.1| iojap family protein [Cyanobium sp. PCC 7001] Length = 136 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ V E + KA DI I S + D VI SG S V +IA ++ L Sbjct: 15 PQTEALARLVAEGCDDRKAVDIRLIRV-DEVSSLADWFVICSGLSDVQVRAIARSVEDKL 73 Query: 74 KKK 76 ++K Sbjct: 74 EEK 76 >gi|307825460|ref|ZP_07655678.1| iojap-like protein [Methylobacter tundripaludum SV96] gi|307733346|gb|EFO04205.1| iojap-like protein [Methylobacter tundripaludum SV96] Length = 117 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + V E L E K ++I ++ ++ D MV+V+G S +H+ S+ + + LK Sbjct: 2 QAEDILKIVQEVLDERKGQNITTLDVR-GKTSFTDYMVVVTGTSDRHLKSLCEYVSEKLK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|186476822|ref|YP_001858292.1| iojap-like protein [Burkholderia phymatum STM815] gi|184193281|gb|ACC71246.1| iojap-like protein [Burkholderia phymatum STM815] Length = 152 Score = 75.1 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRAIVDGLEDVKAQDIRVFN-TSHLTELFDRVIVASGTSNRQTKALASSVREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|301632137|ref|XP_002945147.1| PREDICTED: hypothetical protein LOC100495456 [Xenopus (Silurana) tropicalis] Length = 588 Score = 74.7 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 11/74 (14%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + + +++ L+++KA+DI T S + + +++ +G S + Sbjct: 26 MTTSTPTETAAKKDVAKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVIVATGSSNRQ 84 Query: 62 VASIADNLISYLKK 75 ++A ++ ++K Sbjct: 85 TKALAASVRDAVRK 98 >gi|226331020|ref|ZP_03806538.1| hypothetical protein PROPEN_04950 [Proteus penneri ATCC 35198] gi|225201815|gb|EEG84169.1| hypothetical protein PROPEN_04950 [Proteus penneri ATCC 35198] Length = 108 Score = 74.7 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ L++ KA+DI ++ +S + D M+I +G S++H+ S+ADNL+ ++ Sbjct: 7 SELQQFIIDKLEDSKAQDIIALDVR-GKSSVTDYMIICTGTSSRHLMSVADNLVDDCRE 64 >gi|149915328|ref|ZP_01903855.1| iojap-related protein [Roseobacter sp. AzwK-3b] gi|149810617|gb|EDM70458.1| iojap-related protein [Roseobacter sp. AzwK-3b] Length = 121 Score = 74.7 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + ++ L + KAE+I I+ +S +CD MVI SGRS++ V+SIA+ L LK Sbjct: 8 TSEAQLDCILTSLDDDKAEEIVQIDLR-GKSAMCDYMVICSGRSSRQVSSIAEKLAERLK 66 Query: 75 KK 76 +K Sbjct: 67 QK 68 >gi|86747381|ref|YP_483877.1| Iojap-related protein [Rhodopseudomonas palustris HaA2] gi|86570409|gb|ABD04966.1| Iojap-related protein [Rhodopseudomonas palustris HaA2] Length = 135 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T T + + ++ L ++KAE+ I+ +S + D +V+ SGR +HV + Sbjct: 13 TPDAISATPLTAEETLQLILSRLDDMKAEEPIAIDIR-GKSAMFDYVVVASGRVNRHVGA 71 Query: 65 IADNLISYLKK 75 IA+N+ LK+ Sbjct: 72 IAENVAKALKE 82 >gi|307730387|ref|YP_003907611.1| iojap-like protein [Burkholderia sp. CCGE1003] gi|307584922|gb|ADN58320.1| iojap-like protein [Burkholderia sp. CCGE1003] Length = 171 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 22 DIRKLQRVIVDALEDVKAQDIRVFN-TSHLTALFDRVIVASGTSNRQTKALASSVREGVK 80 Query: 75 K 75 + Sbjct: 81 E 81 >gi|329847643|ref|ZP_08262671.1| hypothetical protein ABI_07090 [Asticcacaulis biprosthecum C19] gi|328842706|gb|EGF92275.1| hypothetical protein ABI_07090 [Asticcacaulis biprosthecum C19] Length = 149 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + L ++E L + KA+DI I+ +S + D ++I SGRS +HV ++AD+++ L Sbjct: 39 ETLPPLETLIVERLDDDKAQDIVCIDL-KGKSSVADTLIIASGRSHRHVGALADHVLRAL 97 Query: 74 KK 75 K+ Sbjct: 98 KE 99 >gi|254503027|ref|ZP_05115178.1| iojap family protein [Labrenzia alexandrii DFL-11] gi|222439098|gb|EEE45777.1| iojap family protein [Labrenzia alexandrii DFL-11] Length = 136 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 1/71 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 +T +A +AD + TV+ L++ KAED+ ++ +S + D+MVIVSGRS +HV Sbjct: 11 STPLKASVSADLTAGLLDTVLASLEDSKAEDLVTLDIA-GKSSLADHMVIVSGRSHRHVG 69 Query: 64 SIADNLISYLK 74 +IAD+L LK Sbjct: 70 AIADHLQRDLK 80 >gi|149185306|ref|ZP_01863623.1| hypothetical protein ED21_19672 [Erythrobacter sp. SD-21] gi|148831417|gb|EDL49851.1| hypothetical protein ED21_19672 [Erythrobacter sp. SD-21] Length = 119 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L + +A+++ I+ +S I D MVI SGRST+ VASIA L LK Sbjct: 5 DKQELLDFVLKQLDDDQAQEVVTIDLA-GKSSIADYMVIASGRSTRQVASIAQKLAEKLK 63 Query: 75 KK 76 + Sbjct: 64 QN 65 >gi|84515773|ref|ZP_01003134.1| iojap-related protein [Loktanella vestfoldensis SKA53] gi|84510215|gb|EAQ06671.1| iojap-related protein [Loktanella vestfoldensis SKA53] Length = 151 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Query: 9 ALQTAD--HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 A+Q + + ++ +A V++ L + K EDI I +S + D MVI SGRST+ V+++A Sbjct: 33 AMQALNIVNSETILAAVLQSLDDDKGEDIVQINLR-GKSEMGDYMVIASGRSTRQVSAMA 91 Query: 67 DNLISYLKKK 76 + L LK++ Sbjct: 92 EKLADKLKQE 101 >gi|290476195|ref|YP_003469095.1| hypothetical protein XBJ1_3210 [Xenorhabdus bovienii SS-2004] gi|289175528|emb|CBJ82331.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004] Length = 134 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 V++ L++ KA+DI I+ +S I D MVI +G ST+H+ S+ADNL+ ++ Sbjct: 34 ELQKFVIDKLEDSKAQDIVSIDVR-GKSSITDCMVICTGTSTRHLMSVADNLVDDCRE 90 >gi|254463254|ref|ZP_05076670.1| iojap family protein [Rhodobacterales bacterium HTCC2083] gi|206679843|gb|EDZ44330.1| iojap family protein [Rhodobacteraceae bacterium HTCC2083] Length = 144 Score = 74.7 bits (183), Expect = 4e-12, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D+ +A ++ L+E KAED+ I+ ++ I D M++ SGRST+ V +I++ L +K Sbjct: 30 SSDALLAFILNSLEEDKAEDVVKIDLR-GKTAIGDYMIVCSGRSTRQVVAISEKLSDRMK 88 Query: 75 KK 76 ++ Sbjct: 89 QE 90 >gi|296160582|ref|ZP_06843397.1| iojap-like protein [Burkholderia sp. Ch1-1] gi|295889108|gb|EFG68911.1| iojap-like protein [Burkholderia sp. Ch1-1] Length = 171 Score = 74.4 bits (182), Expect = 4e-12, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ Sbjct: 19 NLMDIRKLQRVIVDALEDVKAQDIKVFN-TSHLTALFDRVIVASGTSNRQTKALASSVRE 77 Query: 72 YLKKK 76 +K+ Sbjct: 78 SVKEN 82 >gi|163867456|ref|YP_001608655.1| hypothetical protein Btr_0176 [Bartonella tribocorum CIP 105476] gi|161017102|emb|CAK00660.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 129 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + +++ L++ KAEDI I+ +S + D MVI S S +HV+SIAD+L+ K Sbjct: 11 SIHESLKIILKSLEDTKAEDIVAIDI-QGKSSLADYMVIASANSQRHVSSIADHLLRIWK 69 Query: 75 K 75 Sbjct: 70 D 70 >gi|158425760|ref|YP_001527052.1| Iojap-related protein precursor [Azorhizobium caulinodans ORS 571] gi|158332649|dbj|BAF90134.1| Iojap-related protein precursor [Azorhizobium caulinodans ORS 571] Length = 125 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 28/76 (36%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Query: 1 MLANTEKQA--LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRS 58 M A T A Q + +A ++ L E KAED+ I+ ++ I D MV+ SGRS Sbjct: 1 MAAETMAAAPISQAQLDAEEILALIVTRLDEDKAEDLVTIDLR-GKTSIADFMVVASGRS 59 Query: 59 TKHVASIADNLISYLK 74 +HV + A++LI LK Sbjct: 60 QRHVGATAEHLIEALK 75 >gi|71902923|ref|YP_279726.1| iojap superfamily protein [Streptococcus pyogenes MGAS6180] gi|71802018|gb|AAX71371.1| iojap protein family [Streptococcus pyogenes MGAS6180] Length = 133 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + V+E E +A+DI ++ + + D VI S +++ + +IADN+ Sbjct: 13 MRNKMKKEELLKIVVEATDEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 71 Query: 70 ISYLKK 75 +K+ Sbjct: 72 REKVKE 77 >gi|312796936|ref|YP_004029858.1| iojap protein family [Burkholderia rhizoxinica HKI 454] gi|312168711|emb|CBW75714.1| iojap protein family [Burkholderia rhizoxinica HKI 454] Length = 131 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + +++ L+++KA+DI TS + + D +V+ SG S + ++A+N+ +K Sbjct: 2 DIRTLQRVIIDALEDVKAQDIRVFN-TSHLTELFDRVVVASGTSNRQTKALANNVREKVK 60 >gi|21232046|ref|NP_637963.1| hypothetical protein XCC2615 [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66767827|ref|YP_242589.1| hypothetical protein XC_1501 [Xanthomonas campestris pv. campestris str. 8004] gi|21113786|gb|AAM41887.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. ATCC 33913] gi|66573159|gb|AAY48569.1| conserved hypothetical protein [Xanthomonas campestris pv. campestris str. 8004] Length = 139 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 25/64 (39%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + +ATV E ++ELKA+D+ I+ +S +CD MV+ SG ST+HV SIA+ ++ + Sbjct: 17 PSVPALLATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVASGTSTRHVKSIAEEVVKFA 75 Query: 74 KKKN 77 K+ + Sbjct: 76 KRLD 79 >gi|167648676|ref|YP_001686339.1| iojap-like protein [Caulobacter sp. K31] gi|167351106|gb|ABZ73841.1| iojap-like protein [Caulobacter sp. K31] Length = 156 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 A T + + ++ L + KA+DI HI+ +S + D++++ SGRS +HV Sbjct: 31 AETSTTETALDKSIKALETLILSRLDDDKAQDIVHIDLKD-KSSVADSLIVASGRSHRHV 89 Query: 63 ASIADNLISYLKKK 76 ++AD++I LK++ Sbjct: 90 GALADHIIRALKEE 103 >gi|241206890|ref|YP_002977986.1| iojap-like protein [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240860780|gb|ACS58447.1| iojap-like protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 149 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 A K A + AD + TV+ L++ KAEDI I+ +S + D M++VSGRS +H Sbjct: 23 FAVIPKSAERGADAAARALETVLASLEDSKAEDIVTIDIA-GKSALGDYMIVVSGRSNRH 81 Query: 62 VASIADNLISYLKK 75 V +I+D+L++ LK Sbjct: 82 VMAISDHLLTDLKD 95 >gi|110834814|ref|YP_693673.1| hypothetical protein ABO_1953 [Alcanivorax borkumensis SK2] gi|110647925|emb|CAL17401.1| conserved hypothetical protein [Alcanivorax borkumensis SK2] Length = 120 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+E+KA++I ++ + + + D MVI SG S +HV ++ADN+ K Sbjct: 7 LLQLVIDALEEVKAQNITPLDVREI-TSVADTMVIASGTSNRHVKALADNVSDAAK 61 >gi|77464445|ref|YP_353949.1| hypothetical protein RSP_0865 [Rhodobacter sphaeroides 2.4.1] gi|126463285|ref|YP_001044399.1| iojap-like protein [Rhodobacter sphaeroides ATCC 17029] gi|77388863|gb|ABA80048.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1] gi|126104949|gb|ABN77627.1| iojap-like protein [Rhodobacter sphaeroides ATCC 17029] Length = 106 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + L + KAEDI I+ RS + D MVI SGRS++ VA+I++ L+ +K++ Sbjct: 2 LASLDDDKAEDIVQIDLR-GRSDMADYMVICSGRSSRQVAAISEKLMDRVKQQ 53 >gi|220935442|ref|YP_002514341.1| iojap-like protein [Thioalkalivibrio sp. HL-EbGR7] gi|219996752|gb|ACL73354.1| iojap-like protein [Thioalkalivibrio sp. HL-EbGR7] Length = 125 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L++LK +DI I+ ++ I D MVI SG S +HV ++AD+++ K Sbjct: 2 QTEELTELVIKALEDLKGQDIKAIDVR-GKTAITDMMVIASGTSDRHVKALADSVVVKAK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|126730877|ref|ZP_01746686.1| Iojap-related protein [Sagittula stellata E-37] gi|126708593|gb|EBA07650.1| Iojap-related protein [Sagittula stellata E-37] Length = 147 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 25/66 (37%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q +A V+ L + KAED+ ++ +S +CD MVI SGRST+ VA+++D L Sbjct: 34 QPDPTSSEILAAVLSTLSDNKAEDVVQVDLR-GKSSVCDWMVIASGRSTRQVAALSDKLA 92 Query: 71 SYLKKK 76 LK + Sbjct: 93 ETLKSE 98 >gi|94987895|ref|YP_595996.1| iojap superfamily protein [Streptococcus pyogenes MGAS9429] gi|94991780|ref|YP_599879.1| iojap superfamily protein [Streptococcus pyogenes MGAS2096] gi|94541403|gb|ABF31452.1| iojap protein family [Streptococcus pyogenes MGAS9429] gi|94545288|gb|ABF35335.1| iojap protein family [Streptococcus pyogenes MGAS2096] Length = 133 Score = 74.4 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + V+E E +A+DI ++ + + D VI S +++ + +IADN+ Sbjct: 13 MRNKMKKEELLKIVVEATDEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 71 Query: 70 ISYLKK 75 +K+ Sbjct: 72 REKVKE 77 >gi|209551453|ref|YP_002283370.1| iojap-like protein [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209537209|gb|ACI57144.1| iojap-like protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 147 Score = 74.4 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 A K A + AD + TV+ L++ KAEDI I+ +S + D M++VSGRS +H Sbjct: 21 FAVIPKSAERGADAAARALETVLASLEDSKAEDIVTIDIA-GKSALGDYMIVVSGRSNRH 79 Query: 62 VASIADNLISYLKK 75 V +I+D+L++ LK Sbjct: 80 VMAISDHLLTDLKD 93 >gi|78067094|ref|YP_369863.1| Iojap-related protein [Burkholderia sp. 383] gi|77967839|gb|ABB09219.1| Iojap-related protein [Burkholderia sp. 383] Length = 148 Score = 74.4 bits (182), Expect = 6e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +V+ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVVVASGTSNRQTKALASSVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|17546913|ref|NP_520315.1| hypothetical protein RSc2194 [Ralstonia solanacearum GMI1000] gi|17429213|emb|CAD15901.1| hypothetical hypothetical protein [Ralstonia solanacearum GMI1000] Length = 203 Score = 74.0 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAASVRDAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|50913639|ref|YP_059611.1| iojap superfamily protein [Streptococcus pyogenes MGAS10394] gi|94989771|ref|YP_597871.1| iojap superfamily protein [Streptococcus pyogenes MGAS10270] gi|50902713|gb|AAT86428.1| iojap protein family [Streptococcus pyogenes MGAS10394] gi|94543279|gb|ABF33327.1| iojap protein family [Streptococcus pyogenes MGAS10270] Length = 133 Score = 74.0 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + V+E E +A+DI ++ + + D VI S +++ + +IADN+ Sbjct: 13 MRNKMKKEELLKIVVEATDEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 71 Query: 70 ISYLKK 75 +K+ Sbjct: 72 REKVKE 77 >gi|116254413|ref|YP_770251.1| hypothetical protein RL4689 [Rhizobium leguminosarum bv. viciae 3841] gi|115259061|emb|CAK10172.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae 3841] Length = 149 Score = 74.0 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 LA K A + AD + TV+ L++ KAEDI I+ +S + D M++VSGRS +H Sbjct: 23 LAVIPKSAERGADAAARALETVLASLEDSKAEDIVTIDIA-GKSALGDYMIVVSGRSNRH 81 Query: 62 VASIADNLISYLKK 75 V +I+D+L++ LK Sbjct: 82 VMAISDHLLTDLKD 95 >gi|296134003|ref|YP_003641250.1| iojap-like protein [Thermincola sp. JR] gi|296032581|gb|ADG83349.1| iojap-like protein [Thermincola potens JR] Length = 114 Score = 74.0 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 AD+ I + ++ KA D+ ++ T + S +CD +I SG S+ V +IA+N+ Sbjct: 2 ADNTQELIYAAVRAAEDKKARDLVVLDLTDI-SPVCDYFLICSGNSSTQVQAIAENIKDK 60 Query: 73 LKKK 76 L++K Sbjct: 61 LREK 64 >gi|254427994|ref|ZP_05041701.1| iojap family protein [Alcanivorax sp. DG881] gi|196194163|gb|EDX89122.1| iojap family protein [Alcanivorax sp. DG881] Length = 120 Score = 74.0 bits (181), Expect = 6e-12, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+E+KA++I ++ + + + DNMVI SG S +HV ++AD++ K Sbjct: 7 LLQLVIDALEEVKAQNITPLDVREI-TSVADNMVIASGTSNRHVKALADSVADAAK 61 >gi|254780562|ref|YP_003064975.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] gi|254040239|gb|ACT57035.1| hypothetical protein CLIBASIA_02245 [Candidatus Liberibacter asiaticus str. psy62] Length = 77 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 77/77 (100%), Positives = 77/77 (100%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK Sbjct: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 Query: 61 HVASIADNLISYLKKKN 77 HVASIADNLISYLKKKN Sbjct: 61 HVASIADNLISYLKKKN 77 >gi|84684463|ref|ZP_01012364.1| iojap-related protein [Maritimibacter alkaliphilus HTCC2654] gi|84667442|gb|EAQ13911.1| iojap-related protein [Rhodobacterales bacterium HTCC2654] Length = 122 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D+ + TV+ L++ KAEDI I+ +S + D MVI SGRS++ VA+I++ L L Sbjct: 8 PSSDNILDTVLSSLEDDKAEDIVTIDLRK-KSAMADAMVICSGRSSRQVAAISEKLCDRL 66 Query: 74 KK 75 K+ Sbjct: 67 KE 68 >gi|94309726|ref|YP_582936.1| Iojap-related protein [Cupriavidus metallidurans CH34] gi|93353578|gb|ABF07667.1| conserved hypothetical protein [Cupriavidus metallidurans CH34] Length = 256 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 K + + +++ L+++KA+DI + T + + D +VI SG S + ++ Sbjct: 1 MKLNKKDTMDIRKLQRAIVDGLEDVKAQDIKVFDTTH-LTELFDRVVIASGNSNRQTKAL 59 Query: 66 ADNLISYLKK 75 A ++ +K Sbjct: 60 AASVRDTVKD 69 >gi|259418099|ref|ZP_05742018.1| putative iojap family protein [Silicibacter sp. TrichCH4B] gi|259347005|gb|EEW58819.1| putative iojap family protein [Silicibacter sp. TrichCH4B] Length = 119 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ L E KAED+ I+ ++ I D MV+ SGRST+ VA++++ L LK Sbjct: 9 SSEDLLERILSSLDEDKAEDVTRIDLR-GKTSIGDYMVVASGRSTRQVAAMSEKLTEKLK 67 Query: 75 KK 76 + Sbjct: 68 HE 69 >gi|77461193|ref|YP_350700.1| hypothetical protein Pfl01_4972 [Pseudomonas fluorescens Pf0-1] gi|77385196|gb|ABA76709.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1] Length = 164 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 D + + L+++KA+DI I+ +S I D M+I +G S + + ++ D + +KK Sbjct: 33 DELVKVAVAALEDVKAQDIQIIDVRDKQS-ITDYMIIATGTSNRQINAMLDKVREEVKKN 91 >gi|88860570|ref|ZP_01135208.1| iojap domain protein [Pseudoalteromonas tunicata D2] gi|88817768|gb|EAR27585.1| iojap domain protein [Pseudoalteromonas tunicata D2] Length = 105 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ + ++K DI ++ +S I D +++ SG S +HV SIA+NL K Sbjct: 2 ETTELLEFALDKIDDMKGRDIVTLDVR-GKSTITDYLIVCSGNSKRHVQSIAENLNKEAK 60 >gi|262369866|ref|ZP_06063193.1| conserved hypothetical protein [Acinetobacter johnsonii SH046] gi|262314905|gb|EEY95945.1| conserved hypothetical protein [Acinetobacter johnsonii SH046] Length = 134 Score = 74.0 bits (181), Expect = 7e-12, Method: Composition-based stats. Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 2/74 (2%) Query: 3 ANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +N+ A+ T + +C+ V E L+++KA+DI I+ SL S + D +VI SG ST+H Sbjct: 10 SNSHDFAMNTQAADVQACLKVVHEALEDVKAKDILAIDV-SLISNVADAIVIASGTSTRH 68 Query: 62 VASIADNLISYLKK 75 + ++ADN+ +K Sbjct: 69 IKALADNVAEEARK 82 >gi|167585913|ref|ZP_02378301.1| iojap-like protein [Burkholderia ubonensis Bu] Length = 150 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|187929471|ref|YP_001899958.1| iojap-like protein [Ralstonia pickettii 12J] gi|309781754|ref|ZP_07676487.1| iojap family protein [Ralstonia sp. 5_7_47FAA] gi|187726361|gb|ACD27526.1| iojap-like protein [Ralstonia pickettii 12J] gi|308919395|gb|EFP65059.1| iojap family protein [Ralstonia sp. 5_7_47FAA] Length = 205 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAASVRDAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|227823688|ref|YP_002827661.1| hypothetical protein NGR_c31740 [Sinorhizobium fredii NGR234] gi|227342690|gb|ACP26908.1| conserved hypothetical protein [Sinorhizobium fredii NGR234] Length = 148 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+E L++ KAEDI I +S + D MV+VSGRS +HV +IAD+L++ LK + Sbjct: 40 LKLVLESLEDSKAEDIISINIA-GKSALGDFMVVVSGRSNRHVMAIADHLVTDLKDE 95 >gi|254439986|ref|ZP_05053480.1| iojap family protein [Octadecabacter antarcticus 307] gi|198255432|gb|EDY79746.1| iojap family protein [Octadecabacter antarcticus 307] Length = 129 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A + D+ +A V++ L + K ED+ I +S + D MVI SGRS++ V+++A+ Sbjct: 1 MSVQAPNSDTTLAAVLKSLDDDKGEDVVQINL-HGKSEMGDYMVIASGRSSRQVSAMAEK 59 Query: 69 LISYLKK 75 L LKK Sbjct: 60 LTDRLKK 66 >gi|221640337|ref|YP_002526599.1| Iojap-like protein [Rhodobacter sphaeroides KD131] gi|221161118|gb|ACM02098.1| Iojap-like protein [Rhodobacter sphaeroides KD131] Length = 106 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + L + KAEDI I+ RS + D MVI SGRS++ VA+I++ L+ +K++ Sbjct: 2 LASLDDDKAEDIVQIDLR-GRSDMADYMVICSGRSSRQVAAISEKLMDRVKQQ 53 >gi|271499703|ref|YP_003332728.1| iojap-like protein [Dickeya dadantii Ech586] gi|270343258|gb|ACZ76023.1| iojap-like protein [Dickeya dadantii Ech586] Length = 105 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI + +S I D MVI +G S++HV+SIAD+++ Sbjct: 4 QALQDFVIDKLDDLKGQDIVALNV-KGKSSITDYMVICTGTSSRHVSSIADHVVQE 58 >gi|218438756|ref|YP_002377085.1| iojap-like protein [Cyanothece sp. PCC 7424] gi|218171484|gb|ACK70217.1| iojap-like protein [Cyanothece sp. PCC 7424] Length = 144 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + T++ + KA DI ++ + S + D +IV+G S V +I+D + Sbjct: 21 EAEQKTNRLVRTILTAADDRKAADIVALDVSE-VSYLTDYFIIVTGFSRTQVKAISDAIE 79 Query: 71 SYLKKK 76 + K+ Sbjct: 80 EKVAKE 85 >gi|88811887|ref|ZP_01127140.1| uncharacterized plant Iojap protein [Nitrococcus mobilis Nb-231] gi|88790771|gb|EAR21885.1| uncharacterized plant Iojap protein [Nitrococcus mobilis Nb-231] Length = 124 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ +D + L+++KAE++ ++ R+ I D MV SG S +HV SIAD Sbjct: 1 MMKPVKAVDEVRRIIQTALEDIKAENVVVLDVRR-RTSITDFMVFASGTSRRHVKSIADR 59 Query: 69 LISYLKKK 76 ++ K+ Sbjct: 60 ILEAAKRN 67 >gi|218682465|ref|ZP_03530066.1| iojap-like protein [Rhizobium etli CIAT 894] Length = 147 Score = 73.6 bits (180), Expect = 8e-12, Method: Composition-based stats. Identities = 30/74 (40%), Positives = 46/74 (62%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 LA K A + AD + TV+ L++ KAEDI I+ +S + D M++VSGRS +H Sbjct: 21 LAVIPKSAERGADAAARALETVLASLEDSKAEDIVTIDIA-GKSALGDYMIVVSGRSNRH 79 Query: 62 VASIADNLISYLKK 75 V +I+D+L++ LK Sbjct: 80 VMAISDHLLTDLKD 93 >gi|255022275|ref|ZP_05294266.1| Iojap-like protein [Acidithiobacillus caldus ATCC 51756] gi|254968284|gb|EET25855.1| Iojap-like protein [Acidithiobacillus caldus ATCC 51756] Length = 117 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V+ L E K + I I+ ++ I D +VI SG S + + ++++ ++ Sbjct: 1 MPTAEEVRDLVVHALDEHKGQSIETIDVR-CQTDITDYLVIASGTSDRQLRALSEAVVEA 59 Query: 73 LK 74 L+ Sbjct: 60 LR 61 >gi|238791642|ref|ZP_04635280.1| hypothetical protein yinte0001_27990 [Yersinia intermedia ATCC 29909] gi|238729258|gb|EEQ20774.1| hypothetical protein yinte0001_27990 [Yersinia intermedia ATCC 29909] Length = 105 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 4 KALQEFVIDKLDDLKGQDIITLDV-QGKSSITDYMIICTGTSTRHVMALADNLVQE 58 >gi|73542211|ref|YP_296731.1| Iojap-related protein [Ralstonia eutropha JMP134] gi|72119624|gb|AAZ61887.1| Iojap-related protein [Ralstonia eutropha JMP134] Length = 241 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI + T + + D +VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRAIVDGLEDVKAQDIKVYDTTH-LTELFDRVVIASGTSNRQTKALAASVRDTVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|306827993|ref|ZP_07461260.1| iojap-like protein [Streptococcus pyogenes ATCC 10782] gi|304429912|gb|EFM32954.1| iojap-like protein [Streptococcus pyogenes ATCC 10782] Length = 125 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + V+E E +A+DI ++ + + D VI S +++ + +IADN+ Sbjct: 5 MRNKMKKEELLKIVVEATDEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 63 Query: 70 ISYLKK 75 +K+ Sbjct: 64 REKVKE 69 >gi|123443215|ref|YP_001007189.1| hypothetical protein YE3000 [Yersinia enterocolitica subsp. enterocolitica 8081] gi|332160859|ref|YP_004297436.1| hypothetical protein YE105_C1237 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|122090176|emb|CAL13039.1| conserved hypothetical protein [Yersinia enterocolitica subsp. enterocolitica 8081] gi|325665089|gb|ADZ41733.1| hypothetical protein YE105_C1237 [Yersinia enterocolitica subsp. palearctica 105.5R(r)] gi|330863388|emb|CBX73510.1| uncharacterized protein ybeB [Yersinia enterocolitica W22703] Length = 105 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 4 KALQEFVIDKLDDLKGQDIITLDV-QGKSSITDYMIICTGTSTRHVMALADNLVQE 58 >gi|313109446|ref|ZP_07795406.1| hypothetical protein PA39016_001790046 [Pseudomonas aeruginosa 39016] gi|310881908|gb|EFQ40502.1| hypothetical protein PA39016_001790046 [Pseudomonas aeruginosa 39016] Length = 110 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 35/54 (64%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ L++LKA+DI ++ ++ + D MVI G S++ V S+ADN+++ K+ Sbjct: 2 AIDALEDLKAQDIVTLDVRD-KTSVTDYMVIACGSSSRQVKSLADNVLTKAKEN 54 >gi|153835761|ref|ZP_01988428.1| iojap-related protein [Vibrio harveyi HY01] gi|156973528|ref|YP_001444435.1| hypothetical protein VIBHAR_01219 [Vibrio harveyi ATCC BAA-1116] gi|269961552|ref|ZP_06175914.1| conserved hypothetical protein [Vibrio harveyi 1DA3] gi|148867552|gb|EDL66883.1| iojap-related protein [Vibrio harveyi HY01] gi|156525122|gb|ABU70208.1| hypothetical protein VIBHAR_01219 [Vibrio harveyi ATCC BAA-1116] gi|269833593|gb|EEZ87690.1| conserved hypothetical protein [Vibrio harveyi 1DA3] Length = 105 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE+I ++ +S + D M+I +G S +HV+SIAD++ S +KK Sbjct: 4 EELKDFLADKADDMKAEEIVILDV-EGKSSVTDYMIICTGTSKRHVSSIADHVASEVKK 61 >gi|167835993|ref|ZP_02462876.1| iojap-like protein [Burkholderia thailandensis MSMB43] Length = 158 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|107023236|ref|YP_621563.1| Iojap-related protein [Burkholderia cenocepacia AU 1054] gi|116690319|ref|YP_835942.1| iojap-like protein [Burkholderia cenocepacia HI2424] gi|170733657|ref|YP_001765604.1| iojap-like protein [Burkholderia cenocepacia MC0-3] gi|206560751|ref|YP_002231516.1| hypothetical protein BCAL2392 [Burkholderia cenocepacia J2315] gi|105893425|gb|ABF76590.1| Iojap-related protein [Burkholderia cenocepacia AU 1054] gi|116648408|gb|ABK09049.1| iojap-like protein [Burkholderia cenocepacia HI2424] gi|169816899|gb|ACA91482.1| iojap-like protein [Burkholderia cenocepacia MC0-3] gi|198036793|emb|CAR52693.1| conserved hypothetical protein [Burkholderia cenocepacia J2315] Length = 147 Score = 73.6 bits (180), Expect = 9e-12, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +V+ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVVVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|300703520|ref|YP_003745122.1| hypothetical protein RCFBP_11202 [Ralstonia solanacearum CFBP2957] gi|299071183|emb|CBJ42499.1| conserved protein of unknown function, DUF143 [Ralstonia solanacearum CFBP2957] Length = 209 Score = 73.6 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAASVRDAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|209517575|ref|ZP_03266414.1| iojap-like protein [Burkholderia sp. H160] gi|209501988|gb|EEA02005.1| iojap-like protein [Burkholderia sp. H160] Length = 149 Score = 73.6 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTSLFDRVIVASGTSNRQTKALASSVREGVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|330811932|ref|YP_004356394.1| hypothetical protein PSEBR_a4966 [Pseudomonas brassicacearum subsp. brassicacearum NFM421] gi|327380040|gb|AEA71390.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp. brassicacearum NFM421] Length = 164 Score = 73.6 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + L+++KA+DI I+ +S I D M+I +G S + + ++ D + +K + Sbjct: 33 EELVKVAVAALEDVKAQDIQVIDVREKQS-ITDYMIIATGTSNRQIGAMLDKVREAVKAQ 91 >gi|318604761|emb|CBY26259.1| iojap protein [Yersinia enterocolitica subsp. palearctica Y11] Length = 105 Score = 73.6 bits (180), Expect = 1e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 4 KALQEFVIDKLDDLKGQDIITLDV-QGKSSITDYMIICTGTSTRHVMALADNLVQE 58 >gi|90581611|ref|ZP_01237402.1| hypothetical protein VAS14_00596 [Vibrio angustum S14] gi|90437194|gb|EAS62394.1| hypothetical protein VAS14_00596 [Vibrio angustum S14] Length = 105 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + ++KA+DI I+ +S I D MVI +G S +HV+SIAD++ K Sbjct: 2 QVQELHDFIVDKIDDIKAQDIVTIDVR-GKSSITDVMVICTGTSNRHVSSIADHVNKESK 60 >gi|289209287|ref|YP_003461353.1| iojap-like protein [Thioalkalivibrio sp. K90mix] gi|288944918|gb|ADC72617.1| iojap-like protein [Thioalkalivibrio sp. K90mix] Length = 130 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + V L+++KA++I I+ ++ + D MVI SG S +HV S A+++ K Sbjct: 2 NSEQLLELVTTALEDIKAQNIRTIDVR-GKTTLADYMVIASGTSGRHVQSAAESVALEAK 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|296136794|ref|YP_003644036.1| iojap-like protein [Thiomonas intermedia K12] gi|295796916|gb|ADG31706.1| iojap-like protein [Thiomonas intermedia K12] Length = 257 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + T+++ L+++KA+DI T + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRTIVDALEDVKAQDIEVFN-TEELTSLFDRVIVASGTSNRQTRALASSVRDSVK 60 >gi|15674477|ref|NP_268651.1| iojap protein family [Streptococcus pyogenes M1 GAS] gi|56808379|ref|ZP_00366133.1| COG0799: Uncharacterized homolog of plant Iojap protein [Streptococcus pyogenes M49 591] gi|71910079|ref|YP_281629.1| iojap superfamily protein [Streptococcus pyogenes MGAS5005] gi|209558824|ref|YP_002285296.1| hypothetical protein Spy49_0262 [Streptococcus pyogenes NZ131] gi|13621576|gb|AAK33372.1| conserved hypothetical protein [Streptococcus pyogenes M1 GAS] gi|71852861|gb|AAZ50884.1| iojap protein family [Streptococcus pyogenes MGAS5005] gi|209540025|gb|ACI60601.1| hypothetical protein Spy49_0262 [Streptococcus pyogenes NZ131] Length = 125 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + V+E +E +A+DI ++ + + D VI S +++ + +IADN+ Sbjct: 5 MRNKMKKEELLKIVVEATEEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 63 Query: 70 ISYLKK 75 +K+ Sbjct: 64 REKVKE 69 >gi|114571333|ref|YP_758013.1| iojap-like protein [Maricaulis maris MCS10] gi|114341795|gb|ABI67075.1| iojap-like protein [Maricaulis maris MCS10] Length = 143 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 25/60 (41%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ +++ L + KAED+ I+ +S I D MVI SGRS +HVAS+AD+L+ LK Sbjct: 33 TEALETLILDSLDDDKAEDVVAIDLR-GKSSITDIMVIASGRSARHVASLADHLVRKLKD 91 >gi|312866396|ref|ZP_07726614.1| iojap-like protein [Streptococcus downei F0415] gi|311098090|gb|EFQ56316.1| iojap-like protein [Streptococcus downei F0415] Length = 117 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D + V++ E +AEDI ++ + + D +I+S +T+ + +IADN+ +K+ Sbjct: 4 DELLKIVVQAADEKRAEDIVALDLA-GLTSLTDYFIIMSAMNTRQLEAIADNIREKVKE 61 >gi|307578097|gb|ADN62066.1| iojap-like protein [Xylella fastidiosa subsp. fastidiosa GB514] Length = 137 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 40/64 (62%), Gaps = 1/64 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L ++TV E ++ LKA+DI I+ +S + D +VI SG ST+HV SIAD ++ + Sbjct: 17 PSLPILLSTVHEAVETLKAKDIVKIDVR-GKSSVADYLVIASGTSTRHVKSIADEVVKFA 75 Query: 74 KKKN 77 K+ N Sbjct: 76 KRLN 79 >gi|99082346|ref|YP_614500.1| Iojap-related protein [Ruegeria sp. TM1040] gi|99038626|gb|ABF65238.1| Iojap-related protein [Ruegeria sp. TM1040] Length = 119 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 38/68 (55%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A T + + ++ L E KAED+ I+ ++ I D MV+ SGRST+ VA++++ Sbjct: 3 ASATQFSSEDLLERILSSLDEDKAEDVTQIDLR-GKTSIGDYMVVASGRSTRQVAAMSEK 61 Query: 69 LISYLKKK 76 L LK + Sbjct: 62 LTEKLKHE 69 >gi|299066206|emb|CBJ37390.1| conserved protein of unknown function, DUF143 [Ralstonia solanacearum CMR15] Length = 215 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAVSVRDAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|319780952|ref|YP_004140428.1| iojap-like protein [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317166840|gb|ADV10378.1| iojap-like protein [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 125 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + I TV+ L++ KAE+I I+ +S + D MV+ SGRS +HVA++AD+L+ + Sbjct: 11 DAVSRAIKTVLASLEDSKAENIVSIDI-QGKSSLGDYMVVASGRSHRHVAAVADHLLKAI 69 Query: 74 KK 75 K Sbjct: 70 KD 71 >gi|167580364|ref|ZP_02373238.1| iojap-like protein [Burkholderia thailandensis TXDOH] Length = 154 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|89074970|ref|ZP_01161415.1| hypothetical protein SKA34_20857 [Photobacterium sp. SKA34] gi|89049209|gb|EAR54773.1| hypothetical protein SKA34_20857 [Photobacterium sp. SKA34] Length = 105 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + ++KA+DI I+ +S I D MVI +G S +HV+SIAD++ K Sbjct: 2 QVQELQDFIVDKIDDIKAQDIVTIDVR-GKSSITDVMVICTGSSNRHVSSIADHVNKESK 60 >gi|299530005|ref|ZP_07043432.1| iojap-like protein [Comamonas testosteroni S44] gi|298721985|gb|EFI62915.1| iojap-like protein [Comamonas testosteroni S44] Length = 225 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 13/74 (17%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+++KA DI T S + + +++ SG S + Sbjct: 1 MTTSTKSDSAAKRDVTKLQRAIVDGLEDVKAHDIQVFN-TEALSPLFERVIVASGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +K+ Sbjct: 60 TKALASSVREAVKE 73 >gi|94501226|ref|ZP_01307748.1| uncharacterized plant Iojap protein [Oceanobacter sp. RED65] gi|94426653|gb|EAT11639.1| uncharacterized plant Iojap protein [Oceanobacter sp. RED65] Length = 114 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+++KA+DI I+ T R+ + D+M+I SG S +HV ++AD++ +K Sbjct: 2 DASALNNVVIDLLEDMKAQDINVIDVT-GRTSVTDSMIIASGTSNRHVQAVADHVADKIK 60 Query: 75 KK 76 Sbjct: 61 DH 62 >gi|260767231|ref|ZP_05876172.1| hypothetical protein VFA_000285 [Vibrio furnissii CIP 102972] gi|260617739|gb|EEX42917.1| hypothetical protein VFA_000285 [Vibrio furnissii CIP 102972] gi|315180856|gb|ADT87770.1| iojap-related protein [Vibrio furnissii NCTC 11218] Length = 105 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KA DI ++ +S + D M+I +G S +HV+SIAD++ S KK Sbjct: 4 EELKDFLADKADDMKAVDIVTLDV-QGKSSVTDYMIICTGTSKRHVSSIADHVASEAKK 61 >gi|114706559|ref|ZP_01439460.1| hypothetical protein FP2506_12444 [Fulvimarina pelagi HTCC2506] gi|114537951|gb|EAU41074.1| hypothetical protein FP2506_12444 [Fulvimarina pelagi HTCC2506] Length = 136 Score = 73.2 bits (179), Expect = 1e-11, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + L++ K E+I I+ +S + D+MVIVSGRS +HV +++D+L+ LK Sbjct: 22 DGQAVLEHALRSLEDSKGENIVSIDMR-GKSALADHMVIVSGRSHRHVTALSDHLLKDLK 80 Query: 75 K 75 Sbjct: 81 D 81 >gi|330722521|gb|EGH00341.1| Iojap-related protein [gamma proteobacterium IMCC2047] Length = 117 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + V E L+++KA D+ I+ S + D MVI SG S +HV ++A+ ++ LK Sbjct: 2 EGEKIVELVTEALEDIKAVDVQVIDV-KGLSNVTDYMVIASGTSRRHVKALAEGVLVELK 60 Query: 75 KK 76 K Sbjct: 61 SK 62 >gi|313206717|ref|YP_004045894.1| iojap-like protein [Riemerella anatipestifer DSM 15868] gi|312446033|gb|ADQ82388.1| iojap-like protein [Riemerella anatipestifer DSM 15868] gi|315023787|gb|EFT36789.1| Iojap family protein [Riemerella anatipestifer RA-YM] gi|325335843|gb|ADZ12117.1| Uncharacterized plant Iojap protein-like protein [Riemerella anatipestifer RA-GD] Length = 122 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 34/67 (50%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + I T++ +++ K EDI + T + + + D +I SG S V++IA N+ Sbjct: 1 MSNTNDKQELIDTIIRAIQDTKGEDIQVLNLTKIENAVADYFIICSGNSNTQVSAIAGNI 60 Query: 70 ISYLKKK 76 ++ + Sbjct: 61 EKTVRNE 67 >gi|295675989|ref|YP_003604513.1| iojap-like protein [Burkholderia sp. CCGE1002] gi|295435832|gb|ADG15002.1| iojap-like protein [Burkholderia sp. CCGE1002] Length = 149 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTSLFDRVIVASGTSNRQTKALASSVREGVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|254510636|ref|ZP_05122703.1| iojap family protein [Rhodobacteraceae bacterium KLH11] gi|221534347|gb|EEE37335.1| iojap family protein [Rhodobacteraceae bacterium KLH11] Length = 119 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ D + ++ L + KAED+ I +S + D+MVI SGRST+ V+++A+ Sbjct: 1 MARSQSISDKLLERILSSLSDDKAEDVVQINL-QGKSSVADHMVIASGRSTRQVSAMAEK 59 Query: 69 LISYLKKK 76 L +K++ Sbjct: 60 LTDRIKQE 67 >gi|330817839|ref|YP_004361544.1| Iojap-related protein [Burkholderia gladioli BSR3] gi|327370232|gb|AEA61588.1| Iojap-related protein [Burkholderia gladioli BSR3] Length = 148 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASSVREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|241766066|ref|ZP_04763981.1| iojap-like protein [Acidovorax delafieldii 2AN] gi|241363922|gb|EER59216.1| iojap-like protein [Acidovorax delafieldii 2AN] Length = 285 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 13/74 (17%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+++KA+DI T S + + +++ SG S + Sbjct: 1 MTTSTKSETAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVIVASGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +K+ Sbjct: 60 TKALAASVRDAVKE 73 >gi|147677172|ref|YP_001211387.1| hypothetical protein PTH_0837 [Pelotomaculum thermopropionicum SI] gi|146273269|dbj|BAF59018.1| Uncharacterized homolog of plant Iojap protein [Pelotomaculum thermopropionicum SI] Length = 116 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + ++ ++ KAE I ++ + S+I D VI SGRS HV ++ +N+ L +K Sbjct: 6 QAVVNIAVKAAEDKKAEGIVVLDIREI-SIIADYFVICSGRSGPHVQAVVENIQEKLAEK 64 >gi|94993656|ref|YP_601754.1| iojap protein family [Streptococcus pyogenes MGAS10750] gi|251781787|ref|YP_002996089.1| iojap protein family [Streptococcus dysgalactiae subsp. equisimilis GGS_124] gi|94547164|gb|ABF37210.1| iojap protein family [Streptococcus pyogenes MGAS10750] gi|242390416|dbj|BAH80875.1| iojap protein family [Streptococcus dysgalactiae subsp. equisimilis GGS_124] Length = 121 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + V++ E +AED+ ++ + + D VI S +++ + +IADN+ Sbjct: 1 MRNKMKKEELLEIVVKAADEKRAEDMLALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 59 Query: 70 ISYLKK 75 +K+ Sbjct: 60 REKVKE 65 >gi|163732521|ref|ZP_02139966.1| iojap-like protein [Roseobacter litoralis Och 149] gi|161393881|gb|EDQ18205.1| iojap-like protein [Roseobacter litoralis Och 149] Length = 122 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A + +AT++ L + KAEDI I+ ++ I D MVI SGRST+ V+SI++ Sbjct: 3 AATEIATSEKLLATILTSLNDDKAEDIVQIDLR-GKTEIGDYMVICSGRSTRQVSSISEK 61 Query: 69 LISYLKK 75 L+ +K Sbjct: 62 LVQKIKD 68 >gi|21909764|ref|NP_664032.1| iojap protein family [Streptococcus pyogenes MGAS315] gi|28896544|ref|NP_802894.1| iojap protein family [Streptococcus pyogenes SSI-1] gi|21903949|gb|AAM78835.1| conserved hypothetical protein [Streptococcus pyogenes MGAS315] gi|28811798|dbj|BAC64727.1| conserved hypothetical protein [Streptococcus pyogenes SSI-1] Length = 125 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ D + V+E +E +A+DI ++ + + D VI S +++ + +IADN+ Sbjct: 5 MRNKMKKDELLKIVVEATEEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNI 63 Query: 70 ISYLKK 75 +K+ Sbjct: 64 REKVKE 69 >gi|323490040|ref|ZP_08095261.1| hypothetical protein GPDM_11835 [Planococcus donghaensis MPA1U2] gi|323396336|gb|EGA89161.1| hypothetical protein GPDM_11835 [Planococcus donghaensis MPA1U2] Length = 112 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ + ++ KAEDI + SL+ D VI +G S + V SIA ++ ++ Sbjct: 4 ETLLQVAYNAAEDKKAEDIVVLNM-EGISLLADYFVICTGNSDRQVQSIAKEIMDKAHEE 62 >gi|229592804|ref|YP_002874923.1| hypothetical protein PFLU5425 [Pseudomonas fluorescens SBW25] gi|229364670|emb|CAY52603.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25] Length = 164 Score = 72.8 bits (178), Expect = 1e-11, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + L+++KA+DI ++ +S I D M+I +G S + + ++ D + +K + Sbjct: 33 EELVKVAVAALEDVKAQDIQVLDVRDKQS-ITDYMIIATGTSNRQIGAMLDKVREAVKAQ 91 >gi|325917118|ref|ZP_08179351.1| iojap-related protein [Xanthomonas vesicatoria ATCC 35937] gi|325536694|gb|EGD08457.1| iojap-related protein [Xanthomonas vesicatoria ATCC 35937] Length = 119 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 1/59 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 +ATV E ++ELKA+D+ I+ +S +CD MV+ SG ST+HV SIA+ ++ + K+ + Sbjct: 4 LLATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVASGTSTRHVKSIAEEVVKFAKRLD 61 >gi|170719798|ref|YP_001747486.1| iojap-like protein [Pseudomonas putida W619] gi|169757801|gb|ACA71117.1| iojap-like protein [Pseudomonas putida W619] Length = 140 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + + L+++KA+DI I+ + + D M+I +G S + + ++ + Sbjct: 1 MSKQKINGEELVKLTISALEDVKAQDIQVIDVRE-KHSLTDYMIIATGTSNRQINAMLEK 59 Query: 69 LISYLKKK 76 + +KK+ Sbjct: 60 VREAVKKE 67 >gi|167562115|ref|ZP_02355031.1| iojap domain protein [Burkholderia oklahomensis EO147] Length = 127 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDIKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|83720360|ref|YP_441565.1| iojap domain-containing protein [Burkholderia thailandensis E264] gi|257139747|ref|ZP_05588009.1| iojap domain-containing protein [Burkholderia thailandensis E264] gi|83654185|gb|ABC38248.1| iojap domain protein [Burkholderia thailandensis E264] Length = 154 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|254292538|ref|YP_003058561.1| iojap-like protein [Hirschia baltica ATCC 49814] gi|254041069|gb|ACT57864.1| iojap-like protein [Hirschia baltica ATCC 49814] Length = 120 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 23/68 (33%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ +S +++ L + KAE+I I+ +S I D M+I SGRST+HV ++AD+L Sbjct: 1 MASSAQTNSIPQMILDRLDDDKAENIVEIDLM-GKSSIADTMIIASGRSTRHVGALADHL 59 Query: 70 ISYLKKKN 77 K+ + Sbjct: 60 TRAFKEAD 67 >gi|326316866|ref|YP_004234538.1| iojap-like protein [Acidovorax avenae subsp. avenae ATCC 19860] gi|323373702|gb|ADX45971.1| iojap-like protein [Acidovorax avenae subsp. avenae ATCC 19860] Length = 272 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 11/74 (14%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + + + +++ L+++KA+DI T S + + +++ SG S + Sbjct: 1 MTTSTRSESAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEKLSPLFERVIVASGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +++ Sbjct: 60 TKALAASVRDAVRE 73 >gi|264679031|ref|YP_003278938.1| iojap-like protein [Comamonas testosteroni CNB-2] gi|262209544|gb|ACY33642.1| iojap-like protein [Comamonas testosteroni CNB-2] Length = 225 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 13/74 (17%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+++KA DI T S + + +++ SG S + Sbjct: 1 MTTSTKSDSAAKRDVTKLQRAIVDGLEDVKAHDIQVFN-TEALSPLFERVIVASGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +K+ Sbjct: 60 TKALASSVREAVKE 73 >gi|120611858|ref|YP_971536.1| iojap-like protein [Acidovorax citrulli AAC00-1] gi|120590322|gb|ABM33762.1| iojap-like protein [Acidovorax citrulli AAC00-1] Length = 263 Score = 72.8 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 11/74 (14%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + + + +++ L+++KA+DI T S + + +++ SG S + Sbjct: 1 MTTSTRSESAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEKLSPLFERVIVASGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +++ Sbjct: 60 TKALAASVRDAVRE 73 >gi|149926736|ref|ZP_01914996.1| iojap domain protein [Limnobacter sp. MED105] gi|149824665|gb|EDM83881.1| iojap domain protein [Limnobacter sp. MED105] Length = 140 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L V++ L+++KA+DI + T + + D ++I S S + ++A+N+ K Sbjct: 2 ELRKLQRVVIDALEDIKAQDIAIFDTTH-LTGVFDRVIIASASSNRQTRALANNVREKTK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|241663584|ref|YP_002981944.1| iojap-like protein [Ralstonia pickettii 12D] gi|240865611|gb|ACS63272.1| iojap-like protein [Ralstonia pickettii 12D] Length = 213 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAASVRDAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|302381257|ref|YP_003817080.1| iojap-like protein [Brevundimonas subvibrioides ATCC 15264] gi|302191885|gb|ADK99456.1| iojap-like protein [Brevundimonas subvibrioides ATCC 15264] Length = 205 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 21/53 (39%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + L E KA+DI I+ +S + D M++ SGRS +HV ++AD+L+ LK++ Sbjct: 101 LSKLDEDKAQDIVLIDL-KGKSPMADTMIVASGRSHRHVGALADHLLRTLKEQ 152 >gi|226325072|ref|ZP_03800590.1| hypothetical protein COPCOM_02864 [Coprococcus comes ATCC 27758] gi|225206420|gb|EEG88774.1| hypothetical protein COPCOM_02864 [Coprococcus comes ATCC 27758] Length = 119 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 +QT + E L + K EDI I+ S++ D +I +G + V ++ DN+ Sbjct: 1 MQTIEQSREMAKLACEALADKKGEDIRVIDIA-GISVLADYFIIANGTNESQVRALVDNV 59 Query: 70 ISYLKK 75 L K Sbjct: 60 EETLGK 65 >gi|119477459|ref|ZP_01617650.1| hypothetical protein GP2143_00757 [marine gamma proteobacterium HTCC2143] gi|119449385|gb|EAW30624.1| hypothetical protein GP2143_00757 [marine gamma proteobacterium HTCC2143] Length = 110 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L +LKA D+ ++ + + D MVI +G S +HV S+ADN+ LK Sbjct: 2 KAEKIKDLALNALDDLKARDVITLDVRE-MTDVTDFMVICTGTSNRHVKSLADNVALDLK 60 Query: 75 KK 76 K Sbjct: 61 HK 62 >gi|320157156|ref|YP_004189535.1| iojap protein [Vibrio vulnificus MO6-24/O] gi|319932468|gb|ADV87332.1| iojap protein [Vibrio vulnificus MO6-24/O] Length = 105 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE+I + +S + D MVI +G S +HVASIAD++ +KK Sbjct: 4 EELKDFLADKADDMKAENIVILNV-EDKSSVTDYMVICTGTSKRHVASIADHVADEVKK 61 >gi|301383645|ref|ZP_07232063.1| iojap domain-containing protein [Pseudomonas syringae pv. tomato Max13] gi|302063168|ref|ZP_07254709.1| iojap domain-containing protein [Pseudomonas syringae pv. tomato K40] gi|302131276|ref|ZP_07257266.1| iojap domain-containing protein [Pseudomonas syringae pv. tomato NCPPB 1108] gi|331014735|gb|EGH94791.1| iojap domain-containing protein [Pseudomonas syringae pv. lachrymans str. M302278PT] Length = 128 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + L+E+K DI I+ ++ I D M+I +G S + + ++ DN Sbjct: 1 MTKQKMSSEEVVQVAIAALEEVKGGDILTIDVRE-KTSIADYMLICTGTSNRQLNALVDN 59 Query: 69 LISYLK 74 + +K Sbjct: 60 VRDKVK 65 >gi|240849828|ref|YP_002971216.1| iojap-like protein [Bartonella grahamii as4aup] gi|240266951|gb|ACS50539.1| iojap-like protein [Bartonella grahamii as4aup] Length = 147 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + +++ L++ KAEDI I+ +S + D MVI S S +HV+S+AD+L+ K Sbjct: 29 SVRESLEVILKSLEDTKAEDIVAIDIR-GKSSLADYMVIASANSQRHVSSVADHLLHTWK 87 >gi|330993040|ref|ZP_08316978.1| hypothetical protein SXCC_02940 [Gluconacetobacter sp. SXCC-1] gi|329759810|gb|EGG76316.1| hypothetical protein SXCC_02940 [Gluconacetobacter sp. SXCC-1] Length = 154 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 37/71 (52%), Gaps = 1/71 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T + + +D + + L++ KAEDI I+ T R+ D MVI +G + + +A+ Sbjct: 26 TATRTREPDPRVDQFLEIITTSLEDDKAEDIVVIDLT-GRASFADRMVIATGLADRQIAA 84 Query: 65 IADNLISYLKK 75 +A ++ L + Sbjct: 85 MAAHIDRKLGE 95 >gi|254495432|ref|ZP_05108356.1| protein of unknown function DUF143 [Polaribacter sp. MED152] gi|85819787|gb|EAQ40944.1| protein of unknown function DUF143 [Polaribacter sp. MED152] Length = 122 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 17/68 (25%), Positives = 35/68 (51%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D IA +++ + ++K EDI ++ + + +CD VI SG S V +I+ + Sbjct: 1 MTKKQVSTDDLIAVIIKGIDDVKGEDIQLLDLRDIENTVCDYFVICSGNSNTQVNAISSS 60 Query: 69 LISYLKKK 76 + + K+ Sbjct: 61 VQKVVSKE 68 >gi|27363754|ref|NP_759282.1| hypothetical protein VV1_0276 [Vibrio vulnificus CMCP6] gi|27359870|gb|AAO08809.1| conserved hypothetical protein [Vibrio vulnificus CMCP6] Length = 105 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE+I + +S + D MVI +G S +HVASIAD++ +KK Sbjct: 4 EELKDFLADKADDMKAENIVILNV-EDKSSVTDYMVICTGTSKRHVASIADHVADEVKK 61 >gi|188534478|ref|YP_001908275.1| hypothetical protein ETA_23510 [Erwinia tasmaniensis Et1/99] gi|188029520|emb|CAO97397.1| Conserved hHypothetical protein YbeB [Erwinia tasmaniensis Et1/99] Length = 105 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ + +LK +DI I+ +S I D MVI +G ST+HV SIA++++ + Sbjct: 4 QALQDFVVDKIDDLKGQDIVTIDV-HGKSSITDCMVICTGTSTRHVVSIAEHVVQEAR 60 >gi|148981393|ref|ZP_01816389.1| hypothetical protein VSWAT3_09513 [Vibrionales bacterium SWAT-3] gi|145960885|gb|EDK26215.1| hypothetical protein VSWAT3_09513 [Vibrionales bacterium SWAT-3] Length = 105 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE I I+ +S + D M++ +G S +HVASIA ++ +KK Sbjct: 4 EELKDFLADKADDMKAESIVTIDV-EGKSSVTDYMIVCTGTSKRHVASIAQHVADEVKK 61 >gi|319762842|ref|YP_004126779.1| iojap-like protein [Alicycliphilus denitrificans BC] gi|317117403|gb|ADU99891.1| iojap-like protein [Alicycliphilus denitrificans BC] Length = 221 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 12/74 (16%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + T K + +++ L+++KA+DI T S + + +++ +G S + Sbjct: 1 MTTTSKSESAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVIVATGGSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +++ Sbjct: 60 TKALASSVRDAVRE 73 >gi|167569365|ref|ZP_02362239.1| iojap-like protein [Burkholderia oklahomensis C6786] Length = 155 Score = 72.4 bits (177), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDIKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|197103716|ref|YP_002129093.1| uncharacterized Iojap-like protein [Phenylobacterium zucineum HLK1] gi|196477136|gb|ACG76664.1| uncharacterized Iojap-like protein [Phenylobacterium zucineum HLK1] Length = 153 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ L E KA+D+ I+ +S + D +V+ SGRS +HV ++AD+L+ LK+ Sbjct: 44 LEDLILARLDEDKAQDVVLIDL-KGKSPVADALVVASGRSQRHVGAMADHLLRALKE 99 >gi|259909126|ref|YP_002649482.1| hypothetical protein EpC_24860 [Erwinia pyrifoliae Ep1/96] gi|224964748|emb|CAX56265.1| conserved uncharacterized protein YbeB [Erwinia pyrifoliae Ep1/96] gi|283479154|emb|CAY75070.1| Uncharacterized protein C7orf30 homolog [Erwinia pyrifoliae DSM 12163] gi|310766974|gb|ADP11924.1| hypothetical protein EJP617_22430 [Erwinia sp. Ejp617] Length = 105 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ + +LK ++I ++ +S I D MVI +G ST+HV SIA++++ + Sbjct: 4 QALQDFVVDKIDDLKGQNIVTLDVR-GKSSITDCMVICTGTSTRHVVSIAEHVVQEAR 60 >gi|190893928|ref|YP_001980470.1| hypothetical protein RHECIAT_CH0004365 [Rhizobium etli CIAT 652] gi|190699207|gb|ACE93292.1| hypothetical conserved protein [Rhizobium etli CIAT 652] Length = 147 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V+ L++ KAEDI I+ +S + D MV+VSGRS +HV +I+D+L++ LK + Sbjct: 42 VLASLEDSKAEDIVTIDIA-GKSALGDYMVVVSGRSNRHVMAISDHLLTDLKDE 94 >gi|113866937|ref|YP_725426.1| hypothetical protein H16_A0912 [Ralstonia eutropha H16] gi|113525713|emb|CAJ92058.1| uncharacterized conserved protein [Ralstonia eutropha H16] Length = 245 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI + TS + + D +VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRAIVDGLEDVKAQDIKVYD-TSHLTELFDRVVIASGTSNRQTKALAASVRDTVK 60 >gi|317052396|ref|YP_004113512.1| iojap-like protein [Desulfurispirillum indicum S5] gi|316947480|gb|ADU66956.1| iojap-like protein [Desulfurispirillum indicum S5] Length = 125 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + E A D+ +E S D I + +S + +IAD++ +K Sbjct: 2 KSSELLERIHQLADEKHAADVKALELA-GVSSFADYFYICTAQSARQAQAIADHIRETVK 60 Query: 75 KK 76 K+ Sbjct: 61 KE 62 >gi|194288984|ref|YP_002004891.1| hypothetical protein RALTA_A0855 [Cupriavidus taiwanensis LMG 19424] gi|193222819|emb|CAQ68822.1| conserved hypothetical protein [Cupriavidus taiwanensis LMG 19424] Length = 248 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI + TS + + D +VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRAIVDGLEDVKAQDIKVYD-TSHLTELFDRVVIASGTSNRQTKALAASVRDTVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|53718797|ref|YP_107783.1| hypothetical protein BPSL1161 [Burkholderia pseudomallei K96243] gi|53725447|ref|YP_103484.1| iojap domain-containing protein [Burkholderia mallei ATCC 23344] gi|67640605|ref|ZP_00439405.1| iojap domain protein [Burkholderia mallei GB8 horse 4] gi|76808538|ref|YP_332791.1| iojap superfamily protein [Burkholderia pseudomallei 1710b] gi|121600223|ref|YP_992411.1| iojap domain-containing protein [Burkholderia mallei SAVP1] gi|124384233|ref|YP_001026786.1| iojap domain-containing protein [Burkholderia mallei NCTC 10229] gi|126449427|ref|YP_001079929.1| iojap domain-containing protein [Burkholderia mallei NCTC 10247] gi|126452827|ref|YP_001065515.1| iojap domain-containing protein [Burkholderia pseudomallei 1106a] gi|167000921|ref|ZP_02266722.1| iojap family protein [Burkholderia mallei PRL-20] gi|167844938|ref|ZP_02470446.1| iojap domain protein [Burkholderia pseudomallei B7210] gi|242318059|ref|ZP_04817075.1| iojap family protein [Burkholderia pseudomallei 1106b] gi|254175453|ref|ZP_04882113.1| iojap domain protein [Burkholderia mallei ATCC 10399] gi|254190604|ref|ZP_04897111.1| putative iojap [Burkholderia pseudomallei Pasteur 52237] gi|254202166|ref|ZP_04908529.1| iojap protein [Burkholderia mallei FMH] gi|254207493|ref|ZP_04913843.1| putative iojap protein [Burkholderia mallei JHU] gi|254261492|ref|ZP_04952546.1| iojap family protein [Burkholderia pseudomallei 1710a] gi|254359911|ref|ZP_04976181.1| putative iojap protein [Burkholderia mallei 2002721280] gi|52209211|emb|CAH35156.1| conserved hypothetical protein [Burkholderia pseudomallei K96243] gi|52428870|gb|AAU49463.1| iojap domain protein [Burkholderia mallei ATCC 23344] gi|76577991|gb|ABA47466.1| iojap protein family [Burkholderia pseudomallei 1710b] gi|121229033|gb|ABM51551.1| iojap domain protein [Burkholderia mallei SAVP1] gi|124292253|gb|ABN01522.1| iojap-like ribosome-associated protein [Burkholderia mallei NCTC 10229] gi|126226469|gb|ABN90009.1| iojap homolog [Burkholderia pseudomallei 1106a] gi|126242297|gb|ABO05390.1| iojap domain protein [Burkholderia mallei NCTC 10247] gi|147746413|gb|EDK53490.1| iojap protein [Burkholderia mallei FMH] gi|147751387|gb|EDK58454.1| putative iojap protein [Burkholderia mallei JHU] gi|148029151|gb|EDK87056.1| putative iojap protein [Burkholderia mallei 2002721280] gi|157938279|gb|EDO93949.1| putative iojap [Burkholderia pseudomallei Pasteur 52237] gi|160696497|gb|EDP86467.1| iojap domain protein [Burkholderia mallei ATCC 10399] gi|238521358|gb|EEP84810.1| iojap domain protein [Burkholderia mallei GB8 horse 4] gi|242141298|gb|EES27700.1| iojap family protein [Burkholderia pseudomallei 1106b] gi|243063224|gb|EES45410.1| iojap family protein [Burkholderia mallei PRL-20] gi|254220181|gb|EET09565.1| iojap family protein [Burkholderia pseudomallei 1710a] Length = 154 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|49474974|ref|YP_033015.1| hypothetical protein BH01600 [Bartonella henselae str. Houston-1] gi|49237779|emb|CAF26972.1| hypothetical protein BH01600 [Bartonella henselae str. Houston-1] Length = 142 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +++ L++ KAEDI I+ +S + D MVI S S +HV+S+AD+L+ K Sbjct: 29 LNVILKSLEDTKAEDIVSIDI-QGKSSLADYMVIASAHSQRHVSSVADHLLRTWKD 83 >gi|167814973|ref|ZP_02446653.1| iojap-like protein [Burkholderia pseudomallei 91] Length = 130 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|167737788|ref|ZP_02410562.1| iojap-like protein [Burkholderia pseudomallei 14] gi|167901933|ref|ZP_02489138.1| iojap-like protein [Burkholderia pseudomallei NCTC 13177] Length = 126 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|16127662|ref|NP_422226.1| iojap-like protein [Caulobacter crescentus CB15] gi|13425148|gb|AAK25394.1| iojap-related protein [Caulobacter crescentus CB15] Length = 113 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 41/61 (67%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +++ L + KA+DI HI+ T +S + D++++ SGRS +HV ++AD+++ LK+ Sbjct: 1 MKALERLILDRLDDDKAQDIVHIDLTD-KSSVADSLIVASGRSHRHVGALADHILRALKE 59 Query: 76 K 76 Sbjct: 60 N 60 >gi|37679092|ref|NP_933701.1| hypothetical protein VV0908 [Vibrio vulnificus YJ016] gi|37197834|dbj|BAC93672.1| conserved hypothetical protein [Vibrio vulnificus YJ016] Length = 105 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE+I + +S + D MVI +G S +HVASIAD++ +KK Sbjct: 4 EELKDFLADKADDMKAENIVILNV-EDKSSVTDYMVICTGTSKRHVASIADHVADEVKK 61 >gi|325661644|ref|ZP_08150268.1| hypothetical protein HMPREF0490_01002 [Lachnospiraceae bacterium 4_1_37FAA] gi|331084761|ref|ZP_08333849.1| iojap protein 155 [Lachnospiraceae bacterium 9_1_43BFAA] gi|325472171|gb|EGC75385.1| hypothetical protein HMPREF0490_01002 [Lachnospiraceae bacterium 4_1_37FAA] gi|330410855|gb|EGG90277.1| iojap protein 155 [Lachnospiraceae bacterium 9_1_43BFAA] Length = 116 Score = 72.0 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 DH + E L + K EDI I+ + S++ D +I +G S V ++ DN+ Y Sbjct: 1 MDHSKEMVRLAYEALSDKKGEDIRIIDISQ-VSVLADYFIIANGSSENQVKALVDNVEEY 59 Query: 73 LKK 75 L K Sbjct: 60 LHK 62 >gi|167893479|ref|ZP_02480881.1| iojap domain protein [Burkholderia pseudomallei 7894] Length = 140 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|332532446|ref|ZP_08408324.1| iojap-like protein [Pseudoalteromonas haloplanktis ANT/505] gi|332038089|gb|EGI74536.1| iojap-like protein [Pseudoalteromonas haloplanktis ANT/505] Length = 105 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A M+ + ++KA DI HI+ T S I D MVI SG S +HV SIAD+L + Sbjct: 2 DSKQLLAFAMDKIDDMKARDIVHIDVTET-SDITDYMVICSGTSKRHVQSIADHLAKEAR 60 Query: 75 KKN 77 + Sbjct: 61 HAD 63 >gi|308186022|ref|YP_003930153.1| hypothetical protein Pvag_0492 [Pantoea vagans C9-1] gi|308056532|gb|ADO08704.1| Uncharacterized protein ybeB [Pantoea vagans C9-1] Length = 105 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI I+ +S I D M+I +G ST+HV SIA+++ Sbjct: 4 KALQEFVIDKIDDLKGQDIVTIDV-QGKSSITDFMIICTGTSTRHVTSIAEHVEQE 58 >gi|304395660|ref|ZP_07377543.1| iojap-like protein [Pantoea sp. aB] gi|304356954|gb|EFM21318.1| iojap-like protein [Pantoea sp. aB] Length = 105 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI I+ +S I D M+I +G ST+HV SIA+++ Sbjct: 4 KALQEFVIDKIDDLKGQDIVTIDV-QGKSSITDYMIICTGTSTRHVTSIAEHVEQE 58 >gi|218509363|ref|ZP_03507241.1| hypothetical protein RetlB5_18554 [Rhizobium etli Brasil 5] Length = 147 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V+ L++ KAEDI I+ +S + D MV+VSGRS +HV +I+D+L++ LK + Sbjct: 42 VLASLEDSKAEDIVTIDIA-GKSALGDYMVVVSGRSNRHVMAISDHLLTDLKDE 94 >gi|83592572|ref|YP_426324.1| Iojap-like protein [Rhodospirillum rubrum ATCC 11170] gi|83575486|gb|ABC22037.1| Iojap-related protein [Rhodospirillum rubrum ATCC 11170] Length = 138 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V L E KAE+I I+ +S D MV+ SGRS +HVA++A+ L L+ Sbjct: 1 MAEIVETALDEDKAEEIVVIDLA-GKSSFADCMVVASGRSARHVAALAERLTERLR 55 >gi|319787823|ref|YP_004147298.1| iojap-like protein [Pseudoxanthomonas suwonensis 11-1] gi|317466335|gb|ADV28067.1| iojap-like protein [Pseudoxanthomonas suwonensis 11-1] Length = 138 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +D +A V ++E+KA+D+ I+ ++ + D++VI SG ST+HV SIAD ++ + Sbjct: 17 PSVDQLLAAVRAAVEEIKAKDVVEIDVR-GKTSVADHLVIASGTSTRHVKSIADEVVKFA 75 Query: 74 K 74 K Sbjct: 76 K 76 >gi|19745432|ref|NP_606568.1| iojap protein family [Streptococcus pyogenes MGAS8232] gi|139474396|ref|YP_001129112.1| iojap protein family [Streptococcus pyogenes str. Manfredo] gi|19747544|gb|AAL97067.1| conserved hypothetical protein [Streptococcus pyogenes MGAS8232] gi|134272643|emb|CAM30910.1| conserved hypothetical protein [Streptococcus pyogenes str. Manfredo] Length = 117 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V+E E +A+DI ++ + + D VI S +++ + +IADN+ +K+ Sbjct: 4 EELLKIVVEATDEKRAKDILALDL-EGLTSLTDYFVIASATNSRQLEAIADNIREKVKE 61 >gi|330824921|ref|YP_004388224.1| iojap-like protein [Alicycliphilus denitrificans K601] gi|329310293|gb|AEB84708.1| iojap-like protein [Alicycliphilus denitrificans K601] Length = 226 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 12/74 (16%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + T K + +++ L+++KA+DI T S + + +++ +G S + Sbjct: 1 MTTTSKSESAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEYLSPLFERVIVATGGSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +++ Sbjct: 60 TKALASSVRDAVRE 73 >gi|313890832|ref|ZP_07824456.1| iojap-like protein [Streptococcus pseudoporcinus SPIN 20026] gi|313120730|gb|EFR43845.1| iojap-like protein [Streptococcus pseudoporcinus SPIN 20026] Length = 117 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI S +++ + +IA+N+ +K+ Sbjct: 4 EELLNVVVKAADEKRAEDILVLDL-EGLTSLTDYFVITSATNSRQLEAIAENIREKVKE 61 >gi|167718777|ref|ZP_02402013.1| iojap-like protein [Burkholderia pseudomallei DM98] Length = 134 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|294340963|emb|CAZ89358.1| conserved hypothetical protein; putative Iojap domain [Thiomonas sp. 3As] Length = 257 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + T+++ L+++KA+DI T + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRTIVDALEDVKAQDIEVFN-TEELTSLFDRVIVASGTSNRQTRALASSVRDSVK 60 >gi|222150153|ref|YP_002551110.1| hypothetical protein Avi_4278 [Agrobacterium vitis S4] gi|221737135|gb|ACM38098.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 137 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + V+ L++ KAEDI I+ +S + D MV+VSGRS++HV +I ++L+S L Sbjct: 23 DAAARALELVLTSLEDSKAEDIVSIDIA-GKSALGDYMVVVSGRSSRHVVAICEHLVSDL 81 Query: 74 KKK 76 K + Sbjct: 82 KDE 84 >gi|330445211|ref|ZP_08308863.1| conserved hypothetical protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328489402|dbj|GAA03360.1| conserved hypothetical protein [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 105 Score = 72.0 bits (176), Expect = 3e-11, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + +LKA+DI I+ +S I D MVI +G S +HV SIAD++ K Sbjct: 2 QVQELHDFIVDKIDDLKAQDIVTIDV-QGKSSITDVMVICTGTSNRHVCSIADHVNKESK 60 >gi|326386221|ref|ZP_08207845.1| Iojap-related protein [Novosphingobium nitrogenifigens DSM 19370] gi|326209446|gb|EGD60239.1| Iojap-related protein [Novosphingobium nitrogenifigens DSM 19370] Length = 131 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S V++ L + +A+D+ I +S I D MVI SGRST+ VA++A L +K+ Sbjct: 24 SLHELVLQSLDDDQAQDVVSIPL-EGKSTIADYMVIASGRSTRQVAAMAQKLAERIKQ 80 >gi|167823387|ref|ZP_02454858.1| iojap domain protein [Burkholderia pseudomallei 9] Length = 118 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|187923294|ref|YP_001894936.1| iojap-like protein [Burkholderia phytofirmans PsJN] gi|187714488|gb|ACD15712.1| iojap-like protein [Burkholderia phytofirmans PsJN] Length = 154 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTALFDRVIVASGTSNRQTKALASSVRESVK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|300113167|ref|YP_003759742.1| iojap-like protein [Nitrosococcus watsonii C-113] gi|299539104|gb|ADJ27421.1| iojap-like protein [Nitrosococcus watsonii C-113] Length = 115 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L+ LK DI ++ + + D MVI SG S + V ++A+ +I K Sbjct: 5 ELKECVVSALEALKGHDIQVLDVRE-LTTVADYMVIASGASNRQVKALANEVIERCK 60 >gi|291616679|ref|YP_003519421.1| YbeB [Pantoea ananatis LMG 20103] gi|291151709|gb|ADD76293.1| YbeB [Pantoea ananatis LMG 20103] gi|327393105|dbj|BAK10527.1| Iojap-related protein YbeB [Pantoea ananatis AJ13355] Length = 110 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK ++I ++ +S I D M+I +G ST+HV SIA+++ Sbjct: 9 KALQEFVVDKIDDLKGQNIVTLDV-QGKSSITDFMIICTGTSTRHVTSIAEHVEQE 63 >gi|295706665|ref|YP_003599740.1| hypothetical protein BMD_4566 [Bacillus megaterium DSM 319] gi|294804324|gb|ADF41390.1| protein of unknown function (DUF143) [Bacillus megaterium DSM 319] Length = 117 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ V+E + KA DI + SL+ D VI G S K V +IA + ++ Sbjct: 4 RELLSLVVEAADDKKAIDIVALNM-EGISLVADYFVICHGNSDKQVQAIAREIKEKAHEQ 62 >gi|221066391|ref|ZP_03542496.1| iojap-like protein [Comamonas testosteroni KF-1] gi|220711414|gb|EED66782.1| iojap-like protein [Comamonas testosteroni KF-1] Length = 225 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 13/74 (17%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+++KA DI T S + + +++ SG S + Sbjct: 1 MTTSTKSDSAAKRDVTKLQRAIVDGLEDVKAHDIQVFN-TEALSPLFERVIVASGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +K+ Sbjct: 60 TKALASSVREAVKE 73 >gi|330873589|gb|EGH07738.1| iojap domain-containing protein [Pseudomonas syringae pv. morsprunorum str. M302280PT] gi|330963461|gb|EGH63721.1| iojap domain-containing protein [Pseudomonas syringae pv. actinidiae str. M302091] Length = 128 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + L+E+K DI I+ ++ I D M+I +G S + + ++ DN Sbjct: 1 MTKQKMSSEEVVQVAIAALEEVKGADILTIDVRE-KTSIADYMLICTGTSNRQLNALVDN 59 Query: 69 LISYLK 74 + +K Sbjct: 60 VRDKVK 65 >gi|110677999|ref|YP_681006.1| iojap-like protein [Roseobacter denitrificans OCh 114] gi|109454115|gb|ABG30320.1| iojap-like protein [Roseobacter denitrificans OCh 114] Length = 122 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +AT++ L + KAEDI I+ ++ I D MVI SGRST+ VASI++ L+ +K Sbjct: 9 TSEKLLATILTSLNDDKAEDIVQIDLR-GKTEIGDYMVICSGRSTRQVASISEKLVQTIK 67 Query: 75 K 75 Sbjct: 68 D 68 >gi|238762879|ref|ZP_04623847.1| hypothetical protein ykris0001_31900 [Yersinia kristensenii ATCC 33638] gi|238698890|gb|EEP91639.1| hypothetical protein ykris0001_31900 [Yersinia kristensenii ATCC 33638] Length = 105 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 4 KALQEFVIDKLDDLKGQDIITLDV-QGKSSITDFMIICTGTSTRHVMALADNLVQE 58 >gi|269102007|ref|ZP_06154704.1| hypothetical protein VDA_001427 [Photobacterium damselae subsp. damselae CIP 102761] gi|268161905|gb|EEZ40401.1| hypothetical protein VDA_001427 [Photobacterium damselae subsp. damselae CIP 102761] Length = 105 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + ++KA+DI ++ +S I D MVI +G S +HVASIAD++ K Sbjct: 2 QVQELHDFIVDKVDDIKAQDIVTVDVR-GKSSITDMMVICTGTSNRHVASIADHVKKESK 60 >gi|254281693|ref|ZP_04956661.1| iojap family protein [gamma proteobacterium NOR51-B] gi|219677896|gb|EED34245.1| iojap family protein [gamma proteobacterium NOR51-B] Length = 118 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 24/65 (36%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + H D A + L +LKA + I+ S S + D +VI SG S++HV S+ADN+I Sbjct: 5 SIPHGDELSALALSALNDLKAVEPVVIDVRS-VSSVMDFLVIASGTSSRHVKSLADNVIV 63 Query: 72 YLKKK 76 K++ Sbjct: 64 TAKEQ 68 >gi|330959970|gb|EGH60230.1| iojap domain-containing protein [Pseudomonas syringae pv. maculicola str. ES4326] Length = 128 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + L+E+K DI I+ ++ I D M+I +G S + + ++ D+ Sbjct: 1 MTKQKMSSEEVVKVAVAALEEIKGADILTIDVRD-KTSIADYMLICTGTSNRQLNALVDS 59 Query: 69 LISYLK 74 + +K Sbjct: 60 VRDKVK 65 >gi|207723778|ref|YP_002254176.1| hypothethical protein [Ralstonia solanacearum MolK2] gi|206588982|emb|CAQ35944.1| hypothetical protein RSMK01243 [Ralstonia solanacearum MolK2] Length = 210 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAVSVRDAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|299771555|ref|YP_003733581.1| iojap-like protein [Acinetobacter sp. DR1] gi|298701643|gb|ADI92208.1| iojap-like protein [Acinetobacter sp. DR1] Length = 133 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Query: 2 LANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 ++N+ A+ T++ + +C+ V + L ++KA+DI ++ +S+ S + D +VI SG ST+ Sbjct: 9 VSNSHDFAMNTSNKDVQTCLKVVHDALVDVKAKDILQLDVSSI-SNVADAIVIASGTSTR 67 Query: 61 HVASIADNLISYLKK 75 HV ++ADN+ +K Sbjct: 68 HVKALADNVAEEARK 82 >gi|148549886|ref|YP_001269988.1| iojap-like protein [Pseudomonas putida F1] gi|148513944|gb|ABQ80804.1| iojap-like protein [Pseudomonas putida F1] Length = 158 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +A L+++KA+DI I+ + + D M+I +G S + + ++A+ + +K K Sbjct: 28 EELVAVTKAALEDVKAQDIQVIDVRE-KHSLTDYMIIATGTSNRQINAMAEKVREAVKAK 86 >gi|91782565|ref|YP_557771.1| Iojap-related protein [Burkholderia xenovorans LB400] gi|91686519|gb|ABE29719.1| Iojap-related protein [Burkholderia xenovorans LB400] Length = 151 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTALFDRVIVASGTSNRQTKALASSVRESVK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|217420060|ref|ZP_03451566.1| iojap-like protein [Burkholderia pseudomallei 576] gi|254298479|ref|ZP_04965931.1| iojap protein [Burkholderia pseudomallei 406e] gi|157808079|gb|EDO85249.1| iojap protein [Burkholderia pseudomallei 406e] gi|217397364|gb|EEC37380.1| iojap-like protein [Burkholderia pseudomallei 576] Length = 154 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|50120244|ref|YP_049411.1| hypothetical protein ECA1305 [Pectobacterium atrosepticum SCRI1043] gi|49610770|emb|CAG74215.1| conserved hypothetical protein [Pectobacterium atrosepticum SCRI1043] Length = 105 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LKA+DI + +S I D MVI +G ST+HVASIAD+++ Sbjct: 4 QALQDFVIDKVDDLKAQDIVVLNV-QGKSSITDYMVICTGTSTRHVASIADHVVQ 57 >gi|28897498|ref|NP_797103.1| hypothetical protein VP0724 [Vibrio parahaemolyticus RIMD 2210633] gi|153840496|ref|ZP_01993163.1| iojap-related protein [Vibrio parahaemolyticus AQ3810] gi|260364647|ref|ZP_05777246.1| iojap-like protein [Vibrio parahaemolyticus K5030] gi|260878360|ref|ZP_05890715.1| iojap-like protein [Vibrio parahaemolyticus AN-5034] gi|260896603|ref|ZP_05905099.1| iojap-like protein [Vibrio parahaemolyticus Peru-466] gi|28805710|dbj|BAC58987.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD 2210633] gi|149745841|gb|EDM56971.1| iojap-related protein [Vibrio parahaemolyticus AQ3810] gi|308089334|gb|EFO39029.1| iojap-like protein [Vibrio parahaemolyticus Peru-466] gi|308090263|gb|EFO39958.1| iojap-like protein [Vibrio parahaemolyticus AN-5034] gi|308111016|gb|EFO48556.1| iojap-like protein [Vibrio parahaemolyticus K5030] Length = 105 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAEDI + +S + D M+I +G S +HV+SIAD++ S +KK Sbjct: 4 EELKDFLADKADDMKAEDIVILNV-EDKSSVTDYMIICTGTSKRHVSSIADHVASEVKK 61 >gi|332827690|gb|EGK00429.1| iojap protein 155 [Dysgonomonas gadei ATCC BAA-286] Length = 119 Score = 71.7 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 31/64 (48%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 S +++ ++ KA +I ++ T L IC VI G + V +I+D ++ Sbjct: 1 MKEGKSLANSIVAACQDKKARNIVIVDMTELPGTICQYFVICEGNTPTQVGAISDEIVDS 60 Query: 73 LKKK 76 LKKK Sbjct: 61 LKKK 64 >gi|84501448|ref|ZP_00999653.1| hypothetical protein OB2597_13823 [Oceanicola batsensis HTCC2597] gi|84390739|gb|EAQ03227.1| hypothetical protein OB2597_13823 [Oceanicola batsensis HTCC2597] Length = 152 Score = 71.7 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 25/67 (37%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 Q +S + ++ L KAEDI I+ RS + D MVI SGRST+ VA+I++ Sbjct: 34 MAQDQSISESLLDLILTSLDTDKAEDIVQIDLR-GRSSMGDFMVICSGRSTRQVAAISEK 92 Query: 69 LISYLKK 75 L+ +K+ Sbjct: 93 LVERIKE 99 >gi|323525388|ref|YP_004227541.1| iojap-like protein [Burkholderia sp. CCGE1001] gi|323382390|gb|ADX54481.1| iojap-like protein [Burkholderia sp. CCGE1001] Length = 151 Score = 71.7 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIRVFN-TSHLTALFDRVIVASGTSNRQTKALASSVREGVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|260773270|ref|ZP_05882186.1| hypothetical protein VIB_001737 [Vibrio metschnikovii CIP 69.14] gi|260612409|gb|EEX37612.1| hypothetical protein VIB_001737 [Vibrio metschnikovii CIP 69.14] Length = 105 Score = 71.7 bits (175), Expect = 4e-11, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++KA +I ++ +S + D MVI +G S +HVASIAD++ + +KK Sbjct: 4 QQLTHFLADKADDMKAVNIVTLDV-QGKSSVTDYMVICTGTSKRHVASIADHIANEVKK 61 >gi|134296482|ref|YP_001120217.1| iojap-like protein [Burkholderia vietnamiensis G4] gi|134139639|gb|ABO55382.1| iojap-like protein [Burkholderia vietnamiensis G4] Length = 148 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDIKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASSVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|312963242|ref|ZP_07777726.1| hypothetical protein PFWH6_5163 [Pseudomonas fluorescens WH6] gi|311282508|gb|EFQ61105.1| hypothetical protein PFWH6_5163 [Pseudomonas fluorescens WH6] Length = 164 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + L+++KA+DI ++ +S I D M+I +G S + + ++ D + +K + Sbjct: 33 EELVKVAVAALEDVKAQDIQVLDVRDKQS-ITDFMIIATGTSNRQIGAMLDKVREAVKAQ 91 >gi|184156895|ref|YP_001845234.1| hypothetical protein ACICU_00575 [Acinetobacter baumannii ACICU] gi|213156032|ref|YP_002318077.1| hypothetical protein AB57_0674 [Acinetobacter baumannii AB0057] gi|215484640|ref|YP_002326875.1| hypothetical protein ABBFA_002989 [Acinetobacter baumannii AB307-0294] gi|239500721|ref|ZP_04660031.1| hypothetical protein AbauAB_00270 [Acinetobacter baumannii AB900] gi|260551963|ref|ZP_05825825.1| iojap family protein [Acinetobacter sp. RUH2624] gi|260556081|ref|ZP_05828300.1| iojap family protein [Acinetobacter baumannii ATCC 19606] gi|301345780|ref|ZP_07226521.1| iojap homolog [Acinetobacter baumannii AB056] gi|301511162|ref|ZP_07236399.1| iojap homolog [Acinetobacter baumannii AB058] gi|301594983|ref|ZP_07239991.1| iojap homolog [Acinetobacter baumannii AB059] gi|332856916|ref|ZP_08436325.1| iojap-like protein [Acinetobacter baumannii 6013150] gi|332867180|ref|ZP_08437445.1| iojap-like protein [Acinetobacter baumannii 6013113] gi|332874028|ref|ZP_08441963.1| iojap-like protein [Acinetobacter baumannii 6014059] gi|183208489|gb|ACC55887.1| uncharacterized plant Iojap protein [Acinetobacter baumannii ACICU] gi|213055192|gb|ACJ40094.1| hypothetical protein AB57_0674 [Acinetobacter baumannii AB0057] gi|213986448|gb|ACJ56747.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294] gi|260405366|gb|EEW98861.1| iojap family protein [Acinetobacter sp. RUH2624] gi|260410136|gb|EEX03435.1| iojap family protein [Acinetobacter baumannii ATCC 19606] gi|332726970|gb|EGJ58475.1| iojap-like protein [Acinetobacter baumannii 6013150] gi|332734119|gb|EGJ65251.1| iojap-like protein [Acinetobacter baumannii 6013113] gi|332737769|gb|EGJ68661.1| iojap-like protein [Acinetobacter baumannii 6014059] Length = 133 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Query: 2 LANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 ++N+ A+ T++ + +C+ V + L ++KA+DI ++ +S+ S + D +VI SG ST+ Sbjct: 9 VSNSHDFAMNTSNKDVQACLKVVHDALVDVKAKDILQLDVSSI-SNVADAIVIASGTSTR 67 Query: 61 HVASIADNLISYLKK 75 HV ++ADN+ +K Sbjct: 68 HVKALADNVAEEARK 82 >gi|292490674|ref|YP_003526113.1| iojap-like protein [Nitrosococcus halophilus Nc4] gi|291579269|gb|ADE13726.1| iojap-like protein [Nitrosococcus halophilus Nc4] Length = 116 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L+ LK DI ++ + + D MV+ SG S + V ++A+ ++ K Sbjct: 5 ELKELVVTALEALKGRDIQVLDVRE-LTDVVDYMVVASGASNRQVKALANEVVERCK 60 >gi|237811523|ref|YP_002895974.1| iojap domain protein [Burkholderia pseudomallei MSHR346] gi|237505922|gb|ACQ98240.1| iojap domain protein [Burkholderia pseudomallei MSHR346] Length = 154 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|323339577|ref|ZP_08079851.1| Iojap family protein [Lactobacillus ruminis ATCC 25644] gi|323092972|gb|EFZ35570.1| Iojap family protein [Lactobacillus ruminis ATCC 25644] Length = 130 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + +K + + V+E +AEDI ++ SL+ D VI+ S + Sbjct: 1 MRSLQKIKARYFMDSKELLKVVVEAADSKRAEDIVALDV-QGISLLADYFVIMQANSERQ 59 Query: 62 VASIADNLISYLKK 75 V +IAD + +++ Sbjct: 60 VKAIADIIEEKVEE 73 >gi|126439798|ref|YP_001058276.1| iojap domain-containing protein [Burkholderia pseudomallei 668] gi|134281075|ref|ZP_01767784.1| iojap-like protein [Burkholderia pseudomallei 305] gi|167910165|ref|ZP_02497256.1| iojap-like protein [Burkholderia pseudomallei 112] gi|167918197|ref|ZP_02505288.1| iojap-like protein [Burkholderia pseudomallei BCC215] gi|226195303|ref|ZP_03790892.1| iojap family protein [Burkholderia pseudomallei Pakistan 9] gi|254195003|ref|ZP_04901432.1| putative iojap protein [Burkholderia pseudomallei S13] gi|126219291|gb|ABN82797.1| iojap-like protein [Burkholderia pseudomallei 668] gi|134247381|gb|EBA47466.1| iojap-like protein [Burkholderia pseudomallei 305] gi|169651751|gb|EDS84444.1| putative iojap protein [Burkholderia pseudomallei S13] gi|225932505|gb|EEH28503.1| iojap family protein [Burkholderia pseudomallei Pakistan 9] Length = 154 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|91228817|ref|ZP_01262724.1| hypothetical protein V12G01_00140 [Vibrio alginolyticus 12G01] gi|262394989|ref|YP_003286843.1| hypothetical protein VEA_004220 [Vibrio sp. Ex25] gi|269965472|ref|ZP_06179591.1| conserved hypothetical protein [Vibrio alginolyticus 40B] gi|91187622|gb|EAS73947.1| hypothetical protein V12G01_00140 [Vibrio alginolyticus 12G01] gi|262338583|gb|ACY52378.1| hypothetical protein VEA_004220 [Vibrio sp. Ex25] gi|269829951|gb|EEZ84181.1| conserved hypothetical protein [Vibrio alginolyticus 40B] Length = 105 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAEDI + +S + D M+I +G S +HV+SIAD++ + +KK Sbjct: 4 EELKDFLADKADDMKAEDIIVLNV-EDKSSVTDYMIICTGTSKRHVSSIADHVATEVKK 61 >gi|238028187|ref|YP_002912418.1| Iojap domain-containing protein [Burkholderia glumae BGR1] gi|237877381|gb|ACR29714.1| Iojap domain protein [Burkholderia glumae BGR1] Length = 146 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFNTTH-LTELFDRVIVASGTSNRQTKALASNVREQVK 60 >gi|172061258|ref|YP_001808910.1| iojap-like protein [Burkholderia ambifaria MC40-6] gi|171993775|gb|ACB64694.1| iojap-like protein [Burkholderia ambifaria MC40-6] Length = 146 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDIKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASSVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|126640641|ref|YP_001083625.1| hypothetical protein A1S_0570 [Acinetobacter baumannii ATCC 17978] gi|126386525|gb|ABO11023.1| hypothetical protein A1S_0570 [Acinetobacter baumannii ATCC 17978] Length = 133 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Query: 2 LANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 ++N+ A+ T++ + +C+ V + L ++KA+DI ++ +S+ S + D +VI SG ST+ Sbjct: 9 VSNSHDFAMNTSNKDIQACLKVVHDALVDVKAKDILQLDVSSI-SNVADAIVIASGTSTR 67 Query: 61 HVASIADNLISYLKK 75 HV ++ADN+ +K Sbjct: 68 HVKALADNVAEEARK 82 >gi|312130472|ref|YP_003997812.1| iojap-like protein [Leadbetterella byssophila DSM 17132] gi|311907018|gb|ADQ17459.1| iojap-like protein [Leadbetterella byssophila DSM 17132] Length = 130 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 30/64 (46%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ ++ ++ ++E K DI ++ + I D +I SG S + +IA+++ Sbjct: 1 MKKKISSEALCDLIINGIQEKKGFDIVKLDLRKISGAITDFFIICSGGSDTQIGAIAESV 60 Query: 70 ISYL 73 + Sbjct: 61 DEEV 64 >gi|150390080|ref|YP_001320129.1| iojap-like protein [Alkaliphilus metalliredigens QYMF] gi|149949942|gb|ABR48470.1| iojap-like protein [Alkaliphilus metalliredigens QYMF] Length = 122 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +++ + + EDI + S ICD VI +G+S + V +IAD + + Sbjct: 2 EKEIFQQVKNIVKAIDDKLGEDIVVLNLGQ-VSPICDYFVIATGKSDRQVKAIADEVENQ 60 Query: 73 LKK 75 LK+ Sbjct: 61 LKE 63 >gi|115352387|ref|YP_774226.1| iojap-like protein [Burkholderia ambifaria AMMD] gi|170699946|ref|ZP_02890974.1| iojap-like protein [Burkholderia ambifaria IOP40-10] gi|171320917|ref|ZP_02909912.1| iojap-like protein [Burkholderia ambifaria MEX-5] gi|115282375|gb|ABI87892.1| iojap-like protein [Burkholderia ambifaria AMMD] gi|170135151|gb|EDT03451.1| iojap-like protein [Burkholderia ambifaria IOP40-10] gi|171093809|gb|EDT38945.1| iojap-like protein [Burkholderia ambifaria MEX-5] Length = 146 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDIKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASSVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|84394385|ref|ZP_00993104.1| hypothetical protein V12B01_09871 [Vibrio splendidus 12B01] gi|84374987|gb|EAP91915.1| hypothetical protein V12B01_09871 [Vibrio splendidus 12B01] Length = 105 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE I I+ +S + D M++ +G S +HVASIA ++ ++K Sbjct: 4 EELKDFLADKADDMKAESIVTIDV-EGKSSVTDYMIVCTGTSKRHVASIAQHVADEVRK 61 >gi|114319566|ref|YP_741249.1| iojap-like protein [Alkalilimnicola ehrlichii MLHE-1] gi|114225960|gb|ABI55759.1| iojap-like protein [Alkalilimnicola ehrlichii MLHE-1] Length = 123 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + L+ + E L+++KAED+ ++ R+ + D +V+ +GRST+HVAS+AD+ Sbjct: 1 MSKAEITLEQLETLLREALEDIKAEDVVCLDVR-GRTPMTDLIVVATGRSTRHVASVADS 59 Query: 69 LISYLKKK 76 + L++ Sbjct: 60 VADDLREH 67 >gi|218247884|ref|YP_002373255.1| iojap-like protein [Cyanothece sp. PCC 8801] gi|218168362|gb|ACK67099.1| iojap-like protein [Cyanothece sp. PCC 8801] Length = 144 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 A + D+ ++ + + + + KA D+ ++ T + S + D +I +G S+ V +IAD Sbjct: 18 NANEAPDNAENLVLAIAQAADDRKAHDLVILKVTEI-SYLTDYFIIATGFSSTQVKAIAD 76 Query: 68 NLISYLKK 75 + + + Sbjct: 77 AIEEKVAE 84 >gi|77166118|ref|YP_344643.1| Iojap-related protein [Nitrosococcus oceani ATCC 19707] gi|254435075|ref|ZP_05048582.1| iojap family protein [Nitrosococcus oceani AFC27] gi|76884432|gb|ABA59113.1| Iojap-related protein [Nitrosococcus oceani ATCC 19707] gi|207088186|gb|EDZ65458.1| iojap family protein [Nitrosococcus oceani AFC27] Length = 115 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 V+ L+ LK DI ++ + + D MVI SG S + V ++A+ +I Sbjct: 5 ELKEFVVSALEALKGHDIQVLDVRK-LTTVADYMVIASGTSNRQVKALANEVIERC 59 >gi|257060795|ref|YP_003138683.1| iojap-like protein [Cyanothece sp. PCC 8802] gi|256590961|gb|ACV01848.1| iojap-like protein [Cyanothece sp. PCC 8802] Length = 144 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 A + D+ ++ + + + + KA D+ ++ T + S + D +I +G S+ V +IAD Sbjct: 18 NANEAPDNAENLVLAIAQAADDRKAHDLVILKVTEI-SYLTDYFIIATGFSSTQVKAIAD 76 Query: 68 NLISYLKK 75 + + + Sbjct: 77 AIEEKVAE 84 >gi|90418828|ref|ZP_01226739.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1] gi|90336908|gb|EAS50613.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1] Length = 141 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S I V L++ K EDI I+ +S + D+MVIVSGRS +HV+++A NL+ LK++ Sbjct: 29 RSAIELVTSSLEDSKGEDIVSIDM-QGKSALADHMVIVSGRSNRHVSAVAGNLLRDLKQQ 87 >gi|66047594|ref|YP_237435.1| Iojap-related protein [Pseudomonas syringae pv. syringae B728a] gi|71736823|ref|YP_276525.1| iojap domain-containing protein [Pseudomonas syringae pv. phaseolicola 1448A] gi|237798406|ref|ZP_04586867.1| iojap domain-containing protein [Pseudomonas syringae pv. oryzae str. 1_6] gi|257482230|ref|ZP_05636271.1| iojap domain-containing protein [Pseudomonas syringae pv. tabaci ATCC 11528] gi|289625774|ref|ZP_06458728.1| iojap domain-containing protein [Pseudomonas syringae pv. aesculi str. NCPPB3681] gi|289648440|ref|ZP_06479783.1| iojap domain-containing protein [Pseudomonas syringae pv. aesculi str. 2250] gi|298488983|ref|ZP_07007006.1| ribosome-associated protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|302185165|ref|ZP_07261838.1| iojap domain-containing protein [Pseudomonas syringae pv. syringae 642] gi|63258301|gb|AAY39397.1| Iojap-related protein [Pseudomonas syringae pv. syringae B728a] gi|71557376|gb|AAZ36587.1| iojap domain protein [Pseudomonas syringae pv. phaseolicola 1448A] gi|298156481|gb|EFH97578.1| ribosome-associated protein [Pseudomonas savastanoi pv. savastanoi NCPPB 3335] gi|320322706|gb|EFW78799.1| iojap domain-containing protein [Pseudomonas syringae pv. glycinea str. B076] gi|320330509|gb|EFW86488.1| iojap domain-containing protein [Pseudomonas syringae pv. glycinea str. race 4] gi|330867170|gb|EGH01879.1| iojap domain-containing protein [Pseudomonas syringae pv. aesculi str. 0893_23] gi|330871058|gb|EGH05767.1| iojap domain-containing protein [Pseudomonas syringae pv. aesculi str. 0893_23] gi|330873705|gb|EGH07854.1| iojap domain-containing protein [Pseudomonas syringae pv. glycinea str. race 4] gi|330887950|gb|EGH20611.1| iojap domain-containing protein [Pseudomonas syringae pv. mori str. 301020] gi|330953027|gb|EGH53287.1| iojap domain-containing protein [Pseudomonas syringae Cit 7] gi|330969432|gb|EGH69498.1| iojap domain-containing protein [Pseudomonas syringae pv. aceris str. M302273PT] gi|330987598|gb|EGH85701.1| iojap domain-containing protein [Pseudomonas syringae pv. lachrymans str. M301315] gi|331011306|gb|EGH91362.1| iojap domain-containing protein [Pseudomonas syringae pv. tabaci ATCC 11528] gi|331021258|gb|EGI01315.1| iojap domain-containing protein [Pseudomonas syringae pv. oryzae str. 1_6] Length = 128 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + I + L+E+K DI I+ ++ I D M+I +G S + + ++ DN Sbjct: 1 MTKQKMSSEEVINVAIAALEEVKGADILTIDVRD-KTSIADYMLICTGTSNRQLNALVDN 59 Query: 69 LISYLK 74 + +K Sbjct: 60 VRDKVK 65 >gi|294501318|ref|YP_003565018.1| hypothetical protein BMQ_4580 [Bacillus megaterium QM B1551] gi|294351255|gb|ADE71584.1| protein of unknown function (DUF143) [Bacillus megaterium QM B1551] Length = 117 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ V+E + KA DI + SL+ D VI G S K V +IA + ++ Sbjct: 4 RELLSLVVEAADDKKAIDIVALNM-EGISLVADYFVICHGNSDKQVQAIAREIKENAHEQ 62 >gi|91774948|ref|YP_544704.1| Iojap-related protein [Methylobacillus flagellatus KT] gi|91708935|gb|ABE48863.1| Iojap-related protein [Methylobacillus flagellatus KT] Length = 119 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 L+ V++ L+++KA DI ++ + + + M++ S ST+ +IADN+ Sbjct: 1 MLDLEQMKLAVVDALEDIKAFDITVMDVSK-LTSLTSYMIVASANSTRQAKAIADNVREK 59 Query: 73 LKKK 76 LK+K Sbjct: 60 LKEK 63 >gi|224823419|ref|ZP_03696528.1| iojap-like protein [Lutiella nitroferrum 2002] gi|224603874|gb|EEG10048.1| iojap-like protein [Lutiella nitroferrum 2002] Length = 122 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ +E L+++K +DI ++ T + + M++ +G S + V ++A+N+ LK Sbjct: 2 DINAIAKLAVEALEDVKGKDIIELDTTD-LTSLFQRMIVCTGDSNRQVKALANNVQVTLK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|170691722|ref|ZP_02882886.1| iojap-like protein [Burkholderia graminis C4D1M] gi|170143006|gb|EDT11170.1| iojap-like protein [Burkholderia graminis C4D1M] Length = 151 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A ++ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTALFDRVIVASGTSNRQTKALASSVREGVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|294789504|ref|ZP_06754740.1| iojap-like protein [Simonsiella muelleri ATCC 29453] gi|294482584|gb|EFG30275.1| iojap-like protein [Simonsiella muelleri ATCC 29453] Length = 130 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+E+KA+DI ++ T ++ + M+I SG ST+ V ++A+N+ Sbjct: 5 QELQKLQQMVDIAVNALEEVKAKDIIVLD-TVGKTSLFSRMIIASGDSTRQVKALANNVA 63 Query: 71 SYLKK 75 LK+ Sbjct: 64 VDLKE 68 >gi|295687694|ref|YP_003591387.1| iojap-like protein [Caulobacter segnis ATCC 21756] gi|295429597|gb|ADG08769.1| iojap-like protein [Caulobacter segnis ATCC 21756] Length = 113 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 40/61 (65%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++ L + KA+DI HI+ T +S + D++++ SGRS +HV ++AD+++ LK+ Sbjct: 1 MKALERLILTRLDDDKAQDIVHIDLTD-KSSVADSLIVASGRSHRHVGALADHILRALKE 59 Query: 76 K 76 Sbjct: 60 N 60 >gi|53803676|ref|YP_114459.1| iojap-like protein [Methylococcus capsulatus str. Bath] gi|53757437|gb|AAU91728.1| iojap-related protein [Methylococcus capsulatus str. Bath] Length = 114 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++S + V+ L E K D+ I+ ++ I + VI SG S +HV S+A N+ + K Sbjct: 4 SVESLLGIVVAALDEGKGRDVKIIDLR-GKTTIAEFFVIASGTSDRHVRSLAGNVEASAK 62 >gi|295399246|ref|ZP_06809228.1| iojap-like protein [Geobacillus thermoglucosidasius C56-YS93] gi|312110152|ref|YP_003988468.1| iojap-like protein [Geobacillus sp. Y4.1MC1] gi|294978712|gb|EFG54308.1| iojap-like protein [Geobacillus thermoglucosidasius C56-YS93] gi|311215253|gb|ADP73857.1| iojap-like protein [Geobacillus sp. Y4.1MC1] Length = 118 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE+I + SL+ D VI G S K V +IA + ++ Sbjct: 4 QEILRLVVRAADDKKAENIVVLNM-KGISLVADYFVICHGNSEKQVQAIAREIKEKAEEH 62 Query: 77 N 77 + Sbjct: 63 H 63 >gi|238785714|ref|ZP_04629688.1| hypothetical protein yberc0001_14970 [Yersinia bercovieri ATCC 43970] gi|238795406|ref|ZP_04638921.1| hypothetical protein ymoll0001_9960 [Yersinia mollaretii ATCC 43969] gi|238713354|gb|EEQ05392.1| hypothetical protein yberc0001_14970 [Yersinia bercovieri ATCC 43970] gi|238720525|gb|EEQ12326.1| hypothetical protein ymoll0001_9960 [Yersinia mollaretii ATCC 43969] Length = 105 Score = 71.3 bits (174), Expect = 5e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 4 KALQEFVIDKLDDLKGQDIIALDV-QGKSSITDCMIICTGTSTRHVMALADNLVQE 58 >gi|228477032|ref|ZP_04061670.1| iojap homolog [Streptococcus salivarius SK126] gi|228251051|gb|EEK10222.1| iojap homolog [Streptococcus salivarius SK126] Length = 116 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K+ Sbjct: 3 EELLELVVKAADEKRAEDIVALDLY-GLTSLTDYFVILSAMNSRQLEAIADNIREKVKE 60 >gi|254509291|ref|ZP_05121383.1| iojap family protein [Vibrio parahaemolyticus 16] gi|219547779|gb|EED24812.1| iojap family protein [Vibrio parahaemolyticus 16] Length = 105 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L+ +++ ++KA+DI I+ +S I D M+I +G S +HVASIAD++ K Sbjct: 2 QLEELNDFLVDKADDMKAQDIKTIDV-QGKSSITDYMIICTGTSKRHVASIADHVAKESK 60 >gi|28871942|ref|NP_794561.1| iojap-like protein [Pseudomonas syringae pv. tomato str. DC3000] gi|213968038|ref|ZP_03396184.1| iojap-related protein [Pseudomonas syringae pv. tomato T1] gi|28855195|gb|AAO58256.1| iojap-related protein [Pseudomonas syringae pv. tomato str. DC3000] gi|213927381|gb|EEB60930.1| iojap-related protein [Pseudomonas syringae pv. tomato T1] Length = 123 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + L+E+K DI I+ ++ I D M+I +G S + + ++ DN+ +K Sbjct: 2 SSEEVVQVAIAALEEVKGGDILTIDVRE-KTSIADYMLICTGTSNRQLNALVDNVRDKVK 60 >gi|91215669|ref|ZP_01252639.1| hypothetical protein P700755_02092 [Psychroflexus torquis ATCC 700755] gi|91186135|gb|EAS72508.1| hypothetical protein P700755_02092 [Psychroflexus torquis ATCC 700755] Length = 123 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 35/65 (53%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 ++LD I +++ ++E+K +DI I+ L + +CD ++ SG S V +I ++ Sbjct: 3 TKKENLDQLITHIIQGIEEVKGDDIQIIDLRELENTVCDYFIVCSGNSNTQVNAIESSVR 62 Query: 71 SYLKK 75 + K Sbjct: 63 KAVSK 67 >gi|86359653|ref|YP_471545.1| hypothetical protein RHE_CH04075 [Rhizobium etli CFN 42] gi|86283755|gb|ABC92818.1| hypothetical conserved protein [Rhizobium etli CFN 42] Length = 149 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 23/54 (42%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V+ L++ KAEDI I+ +S + D M++VSGRS +HV +I+D+L++ LK + Sbjct: 44 VLTSLEDSKAEDIVTIDIA-GKSALGDYMIVVSGRSNRHVLAISDHLLTDLKDE 96 >gi|260753783|ref|YP_003226676.1| iojap-like protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258553146|gb|ACV76092.1| iojap-like protein [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 133 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M A + + QT+ + + V + L + +A +I I +S I D MVI SGRS++ Sbjct: 1 MPAPSSPRKNQTSFDPEMLLKLVTDSLDDDQALEIVTIPLA-GKSSIADYMVIASGRSSR 59 Query: 61 HVASIADNLISYLK 74 V ++A L +K Sbjct: 60 QVTAMAQKLADRIK 73 >gi|225867899|ref|YP_002743847.1| hypothetical protein SZO_02890 [Streptococcus equi subsp. zooepidemicus] gi|225701175|emb|CAW98079.1| conserved hypothetical protein [Streptococcus equi subsp. zooepidemicus] Length = 117 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AED+ ++ + + D VIV+ +++ + +IADN+ +K+ Sbjct: 4 EELLEIVIKGADEKRAEDMLALDLA-GLTSLTDYFVIVTATNSRQLEAIADNIRERVKE 61 >gi|188582235|ref|YP_001925680.1| iojap-like protein [Methylobacterium populi BJ001] gi|179345733|gb|ACB81145.1| iojap-like protein [Methylobacterium populi BJ001] Length = 157 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 25/62 (40%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D+ A + CL E+KAE+ I+ ++ + D M+I SGRS +HV SIAD +I +K Sbjct: 43 SSDALKALALGCLDEMKAEETVEIDLA-GKTSLADTMIIASGRSQRHVGSIADKIIQEMK 101 Query: 75 KK 76 K Sbjct: 102 AK 103 >gi|261822391|ref|YP_003260497.1| hypothetical protein Pecwa_3148 [Pectobacterium wasabiae WPP163] gi|261606404|gb|ACX88890.1| iojap-like protein [Pectobacterium wasabiae WPP163] Length = 105 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LKA+DI + +S I D MVI +G ST+HVASIAD+++ Sbjct: 4 QALQDFVIDKVDDLKAQDIVALNV-QGKSSITDYMVICTGTSTRHVASIADHVVQ 57 >gi|91975049|ref|YP_567708.1| Iojap-related protein [Rhodopseudomonas palustris BisB5] gi|91681505|gb|ABE37807.1| Iojap-related protein [Rhodopseudomonas palustris BisB5] Length = 210 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 A T + + ++ L ++KAE+ I+ +S + D +V+ SGR +HV Sbjct: 86 ATPPDAISTTHGTAEETLQLILSRLDDMKAEETVAIDLR-GKSAMFDYVVVTSGRVNRHV 144 Query: 63 ASIADNLISYLKK 75 +I++N+ LK+ Sbjct: 145 GAISENVSKALKE 157 >gi|292487606|ref|YP_003530478.1| hypothetical protein EAMY_1120 [Erwinia amylovora CFBP1430] gi|292898845|ref|YP_003538214.1| hypothetical protein EAM_1127 [Erwinia amylovora ATCC 49946] gi|291198693|emb|CBJ45802.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946] gi|291553025|emb|CBA20070.1| Uncharacterized protein C7orf30 homolog [Erwinia amylovora CFBP1430] gi|312171713|emb|CBX79971.1| Uncharacterized protein C7orf30 homolog [Erwinia amylovora ATCC BAA-2158] Length = 105 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ + +LK +DI I+ +S I D M+I +G ST+HV SIA++++ + Sbjct: 4 QALQDFVVDKIDDLKGQDIVTIDVR-GKSSITDCMIICTGTSTRHVVSIAEHVVQAAR 60 >gi|154504421|ref|ZP_02041159.1| hypothetical protein RUMGNA_01925 [Ruminococcus gnavus ATCC 29149] gi|153795350|gb|EDN77770.1| hypothetical protein RUMGNA_01925 [Ruminococcus gnavus ATCC 29149] Length = 116 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L + K EDI I+ + S++ D +I +G S V ++ DN+ Sbjct: 1 MEQSKLMARLAYQALDDKKGEDIQVIDISQ-VSVLADYFIIANGNSESQVRALVDNVEEE 59 Query: 73 LKK 75 L K Sbjct: 60 LSK 62 >gi|262402703|ref|ZP_06079264.1| hypothetical protein VOA_000684 [Vibrio sp. RC586] gi|262351485|gb|EEZ00618.1| hypothetical protein VOA_000684 [Vibrio sp. RC586] Length = 105 Score = 70.9 bits (173), Expect = 5e-11, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + + ++KA DI ++ +S + D M++ +G S +HVASIA+++ + K+ Sbjct: 4 EALKDFLSDKADDMKAVDIVTLDV-QGKSSVTDYMIVCTGTSKRHVASIAEHVANEAKQ 61 >gi|108762788|ref|YP_629499.1| iojap-like protein [Myxococcus xanthus DK 1622] gi|108466668|gb|ABF91853.1| iojap-like protein [Myxococcus xanthus DK 1622] Length = 121 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + L + KA+D+ ++ + D VI S + + V+++A+N+ L Sbjct: 7 PAAKALAHRIGNLLVDKKAQDVVILDVR-GMTSYADYFVIASAETDRQVSAMAENVQVQL 65 Query: 74 K 74 K Sbjct: 66 K 66 >gi|254784811|ref|YP_003072239.1| polyA polymerase, iojap protein [Teredinibacter turnerae T7901] gi|237684623|gb|ACR11887.1| polyA polymerase, iojap protein [Teredinibacter turnerae T7901] Length = 118 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 V+ L++LK +DI ++ S + D +VIV+G S +HV S+A+N++ K+ + Sbjct: 4 ELNKVVINALEDLKGKDIVELDVRE-LSDVTDALVIVTGTSNRHVKSLANNVVEDGKEHD 62 >gi|194466639|ref|ZP_03072626.1| iojap-like protein [Lactobacillus reuteri 100-23] gi|194453675|gb|EDX42572.1| iojap-like protein [Lactobacillus reuteri 100-23] Length = 128 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AEDI ++ S + D VI++G S + V +I + ++ Sbjct: 2 DSKQLLEMVVKAADGRRAEDIVALKV-DEISPMADYFVIMTGGSDRQVQAITNAIVEKAH 60 Query: 75 KKN 77 ++N Sbjct: 61 EEN 63 >gi|86148570|ref|ZP_01066855.1| hypothetical protein MED222_02052 [Vibrio sp. MED222] gi|218708736|ref|YP_002416357.1| hypothetical protein VS_0715 [Vibrio splendidus LGP32] gi|85833636|gb|EAQ51809.1| hypothetical protein MED222_02052 [Vibrio sp. MED222] gi|218321755|emb|CAV17710.1| hypothetical protein VS_0715 [Vibrio splendidus LGP32] Length = 105 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KAE I I+ +S + D M++ +G S +HVASIA ++ ++K Sbjct: 4 EELKDFLADKADDMKAESIVTIDV-EGKSSVTDYMIVCTGTSKRHVASIAQHVADEVRK 61 >gi|152969240|ref|YP_001334349.1| hypothetical protein KPN_00669 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|206576093|ref|YP_002239708.1| iojap family protein [Klebsiella pneumoniae 342] gi|238893704|ref|YP_002918438.1| hypothetical protein KP1_1624 [Klebsiella pneumoniae NTUH-K2044] gi|262041272|ref|ZP_06014483.1| iojap family protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|288936550|ref|YP_003440609.1| iojap-like protein [Klebsiella variicola At-22] gi|290510394|ref|ZP_06549764.1| iojap protein 155 [Klebsiella sp. 1_1_55] gi|330006019|ref|ZP_08305462.1| iojap-like protein [Klebsiella sp. MS 92-3] gi|150954089|gb|ABR76119.1| hypothetical protein KPN_00669 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|206565151|gb|ACI06927.1| iojap family protein [Klebsiella pneumoniae 342] gi|238546020|dbj|BAH62371.1| hypothetical protein KP1_1624 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] gi|259041388|gb|EEW42448.1| iojap family protein [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|288891259|gb|ADC59577.1| iojap-like protein [Klebsiella variicola At-22] gi|289777110|gb|EFD85108.1| iojap protein 155 [Klebsiella sp. 1_1_55] gi|328536011|gb|EGF62421.1| iojap-like protein [Klebsiella sp. MS 92-3] Length = 105 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI I+ +S I D M+I +G ST+HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIVAIDV-HGKSSITDCMIICTGTSTRHVMSIADHVVQE 58 >gi|126733848|ref|ZP_01749595.1| Iojap-related protein [Roseobacter sp. CCS2] gi|126716714|gb|EBA13578.1| Iojap-related protein [Roseobacter sp. CCS2] Length = 151 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 DS +A V++ L++ K EDI I +S I D MVI SGRST+ V ++A+ L +K Sbjct: 41 TSDSLLAAVLKSLEDDKGEDIVQINLR-GKSEIGDYMVIASGRSTRQVTAMAEKLADKIK 99 Query: 75 K 75 + Sbjct: 100 Q 100 >gi|262280989|ref|ZP_06058772.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] gi|262257889|gb|EEY76624.1| conserved hypothetical protein [Acinetobacter calcoaceticus RUH2202] Length = 133 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Query: 2 LANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 ++N+ A+ T++ + +C+ V + L ++KA+DI ++ +S+ S + D +VI SG ST+ Sbjct: 9 VSNSHDFAMNTSNKDVQTCLKVVHDALVDVKAKDILQLDVSSI-SNVSDAIVIASGTSTR 67 Query: 61 HVASIADNLISYLKK 75 HV ++ADN+ +K Sbjct: 68 HVKALADNVAEEARK 82 >gi|119470848|ref|ZP_01613459.1| hypothetical protein ATW7_05896 [Alteromonadales bacterium TW-7] gi|119446075|gb|EAW27354.1| hypothetical protein ATW7_05896 [Alteromonadales bacterium TW-7] Length = 105 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A M+ + ++KA DI I+ T +S I D MVI +G S +HV SIAD+L + Sbjct: 2 DSKQLLAFAMDKIDDMKARDIVDIDVTD-KSDITDYMVICTGTSKRHVQSIADHLAKEAR 60 Query: 75 KKN 77 + Sbjct: 61 HAD 63 >gi|251790542|ref|YP_003005263.1| hypothetical protein Dd1591_2962 [Dickeya zeae Ech1591] gi|247539163|gb|ACT07784.1| iojap-like protein [Dickeya zeae Ech1591] Length = 105 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 QALQDFVIDKLDDLKGQDIVTLDV-KGKSSITDCMIICTGTSSRHVISIADHVVQE 58 >gi|114776730|ref|ZP_01451773.1| iojap-related protein [Mariprofundus ferrooxydans PV-1] gi|114552816|gb|EAU55247.1| iojap-related protein [Mariprofundus ferrooxydans PV-1] Length = 120 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + L++ V+E L++ KA DI I+ R D V+ SGRS + + ++A+++ Sbjct: 5 TEQESLEALTTAVVEALEDKKATDILVIDVR-GRCDFTDRFVLASGRSDRQLKALANSVG 63 Query: 71 SYLKK 75 + Sbjct: 64 EAAHR 68 >gi|195978783|ref|YP_002124027.1| Iojap-related protein [Streptococcus equi subsp. zooepidemicus MGCS10565] gi|195975488|gb|ACG63014.1| Iojap-related protein [Streptococcus equi subsp. zooepidemicus MGCS10565] Length = 117 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AED+ ++ + + D VIV+ +++ + +IADN+ +K+ Sbjct: 4 EELLEIVIKGADEKRAEDMLALDLA-GLTSLTDYFVIVTATNSRQLEAIADNIRERVKE 61 >gi|253997255|ref|YP_003049319.1| iojap-like protein [Methylotenera mobilis JLW8] gi|253983934|gb|ACT48792.1| iojap-like protein [Methylotenera mobilis JLW8] Length = 129 Score = 70.5 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 17/76 (22%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M +T+K A L++ V++ ++++K DI ++ + + + M++ S S++ Sbjct: 1 MTQDTQKVASNNL-DLEAMKNAVVDAIEDIKGFDISVMDVRK-LTSMTNYMIVASANSSR 58 Query: 61 HVASIADNLISYLKKK 76 ++ADN+ +K+K Sbjct: 59 QAKAVADNVREKIKEK 74 >gi|227114419|ref|ZP_03828075.1| hypothetical protein PcarbP_15738 [Pectobacterium carotovorum subsp. brasiliensis PBR1692] gi|227327376|ref|ZP_03831400.1| hypothetical protein PcarcW_08648 [Pectobacterium carotovorum subsp. carotovorum WPP14] gi|253687577|ref|YP_003016767.1| iojap-like protein [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251754155|gb|ACT12231.1| iojap-like protein [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 105 Score = 70.5 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LKA+DI + +S I D MVI +G ST+HVASIAD+++ Sbjct: 4 QALQDFVIDKVDDLKAQDIVALNV-QGKSSITDYMVICTGTSTRHVASIADHVVQ 57 >gi|237809565|ref|YP_002894005.1| iojap-like protein [Tolumonas auensis DSM 9187] gi|237501826|gb|ACQ94419.1| iojap-like protein [Tolumonas auensis DSM 9187] Length = 111 Score = 70.5 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ L ++KA DI ++ S I D M+I +G S +HV SIA+NL ++ Sbjct: 4 KQLQDFVVDKLDDMKASDIMVLDV-HGISDITDCMIICTGNSNRHVRSIAENLAEEIR 60 >gi|170742348|ref|YP_001771003.1| iojap-like protein [Methylobacterium sp. 4-46] gi|168196622|gb|ACA18569.1| iojap-like protein [Methylobacterium sp. 4-46] Length = 121 Score = 70.5 bits (172), Expect = 6e-11, Method: Composition-based stats. Identities = 26/63 (41%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D D +A CL+++KAED I+ ++ I D M+I SGRS +HV SIA+ L+ Sbjct: 5 AEDRPDGLLAIARRCLEDMKAEDTVEIDLA-GKTSIADAMIITSGRSHRHVGSIAEKLVQ 63 Query: 72 YLK 74 LK Sbjct: 64 ELK 66 >gi|238752599|ref|ZP_04614072.1| hypothetical protein yrohd0001_830 [Yersinia rohdei ATCC 43380] gi|238709190|gb|EEQ01435.1| hypothetical protein yrohd0001_830 [Yersinia rohdei ATCC 43380] Length = 105 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ +K Sbjct: 4 KALQEFVIDKLDDLKGQDILALDV-QGKSSITDCMIICTGTSTRHVMALADNLVQESRK 61 >gi|22125083|ref|NP_668506.1| hypothetical protein y1180 [Yersinia pestis KIM 10] gi|45440937|ref|NP_992476.1| hypothetical protein YP_1107 [Yersinia pestis biovar Microtus str. 91001] gi|51595446|ref|YP_069637.1| hypothetical protein YPTB1099 [Yersinia pseudotuberculosis IP 32953] gi|108808484|ref|YP_652400.1| hypothetical protein YPA_2491 [Yersinia pestis Antiqua] gi|108811255|ref|YP_647022.1| hypothetical protein YPN_1091 [Yersinia pestis Nepal516] gi|145599910|ref|YP_001163986.1| hypothetical protein YPDSF_2647 [Yersinia pestis Pestoides F] gi|149365493|ref|ZP_01887528.1| hypothetical protein YPE_0658 [Yersinia pestis CA88-4125] gi|153947392|ref|YP_001401909.1| hypothetical protein YpsIP31758_2947 [Yersinia pseudotuberculosis IP 31758] gi|162419787|ref|YP_001606333.1| hypothetical protein YpAngola_A1846 [Yersinia pestis Angola] gi|165925407|ref|ZP_02221239.1| iojap-related protein [Yersinia pestis biovar Orientalis str. F1991016] gi|165937603|ref|ZP_02226165.1| iojap-related protein [Yersinia pestis biovar Orientalis str. IP275] gi|166008122|ref|ZP_02229020.1| iojap-related protein [Yersinia pestis biovar Antiqua str. E1979001] gi|166212496|ref|ZP_02238531.1| iojap-related protein [Yersinia pestis biovar Antiqua str. B42003004] gi|167399362|ref|ZP_02304886.1| iojap-related protein [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167422568|ref|ZP_02314321.1| iojap-related protein [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167423163|ref|ZP_02314916.1| iojap-related protein [Yersinia pestis biovar Mediaevalis str. K1973002] gi|167468420|ref|ZP_02333124.1| iojap-related protein [Yersinia pestis FV-1] gi|170025240|ref|YP_001721745.1| hypothetical protein YPK_3019 [Yersinia pseudotuberculosis YPIII] gi|186894477|ref|YP_001871589.1| hypothetical protein YPTS_1156 [Yersinia pseudotuberculosis PB1/+] gi|218929687|ref|YP_002347562.1| hypothetical protein YPO2606 [Yersinia pestis CO92] gi|229838152|ref|ZP_04458311.1| hypothetical protein YPH_0378 [Yersinia pestis biovar Orientalis str. PEXU2] gi|229895944|ref|ZP_04511114.1| hypothetical protein YPS_3747 [Yersinia pestis Pestoides A] gi|229898737|ref|ZP_04513882.1| hypothetical protein YPF_3178 [Yersinia pestis biovar Orientalis str. India 195] gi|229901492|ref|ZP_04516614.1| hypothetical protein YP516_1185 [Yersinia pestis Nepal516] gi|270489678|ref|ZP_06206752.1| iojap-like ribosome-associated protein [Yersinia pestis KIM D27] gi|294504410|ref|YP_003568472.1| hypothetical protein YPZ3_2300 [Yersinia pestis Z176003] gi|21957937|gb|AAM84757.1|AE013721_5 hypothetical protein y1180 [Yersinia pestis KIM 10] gi|45435796|gb|AAS61353.1| conserved hypothetical protein (homolog of plant Iojap proteins) [Yersinia pestis biovar Microtus str. 91001] gi|51588728|emb|CAH20339.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP 32953] gi|108774903|gb|ABG17422.1| hypothetical protein YPN_1091 [Yersinia pestis Nepal516] gi|108780397|gb|ABG14455.1| hypothetical protein YPA_2491 [Yersinia pestis Antiqua] gi|115348298|emb|CAL21229.1| conserved hypothetical protein [Yersinia pestis CO92] gi|145211606|gb|ABP41013.1| hypothetical protein YPDSF_2647 [Yersinia pestis Pestoides F] gi|149291906|gb|EDM41980.1| hypothetical protein YPE_0658 [Yersinia pestis CA88-4125] gi|152958887|gb|ABS46348.1| iojap-related protein [Yersinia pseudotuberculosis IP 31758] gi|162352602|gb|ABX86550.1| iojap-related protein [Yersinia pestis Angola] gi|165914353|gb|EDR32968.1| iojap-related protein [Yersinia pestis biovar Orientalis str. IP275] gi|165923014|gb|EDR40165.1| iojap-related protein [Yersinia pestis biovar Orientalis str. F1991016] gi|165992504|gb|EDR44805.1| iojap-related protein [Yersinia pestis biovar Antiqua str. E1979001] gi|166206427|gb|EDR50907.1| iojap-related protein [Yersinia pestis biovar Antiqua str. B42003004] gi|166958582|gb|EDR55603.1| iojap-related protein [Yersinia pestis biovar Orientalis str. MG05-1020] gi|167051866|gb|EDR63274.1| iojap-related protein [Yersinia pestis biovar Antiqua str. UG05-0454] gi|167057333|gb|EDR67079.1| iojap-related protein [Yersinia pestis biovar Mediaevalis str. K1973002] gi|169751774|gb|ACA69292.1| iojap-like protein [Yersinia pseudotuberculosis YPIII] gi|186697503|gb|ACC88132.1| iojap-like protein [Yersinia pseudotuberculosis PB1/+] gi|229681421|gb|EEO77515.1| hypothetical protein YP516_1185 [Yersinia pestis Nepal516] gi|229688285|gb|EEO80356.1| hypothetical protein YPF_3178 [Yersinia pestis biovar Orientalis str. India 195] gi|229694518|gb|EEO84565.1| hypothetical protein YPH_0378 [Yersinia pestis biovar Orientalis str. PEXU2] gi|229700867|gb|EEO88896.1| hypothetical protein YPS_3747 [Yersinia pestis Pestoides A] gi|262362600|gb|ACY59321.1| hypothetical protein YPD4_2414 [Yersinia pestis D106004] gi|262366396|gb|ACY62953.1| hypothetical protein YPD8_2278 [Yersinia pestis D182038] gi|270338182|gb|EFA48959.1| iojap-like ribosome-associated protein [Yersinia pestis KIM D27] gi|294354869|gb|ADE65210.1| hypothetical protein YPZ3_2300 [Yersinia pestis Z176003] gi|320016191|gb|ADV99762.1| hypothetical protein YPC_3269 [Yersinia pestis biovar Medievalis str. Harbin 35] Length = 105 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADN++ Sbjct: 4 KALQEFVIDKLDDLKGQDIIALDV-QGKSSITDCMIICTGTSTRHVMALADNVVQE 58 >gi|332284812|ref|YP_004416723.1| hypothetical protein PT7_1559 [Pusillimonas sp. T7-7] gi|330428765|gb|AEC20099.1| hypothetical protein PT7_1559 [Pusillimonas sp. T7-7] Length = 131 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+++KA+DI T + + + D +VI SG S + +IA N+ + Sbjct: 2 DIQKLQRLVIDALEDVKAQDIKVFNTTHI-TGLFDRVVIASGTSNRQTRAIASNVADAAR 60 Query: 75 KK 76 K+ Sbjct: 61 KQ 62 >gi|255263870|ref|ZP_05343212.1| putative iojap family protein [Thalassiobium sp. R2A62] gi|255106205|gb|EET48879.1| putative iojap family protein [Thalassiobium sp. R2A62] Length = 145 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 38/62 (61%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ +A ++ L+ KAEDI I+ +S + D M+I SGRST+ V++IA+ L +K Sbjct: 33 TSETLLAEILTSLEADKAEDIVQIDLR-GKSEMGDYMIICSGRSTRQVSAIAEKLTDKVK 91 Query: 75 KK 76 + Sbjct: 92 SE 93 >gi|153874417|ref|ZP_02002648.1| Iojap-related protein [Beggiatoa sp. PS] gi|152069120|gb|EDN67353.1| Iojap-related protein [Beggiatoa sp. PS] Length = 115 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + V + L++ KA+DI I D M++ +G + + V ++A N+I K Sbjct: 2 DTEKLLIIVKQALEDKKAQDIKVINVRK-LCNFTDFMIVATGNTARQVVALAQNVIDEAK 60 Query: 75 KK 76 K+ Sbjct: 61 KQ 62 >gi|322373548|ref|ZP_08048084.1| iojap-like protein [Streptococcus sp. C150] gi|321278590|gb|EFX55659.1| iojap-like protein [Streptococcus sp. C150] Length = 116 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K+ Sbjct: 3 EELLELVVKAADEKRAEDIVALDLY-GLTSLTDYFVILSAMNSRQLEAIADNIREKVKE 60 >gi|146310830|ref|YP_001175904.1| hypothetical protein Ent638_1172 [Enterobacter sp. 638] gi|145317706|gb|ABP59853.1| iojap-like protein [Enterobacter sp. 638] Length = 105 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 V++ + +LK +DI I+ RS I D M+I +G ST+HVASIAD+++ Sbjct: 4 KELQDFVIDKIDDLKGQDIIAIDV-HGRSSITDCMIICTGTSTRHVASIADHVVQE 58 >gi|322411132|gb|EFY02040.1| iojap protein family [Streptococcus dysgalactiae subsp. dysgalactiae ATCC 27957] gi|323126599|gb|ADX23896.1| iojap protein family [Streptococcus dysgalactiae subsp. equisimilis ATCC 12394] Length = 117 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AED+ ++ + + D VI S +++ + +IADN+ +K+ Sbjct: 4 EELLEIVVKAADEKRAEDMLALDL-EGLTSLTDYFVIASATNSRQLEAIADNIREKVKE 61 >gi|225871187|ref|YP_002747134.1| hypothetical protein SEQ_1908 [Streptococcus equi subsp. equi 4047] gi|225700591|emb|CAW95111.1| conserved hypothetical protein [Streptococcus equi subsp. equi 4047] Length = 117 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AED+ ++ + + D VIV+ +++ + +IADN+ +K+ Sbjct: 4 EELLEIVIKAADEKRAEDMLALDLA-GLTSLTDYFVIVTATNSRQLEAIADNIRERVKE 61 >gi|312863397|ref|ZP_07723635.1| iojap-like protein [Streptococcus vestibularis F0396] gi|322516200|ref|ZP_08069133.1| Iojap protein family protein [Streptococcus vestibularis ATCC 49124] gi|311100933|gb|EFQ59138.1| iojap-like protein [Streptococcus vestibularis F0396] gi|322125376|gb|EFX96731.1| Iojap protein family protein [Streptococcus vestibularis ATCC 49124] Length = 116 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K+ Sbjct: 3 EELLELVVKAADEKRAEDIVALDLY-GLTSLTDYFVILSAMNSRQLEAIADNIREKVKE 60 >gi|254486701|ref|ZP_05099906.1| iojap family protein [Roseobacter sp. GAI101] gi|214043570|gb|EEB84208.1| iojap family protein [Roseobacter sp. GAI101] Length = 122 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 25/68 (36%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 A D+ +A++++ L E KAEDI I+ ++ I D MV+ +GRST+ V+SIA+ Sbjct: 2 NASDETATSDALLASILKQLDEDKAEDIVQIDLR-GKTAIGDYMVVCTGRSTRQVSSIAE 60 Query: 68 NLISYLKK 75 L +K Sbjct: 61 KLAQMVKD 68 >gi|325954171|ref|YP_004237831.1| iojap-like protein [Weeksella virosa DSM 16922] gi|323436789|gb|ADX67253.1| iojap-like protein [Weeksella virosa DSM 16922] Length = 120 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 35/67 (52%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + ++++ + ++K EDI ++ + + C+ VI +G S V +IA+++ Sbjct: 1 MIDNQYTKDLLDSIVDGISKVKGEDITILDLREIENSFCEYFVICNGNSNTQVNAIAESV 60 Query: 70 ISYLKKK 76 +K + Sbjct: 61 ERLVKTE 67 >gi|239827792|ref|YP_002950416.1| iojap-like protein [Geobacillus sp. WCH70] gi|239808085|gb|ACS25150.1| iojap-like protein [Geobacillus sp. WCH70] Length = 118 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE+I + SL+ D VI G S K V +IA + ++ Sbjct: 4 QEILQLVVRAADDKKAENIVVLNM-KGISLVADYFVICHGNSEKQVQAIAREIKEKAEEH 62 Query: 77 N 77 + Sbjct: 63 H 63 >gi|258621970|ref|ZP_05716999.1| conserved hypothetical protein [Vibrio mimicus VM573] gi|258625420|ref|ZP_05720314.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|258582331|gb|EEW07186.1| conserved hypothetical protein [Vibrio mimicus VM603] gi|258585723|gb|EEW10443.1| conserved hypothetical protein [Vibrio mimicus VM573] Length = 105 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + ++KA DI ++ +S + D M++ +G S +HVASIAD++ + K Sbjct: 4 EALKDFLSDKADDMKAVDIVTLDV-QGKSSVTDYMIVCTGTSKRHVASIADHVANEAK 60 >gi|89900864|ref|YP_523335.1| Iojap-like protein [Rhodoferax ferrireducens T118] gi|89345601|gb|ABD69804.1| Iojap-related protein [Rhodoferax ferrireducens T118] Length = 261 Score = 70.5 bits (172), Expect = 7e-11, Method: Composition-based stats. Identities = 13/72 (18%), Positives = 34/72 (47%), Gaps = 1/72 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 T + + +++ L+++KA+DI + T S + + ++I SG S + Sbjct: 2 TTTTFSTIAKKDIQKLQRAIVDGLEDVKAQDIVVFD-TEHLSALFERVIIASGTSNRQTK 60 Query: 64 SIADNLISYLKK 75 ++A ++ ++ Sbjct: 61 ALAASVRDAVRD 72 >gi|253990634|ref|YP_003041990.1| hypothetical protein PAU_03160 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253782084|emb|CAQ85248.1| conserved hypothetical protein [Photorhabdus asymbiotica] Length = 108 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ L++ KA+DI + +S I D M+I +G S +H+ S+ADNL+ + Sbjct: 7 RELQQFVIDKLEDSKAQDIVSLNV-HGKSSITDCMIICTGTSNRHLMSVADNLVGDCR 63 >gi|307130046|ref|YP_003882062.1| hypothetical protein Dda3937_02481 [Dickeya dadantii 3937] gi|306527575|gb|ADM97505.1| predicted protein [Dickeya dadantii 3937] Length = 105 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI + +S I D M+I +G S++HV SIAD+++ Sbjct: 4 QALQDFVIDKLDDLKGQDIVALNV-KGKSSITDCMIICTGTSSRHVTSIADHVVQE 58 >gi|289424021|ref|ZP_06425810.1| iojap family protein [Peptostreptococcus anaerobius 653-L] gi|289155596|gb|EFD04272.1| iojap family protein [Peptostreptococcus anaerobius 653-L] Length = 117 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++S +A + + + + +DI + S +CD VI +G S++ V +IAD++ Sbjct: 1 METVESILAKIYDAIDDKIGQDIVILNIGK-VSSLCDYFVIATGSSSRQVKAIADSVEDE 59 Query: 73 LKKKN 77 + K + Sbjct: 60 MTKID 64 >gi|222087885|ref|YP_002546423.1| hypothetical protein Arad_4887 [Agrobacterium radiobacter K84] gi|221725333|gb|ACM28489.1| conserved hypothetical protein [Agrobacterium radiobacter K84] Length = 148 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 40/63 (63%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + V+ L++ KAE+I I+ +S + D+MV+VSGRS +HV +IAD+L + L Sbjct: 34 DAAARALQAVLVSLEDSKAENIVTIDIA-GKSALGDHMVVVSGRSNRHVLAIADHLTTDL 92 Query: 74 KKK 76 K + Sbjct: 93 KDE 95 >gi|319789103|ref|YP_004150736.1| iojap-like protein [Thermovibrio ammonificans HB-1] gi|317113605|gb|ADU96095.1| iojap-like protein [Thermovibrio ammonificans HB-1] Length = 120 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ + KAED I+ + I D +IV+ S H +IA+ + LK Sbjct: 2 DSSEKLKLALQTALDKKAEDPVVIDLR-GLTSIADYFLIVTASSDTHARTIAEEIKRKLK 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|260774876|ref|ZP_05883777.1| hypothetical protein VIC_000247 [Vibrio coralliilyticus ATCC BAA-450] gi|260609131|gb|EEX35289.1| hypothetical protein VIC_000247 [Vibrio coralliilyticus ATCC BAA-450] Length = 105 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L+ +++ ++KA+DI ++ +S I D M+I +G S +HVASIA+++ K Sbjct: 2 QLEELNDFLVDKADDMKAQDIKTLDV-QGKSSITDYMIICTGTSKRHVASIAEHVAKESK 60 >gi|327191260|gb|EGE58303.1| hypothetical protein RHECNPAF_33400107 [Rhizobium etli CNPAF512] Length = 147 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 24/53 (45%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 V+ L++ KAEDI I+ +S + D MV+VSGRS +HV +I+D+L++ LK Sbjct: 42 VLASLEDSKAEDIVTIDIA-GKSALGDYMVVVSGRSNRHVMAISDHLLTDLKD 93 >gi|300722319|ref|YP_003711604.1| hypothetical protein XNC1_1334 [Xenorhabdus nematophila ATCC 19061] gi|297628821|emb|CBJ89399.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061] Length = 105 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 V++ L++ KA+DI I+ +S I D MVI +G S +H+ S+A NL+ ++ Sbjct: 5 ELQQFVIDKLEDSKAQDIVSIDVR-GKSNITDCMVICTGTSNRHLMSVAHNLVDDCRE 61 >gi|269139987|ref|YP_003296688.1| hypothetical protein ETAE_2642 [Edwardsiella tarda EIB202] gi|267985648|gb|ACY85477.1| hypothetical protein ETAE_2642 [Edwardsiella tarda EIB202] gi|304559820|gb|ADM42484.1| Iojap-related protein [Edwardsiella tarda FL6-60] Length = 105 Score = 70.5 bits (172), Expect = 8e-11, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI I+ +S I D M+I +G S++HV +IAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIVAIDVC-GKSSITDCMIICTGTSSRHVIAIADHVVQ 57 >gi|229543787|ref|ZP_04432847.1| iojap-like protein [Bacillus coagulans 36D1] gi|229328207|gb|EEN93882.1| iojap-like protein [Bacillus coagulans 36D1] Length = 117 Score = 70.1 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + TV++ + +AEDI ++ SLI D +I +G S K + +IA + + Sbjct: 2 DNQTLLKTVVKACDDKRAEDIVVLDMR-GISLIADYFLICNGNSDKQIQAIAREVKEKAE 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|163755773|ref|ZP_02162891.1| hypothetical protein KAOT1_22276 [Kordia algicida OT-1] gi|161324294|gb|EDP95625.1| hypothetical protein KAOT1_22276 [Kordia algicida OT-1] Length = 123 Score = 70.1 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 34/68 (50%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 +T D I +++ ++E+K DI ++ + + +CD +I +G S V +I + Sbjct: 1 MTKTKVSTDQLITGIIKGIEEVKGNDITILDLREIDNTVCDYFIICNGTSNTQVNAIVGS 60 Query: 69 LISYLKKK 76 + + K+ Sbjct: 61 VQKMVSKE 68 >gi|16330295|ref|NP_441023.1| iojap protein [Synechocystis sp. PCC 6803] gi|1652784|dbj|BAA17703.1| putative iojap protein [Synechocystis sp. PCC 6803] Length = 154 Score = 70.1 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 A + + T+ + +E KA D+ ++ T S + D VI +G S V +IADN+ Sbjct: 24 APATEHLVWTIAQAAEERKAGDLVILKVTD-VSYLADYFVICTGFSRTQVRAIADNIEKQ 82 Query: 73 L 73 + Sbjct: 83 V 83 >gi|329117583|ref|ZP_08246300.1| iojap-like protein [Streptococcus parauberis NCFD 2020] gi|326907988|gb|EGE54902.1| iojap-like protein [Streptococcus parauberis NCFD 2020] Length = 117 Score = 70.1 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + E +AEDI ++ + + D +I S +T+ + +IA+N+ +K+ Sbjct: 4 EELLELAAKAADEKRAEDILALDL-EGLTSLTDYFLIASATNTRQLEAIAENIREKVKE 61 >gi|242238540|ref|YP_002986721.1| hypothetical protein Dd703_1094 [Dickeya dadantii Ech703] gi|242130597|gb|ACS84899.1| iojap-like protein [Dickeya dadantii Ech703] Length = 105 Score = 70.1 bits (171), Expect = 8e-11, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 QALQDFVIDKIDDLKGQDIVALDV-KGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|303241830|ref|ZP_07328325.1| iojap-like protein [Acetivibrio cellulolyticus CD2] gi|302590605|gb|EFL60358.1| iojap-like protein [Acetivibrio cellulolyticus CD2] Length = 111 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + E L + KA+D+ I+ + ++I D VI SG ST H+ ++AD + +K Sbjct: 2 DSNIIAQKIAEILTDKKAKDVRSIDISE-VTVIADYFVICSGTSTTHIKALADEVEQKMK 60 Query: 75 KKN 77 ++N Sbjct: 61 EQN 63 >gi|294637507|ref|ZP_06715793.1| iojap family protein [Edwardsiella tarda ATCC 23685] gi|291089339|gb|EFE21900.1| iojap family protein [Edwardsiella tarda ATCC 23685] Length = 105 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK ++I I+ +S I D M+I +G S +HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQEIVAIDVC-GKSSITDCMIICTGTSNRHVMSIADHVVQA 58 >gi|238755061|ref|ZP_04616409.1| hypothetical protein yruck0001_21400 [Yersinia ruckeri ATCC 29473] gi|238706765|gb|EEP99134.1| hypothetical protein yruck0001_21400 [Yersinia ruckeri ATCC 29473] Length = 105 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ L +LK +DI I+ +S I D M+I +G ST+HV ++ADNL+ +K Sbjct: 4 KALQEFVIDKLDDLKGQDILSIDV-KGKSSITDCMIICTGTSTRHVMALADNLVQESRK 61 >gi|121594261|ref|YP_986157.1| iojap-like protein [Acidovorax sp. JS42] gi|120606341|gb|ABM42081.1| iojap-like protein [Acidovorax sp. JS42] Length = 274 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 13/74 (17%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+++KA+DI T S + + +V+ +G S + Sbjct: 1 MTTSSKSETAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVVVATGSSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ ++K Sbjct: 60 TKALAASVRDAVRK 73 >gi|319407615|emb|CBI81265.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 120 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++ L+++KAEDI I+ RS + D MVI SG S +HV +I D L+S K+ Sbjct: 7 LKIILSSLEDIKAEDIISIDLR-GRSSLADYMVIASGCSQRHVLAITDRLLSVWKE 61 >gi|153003105|ref|YP_001377430.1| iojap-like protein [Anaeromyxobacter sp. Fw109-5] gi|152026678|gb|ABS24446.1| iojap-like protein [Anaeromyxobacter sp. Fw109-5] Length = 191 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 DH + + KAE++ ++ + D V+++ S + ++IAD++ + Sbjct: 78 DHARPTALAIAHAGLDKKAEEVTVLDVR-GLTSYADYFVVMTADSDRQASAIADHVEQTM 136 Query: 74 KKK 76 K + Sbjct: 137 KAQ 139 >gi|293397306|ref|ZP_06641578.1| Iojap family protein [Serratia odorifera DSM 4582] gi|291420224|gb|EFE93481.1| Iojap family protein [Serratia odorifera DSM 4582] Length = 118 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V++ + +LK +DI ++ +S I D M+I +G ST+HV SIA++++ + + Sbjct: 17 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSTRHVMSIANHVVQESRAQ 75 >gi|70732759|ref|YP_262522.1| iojap domain-containing protein [Pseudomonas fluorescens Pf-5] gi|68347058|gb|AAY94664.1| iojap domain protein [Pseudomonas fluorescens Pf-5] Length = 140 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 33/68 (48%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + L+++KA+D+ I+ +S I D M+I +G S + + ++ + Sbjct: 1 MTNQVMKGEDLVKVAVAALEDVKAQDVLVIDVRDKQS-ITDYMIIATGTSNRQIGAMLEK 59 Query: 69 LISYLKKK 76 + +K + Sbjct: 60 VREMVKAQ 67 >gi|325266610|ref|ZP_08133287.1| Iojap family protein [Kingella denitrificans ATCC 33394] gi|324982053|gb|EGC17688.1| Iojap family protein [Kingella denitrificans ATCC 33394] Length = 131 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q + + + L+++KA+DI ++ + ++ + M+I SG ST+ V ++A+N+ Sbjct: 5 QELQAIQKMVDIAVNALEDVKAKDIIVLDTSE-KTSLFSRMIIASGDSTRQVKALANNVA 63 Query: 71 SYLKK 75 LK+ Sbjct: 64 VDLKE 68 >gi|82701495|ref|YP_411061.1| Iojap-related protein [Nitrosospira multiformis ATCC 25196] gi|82409560|gb|ABB73669.1| Iojap-related protein [Nitrosospira multiformis ATCC 25196] Length = 158 Score = 70.1 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I TV+ L E+KA D+ ++ + + D M+I SG ST+ +IA+N++ +K Sbjct: 5 KLIKTVVAALDEIKARDVEVLDVKK-LTALFDRMIIASGDSTRQTRAIANNVVEKVK 60 >gi|238790767|ref|ZP_04634526.1| hypothetical protein yfred0001_12760 [Yersinia frederiksenii ATCC 33641] gi|238721125|gb|EEQ12806.1| hypothetical protein yfred0001_12760 [Yersinia frederiksenii ATCC 33641] Length = 105 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L +LK +DI ++ +S I D M+I +G ST+HV ++ADNL+ Sbjct: 4 KALQEFVIDKLDDLKGQDIIALDV-QGKSSITDCMIICTGTSTRHVMALADNLVQE 58 >gi|332523701|ref|ZP_08399953.1| iojap-like protein [Streptococcus porcinus str. Jelinkova 176] gi|332314965|gb|EGJ27950.1| iojap-like protein [Streptococcus porcinus str. Jelinkova 176] Length = 117 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI S +++ + +IADN+ +K+ Sbjct: 4 EELLNIVVKAADEKRAEDILALDL-EGLTSLTDYFVITSATNSRQLEAIADNIREKVKE 61 >gi|163793767|ref|ZP_02187741.1| iojap-like protein [alpha proteobacterium BAL199] gi|159180878|gb|EDP65395.1| iojap-like protein [alpha proteobacterium BAL199] Length = 120 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + L + KAEDI I+ + +S I D+MVI +GRS + VA++AD+L+S LK K Sbjct: 3 KSLDDDKAEDIVAIDLAN-KSSIGDHMVIATGRSARQVAAMADHLVSKLKDK 53 >gi|319408137|emb|CBI81790.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 147 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++ L+ KAEDI I+ +S + D +VI S RS +HV++IAD+L+S K Sbjct: 34 LKIILNSLENAKAEDIVSIDI-QGKSSLADYIVIASARSQRHVSAIADHLLSTWKD 88 >gi|258516439|ref|YP_003192661.1| iojap-like protein [Desulfotomaculum acetoxidans DSM 771] gi|257780144|gb|ACV64038.1| iojap-like protein [Desulfotomaculum acetoxidans DSM 771] Length = 115 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +++ ++ KA + ++ + + S I D VI SGRS HV +I +N+ L ++ Sbjct: 6 QELTDLIIDACEDKKAYGVTVLDISEI-STIADYFVICSGRSKPHVQAIVENIQEKLGER 64 >gi|289675741|ref|ZP_06496631.1| iojap domain-containing protein [Pseudomonas syringae pv. syringae FF5] gi|330938290|gb|EGH41943.1| iojap domain-containing protein [Pseudomonas syringae pv. pisi str. 1704B] gi|330976826|gb|EGH76858.1| iojap domain-containing protein [Pseudomonas syringae pv. aptata str. DSM 50252] Length = 128 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + I + L+E+K DI I+ ++ I D M+I +G S + + ++ DN Sbjct: 1 MTKQKMSSEDVINVAIAALEEVKGADILTIDVRD-KTSIADYMLICTGTSNRQLNALVDN 59 Query: 69 LISYLK 74 + +K Sbjct: 60 VRDKVK 65 >gi|118594492|ref|ZP_01551839.1| hypothetical protein MB2181_02450 [Methylophilales bacterium HTCC2181] gi|118440270|gb|EAV46897.1| hypothetical protein MB2181_02450 [Methylophilales bacterium HTCC2181] Length = 108 Score = 70.1 bits (171), Expect = 1e-10, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + V++ L+++KA DI ++ + I D M+I S S++ ++A+N+ Sbjct: 1 MTSVSTIKKNVIDALEDIKAFDIIALDVRK-LTSIADYMIIASASSSRQTKALANNVQDK 59 Query: 73 LKKKN 77 +K+ N Sbjct: 60 MKEIN 64 >gi|300021744|ref|YP_003754355.1| iojap-like protein [Hyphomicrobium denitrificans ATCC 51888] gi|299523565|gb|ADJ22034.1| iojap-like protein [Hyphomicrobium denitrificans ATCC 51888] Length = 142 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 +++ Q+ A + + V+ L + KAE+I I +S + D MV+ SGR+ +HV Sbjct: 13 SSQAQSAAKAPDAAALLEDVVHWLDDAKAEEIVSIPL-KGKSSLGDFMVVASGRNDRHVG 71 Query: 64 SIADNLISYLK 74 +IA+ L LK Sbjct: 72 AIAEQLRDKLK 82 >gi|120437030|ref|YP_862716.1| hypothetical protein GFO_2693 [Gramella forsetii KT0803] gi|117579180|emb|CAL67649.1| protein containing DUF143 [Gramella forsetii KT0803] Length = 123 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 35/67 (52%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + D IA +++ ++E+K DI ++ + + +CD +I +G S V +I ++ Sbjct: 1 MSKKEKNSDQLIAHIIKGIEEVKGNDISILDLREIENTVCDYFIICNGTSNTQVNAIVNS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 IQKTVSK 67 >gi|83942184|ref|ZP_00954646.1| iojap-related protein [Sulfitobacter sp. EE-36] gi|83953239|ref|ZP_00961961.1| iojap-related protein [Sulfitobacter sp. NAS-14.1] gi|83842207|gb|EAP81375.1| iojap-related protein [Sulfitobacter sp. NAS-14.1] gi|83848004|gb|EAP85879.1| iojap-related protein [Sulfitobacter sp. EE-36] Length = 122 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q D+ +A+++ L + KAE++ I+ ++ I D MV+ SGRS++ V++IA+ L Sbjct: 5 QNTATSDALLASILSQLDDDKAEEVVQIDLR-GKTAIGDYMVVCSGRSSRQVSAIAEKLA 63 Query: 71 SYLKK 75 +K Sbjct: 64 QMVKD 68 >gi|332886185|gb|EGK06429.1| iojap protein 155 [Dysgonomonas mossii DSM 22836] Length = 119 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 35/64 (54%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + S + ++ +E KA++I ++ T L IC VI G + V++I++ ++ Y Sbjct: 1 MKEVKSLVNNIVAACQEKKAKNIVIVDMTELPGTICQYFVICEGNTPIQVSAISEEIVDY 60 Query: 73 LKKK 76 LKKK Sbjct: 61 LKKK 64 >gi|261341259|ref|ZP_05969117.1| iojap family protein [Enterobacter cancerogenus ATCC 35316] gi|288316563|gb|EFC55501.1| iojap family protein [Enterobacter cancerogenus ATCC 35316] Length = 105 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI I+ +S I D M+I +G ST+HVASIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIAIDV-KGKSSITDCMIICTGTSTRHVASIADHVVQE 58 >gi|228476031|ref|ZP_04060739.1| iojap homolog [Staphylococcus hominis SK119] gi|314936288|ref|ZP_07843635.1| iojap-like protein [Staphylococcus hominis subsp. hominis C80] gi|228269854|gb|EEK11334.1| iojap homolog [Staphylococcus hominis SK119] gi|313654907|gb|EFS18652.1| iojap-like protein [Staphylococcus hominis subsp. hominis C80] Length = 117 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ++ KAEDI + S + D V+ G + + V SIA + + Sbjct: 2 NSEELLNIAVTATEDKKAEDIVSLNM-QGISDMTDYFVVCHGNNERQVQSIARAVKEKVH 60 Query: 75 KKN 77 + N Sbjct: 61 ENN 63 >gi|254420979|ref|ZP_05034703.1| iojap family protein, putative [Brevundimonas sp. BAL3] gi|196187156|gb|EDX82132.1| iojap family protein, putative [Brevundimonas sp. BAL3] Length = 144 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ L E KA+++ I+ +S + D M++ SGRS +HV +IAD+L+ LK++ Sbjct: 35 LEEAILSRLDEDKAQEMVLIDL-KGKSAMADTMIVASGRSHRHVGAIADHLLRTLKEQ 91 >gi|222152538|ref|YP_002561713.1| hypothetical protein SUB0358 [Streptococcus uberis 0140J] gi|222113349|emb|CAR40954.1| conserved hypothetical protein [Streptococcus uberis 0140J] Length = 117 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + V++ E +AED + + + D VI S +++ + +IADN+ +K++ Sbjct: 4 EELLEIVVKAADEKRAEDTLALNL-EGITSLTDYFVITSATNSRQLEAIADNIREKVKEQ 62 >gi|150008467|ref|YP_001303210.1| hypothetical protein BDI_1853 [Parabacteroides distasonis ATCC 8503] gi|255014266|ref|ZP_05286392.1| hypothetical protein B2_10171 [Bacteroides sp. 2_1_7] gi|256841516|ref|ZP_05547023.1| conserved hypothetical protein [Parabacteroides sp. D13] gi|262383314|ref|ZP_06076450.1| iojap protein 155 [Bacteroides sp. 2_1_33B] gi|298376265|ref|ZP_06986221.1| iojap-like protein [Bacteroides sp. 3_1_19] gi|301309365|ref|ZP_07215307.1| iojap-like protein [Bacteroides sp. 20_3] gi|149936891|gb|ABR43588.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503] gi|256737359|gb|EEU50686.1| conserved hypothetical protein [Parabacteroides sp. D13] gi|262294212|gb|EEY82144.1| iojap protein 155 [Bacteroides sp. 2_1_33B] gi|298267302|gb|EFI08959.1| iojap-like protein [Bacteroides sp. 3_1_19] gi|300832454|gb|EFK63082.1| iojap-like protein [Bacteroides sp. 20_3] Length = 119 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 34/64 (53%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + T++E L+E + ++I ++ + IC MVI G + V++++D++ + Sbjct: 1 MDQTKELVKTIVEGLQEKRGKNIVTVDLSQTSGAICQYMVICEGNTPTQVSALSDSVWDF 60 Query: 73 LKKK 76 +K Sbjct: 61 ARKN 64 >gi|83949906|ref|ZP_00958639.1| iojap-related protein [Roseovarius nubinhibens ISM] gi|83837805|gb|EAP77101.1| iojap-related protein [Roseovarius nubinhibens ISM] Length = 120 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D+ +A V+ L + KAE+I ++ ++ I D+MVI SGRS++ V +IA+ L+ LK Sbjct: 8 DSDTQLARVLSSLSDDKAEEIVQVDLR-GKTAIGDHMVICSGRSSRQVTAIAEKLVERLK 66 Query: 75 KK 76 ++ Sbjct: 67 QE 68 >gi|222110899|ref|YP_002553163.1| iojap-like protein [Acidovorax ebreus TPSY] gi|221730343|gb|ACM33163.1| iojap-like protein [Acidovorax ebreus TPSY] Length = 262 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 13/74 (17%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+++KA+DI T S + + +V+ +G S + Sbjct: 1 MTTSSKSETAAKKDVTKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVVVATGSSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ ++K Sbjct: 60 TKALAASVRDAVRK 73 >gi|205374265|ref|ZP_03227064.1| YqeL [Bacillus coahuilensis m4-4] Length = 119 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + + + +AEDI ++ SLI D +I G S K V +IA + Sbjct: 1 MGDNNNLLNVAYKAADDKRAEDIVALDM-KGVSLISDYFIICHGNSDKQVQAIAKEVKEA 59 Query: 73 LKKK 76 ++ Sbjct: 60 AEEN 63 >gi|260063603|ref|YP_003196683.1| hypothetical protein RB2501_02315 [Robiginitalea biformata HTCC2501] gi|88783048|gb|EAR14221.1| hypothetical protein RB2501_02315 [Robiginitalea biformata HTCC2501] Length = 124 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 35/67 (52%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D IA ++ ++E+K DI ++ ++ + +CD VI +G S HV +I ++ Sbjct: 1 MTKREASADELIALILHGIEEVKGLDINLLDLRAIDNTVCDYFVICNGTSNTHVNAIVNS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 IQKTVSK 67 >gi|254483502|ref|ZP_05096729.1| iojap family protein [marine gamma proteobacterium HTCC2148] gi|214036223|gb|EEB76903.1| iojap family protein [marine gamma proteobacterium HTCC2148] Length = 113 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L +LKA + ++ T + + D +V+ SG S +HV S+A N+ K Sbjct: 2 QAEPLKKLVVDALDDLKAINTVTLDVT-GLTDVMDYLVVASGTSNRHVKSLASNVCMEAK 60 Query: 75 KK 76 K+ Sbjct: 61 KQ 62 >gi|149192418|ref|ZP_01870616.1| hypothetical protein VSAK1_08778 [Vibrio shilonii AK1] gi|148833747|gb|EDL50786.1| hypothetical protein VSAK1_08778 [Vibrio shilonii AK1] Length = 105 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + ++KA+DI I+ +S + D M++ +G S +HV SIAD++ S +KK Sbjct: 4 EELKLFLADKADDMKAQDIVTIDV-EGKSSVTDFMIVCTGTSKRHVISIADHVASEVKK 61 >gi|307544785|ref|YP_003897264.1| hypothetical protein HELO_2195 [Halomonas elongata DSM 2581] gi|307216809|emb|CBV42079.1| K09710 hypothetical protein [Halomonas elongata DSM 2581] Length = 135 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 40/62 (64%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 H+D+ VM+ L+ELKA DI ++ + + + + MV+ SG S +H+A++A+NLI K Sbjct: 14 HIDALKTLVMDALEELKARDIVQLDVSR-LTSVTELMVVASGTSNRHLAALAENLIRTAK 72 Query: 75 KK 76 + Sbjct: 73 EN 74 >gi|332521363|ref|ZP_08397819.1| iojap-like protein [Lacinutrix algicola 5H-3-7-4] gi|332043091|gb|EGI79289.1| iojap-like protein [Lacinutrix algicola 5H-3-7-4] Length = 123 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 35/68 (51%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ + D+ I T++ ++++K +DI ++ + + +CD +I G S V +I Sbjct: 1 MVKNQVNADALITTIISGIEDVKGKDINILDLRDIENTVCDYFIICEGTSNTQVNAIVSA 60 Query: 69 LISYLKKK 76 + + K+ Sbjct: 61 VQKKVSKE 68 >gi|262377429|ref|ZP_06070652.1| conserved hypothetical protein [Acinetobacter lwoffii SH145] gi|262307659|gb|EEY88799.1| conserved hypothetical protein [Acinetobacter lwoffii SH145] Length = 136 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Query: 3 ANTEKQALQTA-DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +N+ + + + C+ V L+++KA++I ++ S S + D MVI SG ST+H Sbjct: 10 SNSHDLTMNSNSQAVQDCLKVVHAALEDVKAKEIVELDV-SGISNVADAMVIASGTSTRH 68 Query: 62 VASIADNLISYLKK 75 + S+A+N+ +K Sbjct: 69 IKSLANNVAEEARK 82 >gi|188025728|ref|ZP_02959602.2| hypothetical protein PROSTU_01473 [Providencia stuartii ATCC 25827] gi|188020267|gb|EDU58307.1| hypothetical protein PROSTU_01473 [Providencia stuartii ATCC 25827] Length = 108 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ L + KAEDI I+ +S I D M+I +G S++H+ S+AD LI +K Sbjct: 8 ELQQFIINQLDDAKAEDIISIDV-HGKSSITDQMIICTGTSSRHLMSVADRLIEACRKN 65 >gi|55823521|ref|YP_141962.1| hypothetical protein str1617 [Streptococcus thermophilus CNRZ1066] gi|116628308|ref|YP_820927.1| hypothetical protein STER_1581 [Streptococcus thermophilus LMD-9] gi|55739506|gb|AAV63147.1| conserved hypothetical protein [Streptococcus thermophilus CNRZ1066] gi|116101585|gb|ABJ66731.1| Uncharacterized homolog of plant Iojap protein [Streptococcus thermophilus LMD-9] gi|312278932|gb|ADQ63589.1| Iojap-like protein [Streptococcus thermophilus ND03] Length = 117 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K+ Sbjct: 4 EELLELVVKAADEKRAEDIVALDLY-GLTSLTDYFVILSAMNSRQLEAIADNIREKVKE 61 >gi|258541474|ref|YP_003186907.1| hypothetical protein APA01_03760 [Acetobacter pasteurianus IFO 3283-01] gi|256632552|dbj|BAH98527.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-01] gi|256635609|dbj|BAI01578.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-03] gi|256638664|dbj|BAI04626.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-07] gi|256641718|dbj|BAI07673.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-22] gi|256644773|dbj|BAI10721.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-26] gi|256647828|dbj|BAI13769.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-32] gi|256650881|dbj|BAI16815.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-01-42C] gi|256653872|dbj|BAI19799.1| unknown function Iojap protein [Acetobacter pasteurianus IFO 3283-12] Length = 153 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T K+ D L+ +A + L++ KAEDI I+ R+ D MVI +G + + +++ Sbjct: 26 TTKREAVAPDMLEQSLALITASLEDDKAEDIVVIDLA-GRASFADRMVIATGLADRQISA 84 Query: 65 IADNLISYLKK 75 +A ++ L+ Sbjct: 85 MAQHIERKLRD 95 >gi|260597062|ref|YP_003209633.1| ribosome-associated protein [Cronobacter turicensis z3032] gi|260216239|emb|CBA29148.1| Uncharacterized protein ybeB [Cronobacter turicensis z3032] Length = 105 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI I+ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIAIDV-KGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|262380232|ref|ZP_06073387.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] gi|262298426|gb|EEY86340.1| conserved hypothetical protein [Acinetobacter radioresistens SH164] Length = 133 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + C+ V L ++KA+DI ++ +S+ S + D +VI SG ST+HV ++ADN Sbjct: 17 MNSQSQSVQECLKVVHNALTDVKAKDIIELDVSSI-SNVADAIVIASGTSTRHVKALADN 75 Query: 69 LISYLKK 75 + +K Sbjct: 76 VADEARK 82 >gi|192359651|ref|YP_001981295.1| iojap domain-containing protein [Cellvibrio japonicus Ueda107] gi|190685816|gb|ACE83494.1| iojap domain protein [Cellvibrio japonicus Ueda107] Length = 122 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++ L++LK ++I ++ S + D ++I SG S++H ++A+NL+ KK Sbjct: 13 MSDLNQAIINALEDLKGKNIVTLDVRE-LSDVMDTLIIASGTSSRHARALAENLVEDTKK 71 Query: 76 K 76 + Sbjct: 72 Q 72 >gi|328949805|ref|YP_004367140.1| iojap-like protein [Marinithermus hydrothermalis DSM 14884] gi|328450129|gb|AEB11030.1| iojap-like protein [Marinithermus hydrothermalis DSM 14884] Length = 117 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I V + L + KAE+I ++ + + D VI +G ST H+ ++ + L+ Sbjct: 6 EAVQIIRWVHQALSDKKAENIVALDLREVSDSL-DFFVIATGTSTPHLEALERAVRERLE 64 Query: 75 KK 76 ++ Sbjct: 65 EE 66 >gi|198284642|ref|YP_002220963.1| iojap-like protein [Acidithiobacillus ferrooxidans ATCC 53993] gi|218666039|ref|YP_002427316.1| iojap-related protein [Acidithiobacillus ferrooxidans ATCC 23270] gi|198249163|gb|ACH84756.1| iojap-like protein [Acidithiobacillus ferrooxidans ATCC 53993] gi|218518252|gb|ACK78838.1| iojap-related protein [Acidithiobacillus ferrooxidans ATCC 23270] Length = 118 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + L E KA DI I+ ++ I D ++I SG S +H+ ++AD +++ Sbjct: 1 MATAETLRDLAISVLDEHKALDIKSIDVRK-QTDITDYLIIASGTSDRHLRALADAVMAR 59 Query: 73 LKKK 76 ++++ Sbjct: 60 MREE 63 >gi|332665520|ref|YP_004448308.1| iojap-like protein [Haliscomenobacter hydrossis DSM 1100] gi|332334334|gb|AEE51435.1| iojap-like protein [Haliscomenobacter hydrossis DSM 1100] Length = 128 Score = 69.7 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 16/74 (21%), Positives = 35/74 (47%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 ++ K ++ + +++ ++E+K ++I ++ L D +I G ST Sbjct: 1 MSTQVKVKRRSKLVAEELTDLIVDSIQEIKGKNIVKLDLRLLEDAPTDFFIICEGTSTTQ 60 Query: 62 VASIADNLISYLKK 75 V I+DN+ LK+ Sbjct: 61 VKGISDNIQRRLKE 74 >gi|261405563|ref|YP_003241804.1| iojap-like protein [Paenibacillus sp. Y412MC10] gi|329925886|ref|ZP_08280596.1| iojap-like protein [Paenibacillus sp. HGF5] gi|261282026|gb|ACX63997.1| iojap-like protein [Paenibacillus sp. Y412MC10] gi|328939537|gb|EGG35886.1| iojap-like protein [Paenibacillus sp. HGF5] Length = 115 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + ++ KA DI ++ SLI D VI G S V +IA + + Sbjct: 6 NELLNVAVAAAEDKKAMDIVVLDLR-GISLIADYFVICHGNSDTQVQAIATEVRKRAHDE 64 >gi|55821593|ref|YP_140035.1| hypothetical protein stu1617 [Streptococcus thermophilus LMG 18311] gi|55737578|gb|AAV61220.1| conserved hypothetical protein [Streptococcus thermophilus LMG 18311] Length = 117 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K+ Sbjct: 4 EELLELVVKAADEKRAEDIVALDLY-GLTSLTDYFVILSAMNSRQLEAIADNIREKVKE 61 >gi|319406129|emb|CBI79759.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 150 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++ L+++KAEDI I+ RS + D MVI SG S +H+++I D L+S K+ Sbjct: 37 LKIILSSLEDIKAEDIVSIDL-QGRSSLADYMVIASGCSQRHISAITDRLLSVWKE 91 >gi|291522344|emb|CBK80637.1| iojap-related protein [Coprococcus catus GD/7] Length = 120 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L++ KA D+ I+ S+I D VI SG +T V ++AD++ Sbjct: 1 MNQSKEMTKLAIAALEDKKANDVRVIDIA-GVSVIADYFVIASGSNTNQVQAMADSVREA 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|297565204|ref|YP_003684176.1| iojap-like protein [Meiothermus silvanus DSM 9946] gi|296849653|gb|ADH62668.1| iojap-like protein [Meiothermus silvanus DSM 9946] Length = 113 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I + + L + KAE+I ++ S D V+ SG S H+ ++ + L+ Sbjct: 6 EAQTLIGWIRQALDDKKAENIVALDLR-GASESLDYFVVASGTSRPHLEALERAVRESLE 64 Query: 75 KKN 77 +++ Sbjct: 65 QRD 67 >gi|225077509|ref|ZP_03720708.1| hypothetical protein NEIFLAOT_02572 [Neisseria flavescens NRL30031/H210] gi|284799908|ref|ZP_05985183.2| iojap-like protein [Neisseria subflava NJ9703] gi|224951159|gb|EEG32368.1| hypothetical protein NEIFLAOT_02572 [Neisseria flavescens NRL30031/H210] gi|284796588|gb|EFC51935.1| iojap-like protein [Neisseria subflava NJ9703] Length = 139 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 ++ + Q L + + L+++KA+DI +E T ++ + M+I SG ST+ Sbjct: 6 ISTRKIMNEQELQDLQKMVEVAVNALEDIKAKDISVLE-TQDKTSLFARMIIASGDSTRQ 64 Query: 62 VASIADNLISYLKK 75 V ++A+N+ LK+ Sbjct: 65 VKALANNVAVDLKE 78 >gi|289450564|ref|YP_003475117.1| iojap-like protein [Clostridiales genomosp. BVAB3 str. UPII9-5] gi|289185111|gb|ADC91536.1| iojap-like protein [Clostridiales genomosp. BVAB3 str. UPII9-5] Length = 113 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D+ ++ L KA DI I+ T ++ + D +IVSG S HV S+AD + LK Sbjct: 2 QADTLKDIIVNILDAKKASDIECIDVTD-KTTLGDYFIIVSGTSVPHVKSLADEVEYKLK 60 Query: 75 K 75 + Sbjct: 61 Q 61 >gi|261880082|ref|ZP_06006509.1| conserved hypothetical protein [Prevotella bergensis DSM 17361] gi|270333237|gb|EFA44023.1| conserved hypothetical protein [Prevotella bergensis DSM 17361] Length = 160 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 32/65 (49%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + + T+ + ++ K +DI ++ + + I + VI G S+ V +IA+++ Sbjct: 41 SMTEATELVKTITKGIQNKKGQDIVVVDLSHIEGAIANYFVICQGSSSNQVEAIAESVGD 100 Query: 72 YLKKK 76 +++ Sbjct: 101 ICRRE 105 >gi|298369686|ref|ZP_06981003.1| iojap-like protein [Neisseria sp. oral taxon 014 str. F0314] gi|298282243|gb|EFI23731.1| iojap-like protein [Neisseria sp. oral taxon 014 str. F0314] Length = 130 Score = 69.3 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + T +E L ++KA++I +E T ++ + M+I SG S++ V ++A+N+ Sbjct: 4 QELQDLQKMVETAVEALDDIKADNISVLE-TQDKTSLFSRMIIASGDSSRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VSLKE 67 >gi|309700875|emb|CBJ00172.1| conserved hypothetical protein [Escherichia coli ETEC H10407] Length = 105 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V+E + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIEKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|15640968|ref|NP_230599.1| hypothetical protein VC0952 [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121591017|ref|ZP_01678334.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121729828|ref|ZP_01682261.1| conserved hypothetical protein [Vibrio cholerae V52] gi|147673275|ref|YP_001216426.1| hypothetical protein VC0395_A0475 [Vibrio cholerae O395] gi|153213849|ref|ZP_01949055.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|153823313|ref|ZP_01975980.1| conserved hypothetical protein [Vibrio cholerae B33] gi|153826122|ref|ZP_01978789.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|153830927|ref|ZP_01983594.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|183179690|ref|ZP_02957901.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|227081126|ref|YP_002809677.1| hypothetical protein VCM66_0908 [Vibrio cholerae M66-2] gi|229505447|ref|ZP_04394957.1| hypothetical protein VCF_000655 [Vibrio cholerae BX 330286] gi|229510883|ref|ZP_04400362.1| hypothetical protein VCE_002290 [Vibrio cholerae B33] gi|229512954|ref|ZP_04402420.1| hypothetical protein VCB_000597 [Vibrio cholerae TMA 21] gi|229518004|ref|ZP_04407448.1| hypothetical protein VCC_002028 [Vibrio cholerae RC9] gi|229523255|ref|ZP_04412662.1| hypothetical protein VIF_000111 [Vibrio cholerae TM 11079-80] gi|229525563|ref|ZP_04414968.1| hypothetical protein VCA_003195 [Vibrio cholerae bv. albensis VL426] gi|229529951|ref|ZP_04419341.1| hypothetical protein VCG_003057 [Vibrio cholerae 12129(1)] gi|229608466|ref|YP_002879114.1| hypothetical protein VCD_003384 [Vibrio cholerae MJ-1236] gi|254285623|ref|ZP_04960587.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|254848084|ref|ZP_05237434.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|255744736|ref|ZP_05418687.1| hypothetical protein VCH_001063 [Vibrio cholera CIRS 101] gi|262161130|ref|ZP_06030241.1| hypothetical protein VIG_002372 [Vibrio cholerae INDRE 91/1] gi|262168633|ref|ZP_06036328.1| hypothetical protein VIJ_001819 [Vibrio cholerae RC27] gi|262190526|ref|ZP_06048770.1| hypothetical protein VIH_000886 [Vibrio cholerae CT 5369-93] gi|297581332|ref|ZP_06943256.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|298498931|ref|ZP_07008738.1| iojap protein [Vibrio cholerae MAK 757] gi|9655411|gb|AAF94114.1| conserved hypothetical protein [Vibrio cholerae O1 biovar El Tor str. N16961] gi|121547127|gb|EAX57259.1| conserved hypothetical protein [Vibrio cholerae 2740-80] gi|121628432|gb|EAX60926.1| conserved hypothetical protein [Vibrio cholerae V52] gi|124115683|gb|EAY34503.1| conserved hypothetical protein [Vibrio cholerae 1587] gi|126519177|gb|EAZ76400.1| conserved hypothetical protein [Vibrio cholerae B33] gi|146315158|gb|ABQ19697.1| conserved hypothetical protein [Vibrio cholerae O395] gi|148873582|gb|EDL71717.1| conserved hypothetical protein [Vibrio cholerae 623-39] gi|149740145|gb|EDM54304.1| conserved hypothetical protein [Vibrio cholerae MZO-2] gi|150424485|gb|EDN16422.1| conserved hypothetical protein [Vibrio cholerae AM-19226] gi|183013101|gb|EDT88401.1| conserved hypothetical protein [Vibrio cholerae MZO-3] gi|227009014|gb|ACP05226.1| conserved hypothetical protein [Vibrio cholerae M66-2] gi|227012769|gb|ACP08979.1| conserved hypothetical protein [Vibrio cholerae O395] gi|229333725|gb|EEN99211.1| hypothetical protein VCG_003057 [Vibrio cholerae 12129(1)] gi|229339144|gb|EEO04161.1| hypothetical protein VCA_003195 [Vibrio cholerae bv. albensis VL426] gi|229339618|gb|EEO04633.1| hypothetical protein VIF_000111 [Vibrio cholerae TM 11079-80] gi|229344719|gb|EEO09693.1| hypothetical protein VCC_002028 [Vibrio cholerae RC9] gi|229349847|gb|EEO14801.1| hypothetical protein VCB_000597 [Vibrio cholerae TMA 21] gi|229350848|gb|EEO15789.1| hypothetical protein VCE_002290 [Vibrio cholerae B33] gi|229357670|gb|EEO22587.1| hypothetical protein VCF_000655 [Vibrio cholerae BX 330286] gi|229371121|gb|ACQ61544.1| hypothetical protein VCD_003384 [Vibrio cholerae MJ-1236] gi|254843789|gb|EET22203.1| conserved hypothetical protein [Vibrio cholerae MO10] gi|255737767|gb|EET93161.1| hypothetical protein VCH_001063 [Vibrio cholera CIRS 101] gi|262022751|gb|EEY41457.1| hypothetical protein VIJ_001819 [Vibrio cholerae RC27] gi|262028880|gb|EEY47533.1| hypothetical protein VIG_002372 [Vibrio cholerae INDRE 91/1] gi|262033599|gb|EEY52093.1| hypothetical protein VIH_000886 [Vibrio cholerae CT 5369-93] gi|297534648|gb|EFH73485.1| conserved hypothetical protein [Vibrio cholerae RC385] gi|297543264|gb|EFH79314.1| iojap protein [Vibrio cholerae MAK 757] gi|327483678|gb|AEA78085.1| Iojap protein [Vibrio cholerae LMA3894-4] Length = 105 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + ++KA DI ++ +S + D M++ +G S +HVASIA+++ + K Sbjct: 4 EALKDFLFDKADDMKAVDIVTLDVKE-KSSVTDYMIVCTGTSKRHVASIAEHVANEAK 60 >gi|325498183|gb|EGC96042.1| hypothetical protein ECD227_2280 [Escherichia fergusonii ECD227] Length = 113 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 12 KALQDFVIDKIDDLKGQDIITLDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 66 >gi|262374286|ref|ZP_06067562.1| conserved hypothetical protein [Acinetobacter junii SH205] gi|262310844|gb|EEY91932.1| conserved hypothetical protein [Acinetobacter junii SH205] Length = 132 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 25/74 (33%), Positives = 46/74 (62%), Gaps = 2/74 (2%) Query: 3 ANTEKQALQ-TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +N+ +Q + + +C+ V E L ++KA+DI ++ +S+ S + D +VI SG ST+H Sbjct: 10 SNSHDLKIQPSNKDVQACLKVVHEALADVKAKDILELDVSSI-SNVADAIVIASGTSTRH 68 Query: 62 VASIADNLISYLKK 75 V ++ADN+ +K Sbjct: 69 VKALADNVADEARK 82 >gi|166031862|ref|ZP_02234691.1| hypothetical protein DORFOR_01563 [Dorea formicigenerans ATCC 27755] gi|166028315|gb|EDR47072.1| hypothetical protein DORFOR_01563 [Dorea formicigenerans ATCC 27755] Length = 146 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L E K EDI I+ S S+I D VI +G S V ++ DN+ Sbjct: 30 MNQALEMARVAYQALDEKKGEDIRVIDI-SGISVIGDYFVITNGTSDSQVRALVDNVEEK 88 Query: 73 LKK 75 + K Sbjct: 89 MHK 91 >gi|26991489|ref|NP_746914.1| iojap-like protein [Pseudomonas putida KT2440] gi|167035851|ref|YP_001671082.1| iojap-like protein [Pseudomonas putida GB-1] gi|325276738|ref|ZP_08142453.1| iojap-like protein [Pseudomonas sp. TJI-51] gi|24986568|gb|AAN70378.1|AE016679_10 conserved hypothetical protein [Pseudomonas putida KT2440] gi|166862339|gb|ABZ00747.1| iojap-like protein [Pseudomonas putida GB-1] gi|313500788|gb|ADR62154.1| Iojap-like protein [Pseudomonas putida BIRD-1] gi|324098121|gb|EGB96252.1| iojap-like protein [Pseudomonas sp. TJI-51] Length = 139 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +A L+++KA+DI I+ + + D M+I +G S + + ++A+ + +K K Sbjct: 9 EELVAVTKAALEDVKAQDIQVIDVRE-KHSLTDYMIIATGTSNRQINAMAEKVREAVKAK 67 >gi|254181241|ref|ZP_04887838.1| iojap protein [Burkholderia pseudomallei 1655] gi|184211779|gb|EDU08822.1| iojap protein [Burkholderia pseudomallei 1655] Length = 154 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI TS + + D +++ SG S + ++A N+ +K Sbjct: 2 DIRKLQRVIVDALEDVKAQDIKVFN-TSHLTELFDRVIVASGTSNRQTKALASNVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|296114651|ref|ZP_06833304.1| iojap-like protein [Gluconacetobacter hansenii ATCC 23769] gi|295979007|gb|EFG85732.1| iojap-like protein [Gluconacetobacter hansenii ATCC 23769] Length = 180 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 15/73 (20%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 A +E++ +++ + + L + K EDI ++ R+ D MVI +G + + + Sbjct: 50 AASEQREPVIDPMVETYLDIITNSLSDDKGEDIVVLDLR-GRAAFADRMVIATGVADRQI 108 Query: 63 ASIADNLISYLKK 75 +++A ++ L++ Sbjct: 109 SAMASHIERKLRE 121 >gi|317047298|ref|YP_004114946.1| iojap-like protein [Pantoea sp. At-9b] gi|316948915|gb|ADU68390.1| iojap-like protein [Pantoea sp. At-9b] Length = 105 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G ST+HV SIAD+++ Sbjct: 4 KALQEFVIDKIDDLKGQDIVALDV-QGKSSITDCMIICTGTSTRHVTSIADHVMQE 58 >gi|134300355|ref|YP_001113851.1| iojap-like protein [Desulfotomaculum reducens MI-1] gi|134053055|gb|ABO51026.1| iojap-like protein [Desulfotomaculum reducens MI-1] Length = 118 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + E KA DI ++ + + S+ICD +I +GRS+ V S+A+++ LK+ Sbjct: 6 KEIVDIAHQAANEKKALDITVLDISKI-SIICDYFLICTGRSSTQVQSVAEHIEEKLKE 63 >gi|294672832|ref|YP_003573448.1| iojap-like protein [Prevotella ruminicola 23] gi|294473299|gb|ADE82688.1| iojap-like protein [Prevotella ruminicola 23] Length = 116 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + T+ + ++E K DI + T + IC +I +G S V +IA+++ +++ Sbjct: 1 MIQLVETIKDAIQEKKGCDIVVADLTKIEGTICQYFIICTGNSPTQVEAIAESVGDMVRE 60 Query: 76 K 76 + Sbjct: 61 Q 61 >gi|323702367|ref|ZP_08114032.1| iojap-like protein [Desulfotomaculum nigrificans DSM 574] gi|323532673|gb|EGB22547.1| iojap-like protein [Desulfotomaculum nigrificans DSM 574] Length = 118 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + KA+DI ++ + + S+ICD +I +G S V S+A+++ L++ Sbjct: 6 KEIVDIAHQAADDKKAKDITVLDISHI-SIICDYFLICTGGSRTQVQSVAEHIEEKLEE 63 >gi|88802373|ref|ZP_01117900.1| hypothetical protein PI23P_07285 [Polaribacter irgensii 23-P] gi|88781231|gb|EAR12409.1| hypothetical protein PI23P_07285 [Polaribacter irgensii 23-P] Length = 122 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 35/68 (51%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D IA + + ++E+K E+I ++ + + +CD +I SG S V +I+ + Sbjct: 1 MTKKQVSADDLIAVIFQGIEEVKGENIQLLDLRDIENTVCDYFIICSGNSNTQVKAISGS 60 Query: 69 LISYLKKK 76 + + K+ Sbjct: 61 IQKTVSKQ 68 >gi|255505323|ref|ZP_05345441.3| iojap-like protein [Bryantella formatexigens DSM 14469] gi|255268334|gb|EET61539.1| iojap-like protein [Bryantella formatexigens DSM 14469] Length = 137 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + E++ + + + + L++ KAED+ I+ T S++ D VI SG + Sbjct: 10 IKQKERREVMDLTKSKTMVKLAVAALEDKKAEDVKIIDITE-VSVLADYFVIASGMNKNQ 68 Query: 62 VASIADNLISYLKK 75 V ++ DN+ L K Sbjct: 69 VQALVDNVEETLGK 82 >gi|160898963|ref|YP_001564545.1| iojap-like protein [Delftia acidovorans SPH-1] gi|160364547|gb|ABX36160.1| iojap-like protein [Delftia acidovorans SPH-1] Length = 261 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 12/74 (16%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K + +++ L+ +KA+DI T S + + +++ +G S + Sbjct: 1 MTTSTKSDSAAKRDVTKLQRAIVDGLENVKAQDIQVFN-TEKLSPLFERVIVAAGTSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +K+ Sbjct: 60 TKALASSVRDAVKQ 73 >gi|331005779|ref|ZP_08329138.1| Iojap-like protein [gamma proteobacterium IMCC1989] gi|330420416|gb|EGG94723.1| Iojap-like protein [gamma proteobacterium IMCC1989] Length = 119 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ E L ++KA+D+ ++ TS S + D+++I +G S +HV S+A N++ LKK Sbjct: 2 IENVSRLAAEALDDMKAQDVVTLDVTS-LSEVMDDLIIATGTSNRHVKSLAANVVDELKK 60 Query: 76 K 76 + Sbjct: 61 Q 61 >gi|311280458|ref|YP_003942689.1| iojap-like protein [Enterobacter cloacae SCF1] gi|308749653|gb|ADO49405.1| iojap-like protein [Enterobacter cloacae SCF1] Length = 105 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D MVI +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMVICTGTSSRHVMSIADHVVQA 58 >gi|237730621|ref|ZP_04561102.1| conserved hypothetical protein [Citrobacter sp. 30_2] gi|283834057|ref|ZP_06353798.1| iojap family protein [Citrobacter youngae ATCC 29220] gi|226906160|gb|EEH92078.1| conserved hypothetical protein [Citrobacter sp. 30_2] gi|291070200|gb|EFE08309.1| iojap family protein [Citrobacter youngae ATCC 29220] Length = 105 Score = 69.3 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|26246618|ref|NP_752658.1| hypothetical protein c0728 [Escherichia coli CFT073] gi|38703886|ref|NP_308702.2| hypothetical protein ECs0675 [Escherichia coli O157:H7 str. Sakai] gi|89107506|ref|AP_001286.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110] gi|90111157|ref|NP_415170.4| ribosome-associated protein [Escherichia coli str. K-12 substr. MG1655] gi|91209684|ref|YP_539670.1| hypothetical protein UTI89_C0639 [Escherichia coli UTI89] gi|110640866|ref|YP_668594.1| hypothetical protein ECP_0667 [Escherichia coli 536] gi|157157914|ref|YP_001461805.1| hypothetical protein EcE24377A_0663 [Escherichia coli E24377A] gi|157160132|ref|YP_001457450.1| hypothetical protein EcHS_A0689 [Escherichia coli HS] gi|168758281|ref|ZP_02783288.1| iojap family protein [Escherichia coli O157:H7 str. EC4401] gi|168779129|ref|ZP_02804136.1| iojap family protein [Escherichia coli O157:H7 str. EC4076] gi|168786487|ref|ZP_02811494.1| iojap family protein [Escherichia coli O157:H7 str. EC869] gi|168802452|ref|ZP_02827459.1| iojap family protein [Escherichia coli O157:H7 str. EC508] gi|170021006|ref|YP_001725960.1| hypothetical protein EcolC_3008 [Escherichia coli ATCC 8739] gi|170080216|ref|YP_001729536.1| hypothetical protein ECDH10B_0598 [Escherichia coli str. K-12 substr. DH10B] gi|170080317|ref|YP_001729637.1| hypothetical protein ECDH10B_0706 [Escherichia coli str. K-12 substr. DH10B] gi|170681282|ref|YP_001742753.1| hypothetical protein EcSMS35_0657 [Escherichia coli SMS-3-5] gi|187733333|ref|YP_001879352.1| hypothetical protein SbBS512_E0614 [Shigella boydii CDC 3083-94] gi|188494352|ref|ZP_03001622.1| iojap protein family [Escherichia coli 53638] gi|193063374|ref|ZP_03044464.1| iojap family protein [Escherichia coli E22] gi|195939376|ref|ZP_03084758.1| hypothetical protein EscherichcoliO157_23644 [Escherichia coli O157:H7 str. EC4024] gi|208807307|ref|ZP_03249644.1| iojap family protein [Escherichia coli O157:H7 str. EC4206] gi|208815004|ref|ZP_03256183.1| iojap family protein [Escherichia coli O157:H7 str. EC4045] gi|208823050|ref|ZP_03263368.1| iojap family protein [Escherichia coli O157:H7 str. EC4042] gi|209397396|ref|YP_002269273.1| iojap family protein [Escherichia coli O157:H7 str. EC4115] gi|209917896|ref|YP_002291980.1| hypothetical protein ECSE_0705 [Escherichia coli SE11] gi|215485677|ref|YP_002328108.1| hypothetical protein E2348C_0537 [Escherichia coli O127:H6 str. E2348/69] gi|217324290|ref|ZP_03440374.1| iojap family protein [Escherichia coli O157:H7 str. TW14588] gi|218553179|ref|YP_002386092.1| hypothetical protein ECIAI1_0621 [Escherichia coli IAI1] gi|218557575|ref|YP_002390488.1| hypothetical protein ECS88_0679 [Escherichia coli S88] gi|218688460|ref|YP_002396672.1| hypothetical protein ECED1_0634 [Escherichia coli ED1a] gi|218694077|ref|YP_002401744.1| hypothetical protein EC55989_0629 [Escherichia coli 55989] gi|218699009|ref|YP_002406638.1| hypothetical protein ECIAI39_0612 [Escherichia coli IAI39] gi|218703971|ref|YP_002411490.1| hypothetical protein ECUMN_0731 [Escherichia coli UMN026] gi|227884383|ref|ZP_04002188.1| iojap family protein [Escherichia coli 83972] gi|237707389|ref|ZP_04537870.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|238899914|ref|YP_002925710.1| hypothetical protein BWG_0508 [Escherichia coli BW2952] gi|253774377|ref|YP_003037208.1| hypothetical protein ECBD_3014 [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254160719|ref|YP_003043827.1| hypothetical protein ECB_00606 [Escherichia coli B str. REL606] gi|254791803|ref|YP_003076640.1| hypothetical protein ECSP_0690 [Escherichia coli O157:H7 str. TW14359] gi|256020589|ref|ZP_05434454.1| hypothetical protein ShiD9_16856 [Shigella sp. D9] gi|256023751|ref|ZP_05437616.1| hypothetical protein E4_10272 [Escherichia sp. 4_1_40B] gi|260842863|ref|YP_003220641.1| hypothetical protein ECO103_0644 [Escherichia coli O103:H2 str. 12009] gi|260853889|ref|YP_003227780.1| hypothetical protein ECO26_0711 [Escherichia coli O26:H11 str. 11368] gi|260866785|ref|YP_003233187.1| hypothetical protein ECO111_0667 [Escherichia coli O111:H- str. 11128] gi|261224104|ref|ZP_05938385.1| hypothetical protein EscherichiacoliO157_05794 [Escherichia coli O157:H7 str. FRIK2000] gi|261257798|ref|ZP_05950331.1| hypothetical protein EscherichiacoliO157EcO_18569 [Escherichia coli O157:H7 str. FRIK966] gi|291281588|ref|YP_003498406.1| hypothetical protein G2583_0800 [Escherichia coli O55:H7 str. CB9615] gi|293403899|ref|ZP_06647893.1| hypothetical protein ECGG_02277 [Escherichia coli FVEC1412] gi|293408763|ref|ZP_06652602.1| iojap protein 155 [Escherichia coli B354] gi|293413933|ref|ZP_06656582.1| iojap protein 155 [Escherichia coli B185] gi|293418748|ref|ZP_06661183.1| iojap protein 155 [Escherichia coli B088] gi|297519940|ref|ZP_06938326.1| hypothetical protein EcolOP_20028 [Escherichia coli OP50] gi|298379675|ref|ZP_06989280.1| hypothetical protein ECFG_02469 [Escherichia coli FVEC1302] gi|300817845|ref|ZP_07098059.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 107-1] gi|300823048|ref|ZP_07103182.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 119-7] gi|300901145|ref|ZP_07119252.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 198-1] gi|300907812|ref|ZP_07125429.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 84-1] gi|300920550|ref|ZP_07136975.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 115-1] gi|300927264|ref|ZP_07142992.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 182-1] gi|300931570|ref|ZP_07146884.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 187-1] gi|300951134|ref|ZP_07164999.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 116-1] gi|300959205|ref|ZP_07171284.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 175-1] gi|300990033|ref|ZP_07179075.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 45-1] gi|300996732|ref|ZP_07181519.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 200-1] gi|301025232|ref|ZP_07188799.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 69-1] gi|301028886|ref|ZP_07192058.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 196-1] gi|301049832|ref|ZP_07196772.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 185-1] gi|301302117|ref|ZP_07208250.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 124-1] gi|301329159|ref|ZP_07222156.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 78-1] gi|301643950|ref|ZP_07243976.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 146-1] gi|306812931|ref|ZP_07447124.1| hypothetical protein ECNC101_13492 [Escherichia coli NC101] gi|307137254|ref|ZP_07496610.1| hypothetical protein EcolH7_03862 [Escherichia coli H736] gi|307312647|ref|ZP_07592279.1| iojap-like protein [Escherichia coli W] gi|309785932|ref|ZP_07680561.1| conserved hypothetical protein [Shigella dysenteriae 1617] gi|309795496|ref|ZP_07689913.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 145-7] gi|312965083|ref|ZP_07779320.1| conserved hypothetical protein [Escherichia coli 2362-75] gi|312970718|ref|ZP_07784899.1| conserved hypothetical protein [Escherichia coli 1827-70] gi|331641140|ref|ZP_08342275.1| ACR, Iojap protein-like protein [Escherichia coli H736] gi|331645795|ref|ZP_08346898.1| ACR, Iojap protein-like protein [Escherichia coli M605] gi|331651649|ref|ZP_08352668.1| ACR, Iojap protein-like protein [Escherichia coli M718] gi|331656664|ref|ZP_08357626.1| ACR, Iojap protein-like protein [Escherichia coli TA206] gi|331662002|ref|ZP_08362925.1| ACR, Iojap protein-like protein [Escherichia coli TA143] gi|331666990|ref|ZP_08367864.1| ACR, Iojap protein-like protein [Escherichia coli TA271] gi|331672176|ref|ZP_08372968.1| ACR, Iojap protein-like protein [Escherichia coli TA280] gi|331676296|ref|ZP_08377008.1| ACR, Iojap protein-like protein [Escherichia coli H591] gi|331682061|ref|ZP_08382685.1| ACR, Iojap protein-like protein [Escherichia coli H299] gi|332281776|ref|ZP_08394189.1| conserved hypothetical protein [Shigella sp. D9] gi|77416744|sp|P0AAT7|YBEB_ECOL6 RecName: Full=Uncharacterized protein ybeB gi|77416745|sp|P0AAT6|YBEB_ECOLI RecName: Full=Uncharacterized protein ybeB gi|77416746|sp|P0AAT8|YBEB_SHIFL RecName: Full=Uncharacterized protein ybeB gi|26107017|gb|AAN79201.1|AE016757_105 Hypothetical protein ybeB [Escherichia coli CFT073] gi|1778554|gb|AAB40837.1| HI0034 homolog [Escherichia coli] gi|85674729|dbj|BAA35284.2| hypothetical protein [Escherichia coli str. K12 substr. W3110] gi|87081768|gb|AAC73738.2| ribosome-associated protein [Escherichia coli str. K-12 substr. MG1655] gi|91071258|gb|ABE06139.1| hypothetical protein YbeB [Escherichia coli UTI89] gi|110342458|gb|ABG68695.1| hypothetical protein ECP_0667 [Escherichia coli 536] gi|157065812|gb|ABV05067.1| iojap family protein [Escherichia coli HS] gi|157079944|gb|ABV19652.1| iojap family protein [Escherichia coli E24377A] gi|169755934|gb|ACA78633.1| iojap-like protein [Escherichia coli ATCC 8739] gi|169888051|gb|ACB01758.1| predicted protein [Escherichia coli str. K-12 substr. DH10B] gi|169888152|gb|ACB01859.1| predicted protein [Escherichia coli str. K-12 substr. DH10B] gi|170519000|gb|ACB17178.1| iojap family protein [Escherichia coli SMS-3-5] gi|187430325|gb|ACD09599.1| iojap family protein [Shigella boydii CDC 3083-94] gi|188489551|gb|EDU64654.1| iojap protein family [Escherichia coli 53638] gi|189003033|gb|EDU72019.1| iojap family protein [Escherichia coli O157:H7 str. EC4076] gi|189354860|gb|EDU73279.1| iojap family protein [Escherichia coli O157:H7 str. EC4401] gi|189373721|gb|EDU92137.1| iojap family protein [Escherichia coli O157:H7 str. EC869] gi|189375570|gb|EDU93986.1| iojap family protein [Escherichia coli O157:H7 str. EC508] gi|192930958|gb|EDV83562.1| iojap family protein [Escherichia coli E22] gi|208727108|gb|EDZ76709.1| iojap family protein [Escherichia coli O157:H7 str. EC4206] gi|208731652|gb|EDZ80340.1| iojap family protein [Escherichia coli O157:H7 str. EC4045] gi|208737243|gb|EDZ84927.1| iojap family protein [Escherichia coli O157:H7 str. EC4042] gi|209158796|gb|ACI36229.1| iojap family protein [Escherichia coli O157:H7 str. EC4115] gi|209911155|dbj|BAG76229.1| conserved hypothetical protein [Escherichia coli SE11] gi|215263749|emb|CAS08085.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|217320511|gb|EEC28935.1| iojap family protein [Escherichia coli O157:H7 str. TW14588] gi|218350809|emb|CAU96501.1| conserved hypothetical protein [Escherichia coli 55989] gi|218359947|emb|CAQ97491.1| conserved hypothetical protein [Escherichia coli IAI1] gi|218364344|emb|CAR02019.1| conserved hypothetical protein [Escherichia coli S88] gi|218368995|emb|CAR16749.1| conserved hypothetical protein [Escherichia coli IAI39] gi|218426024|emb|CAR06841.1| conserved hypothetical protein [Escherichia coli ED1a] gi|218431068|emb|CAR11944.1| conserved hypothetical protein [Escherichia coli UMN026] gi|222032397|emb|CAP75136.1| Uncharacterized protein ybeB [Escherichia coli LF82] gi|226898599|gb|EEH84858.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA] gi|227838469|gb|EEJ48935.1| iojap family protein [Escherichia coli 83972] gi|238862850|gb|ACR64848.1| predicted protein [Escherichia coli BW2952] gi|242376412|emb|CAQ31112.1| predicted protein [Escherichia coli BL21(DE3)] gi|253325421|gb|ACT30023.1| Iojap-related protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253972620|gb|ACT38291.1| hypothetical protein ECB_00606 [Escherichia coli B str. REL606] gi|253976814|gb|ACT42484.1| hypothetical protein ECD_00606 [Escherichia coli BL21(DE3)] gi|254591203|gb|ACT70564.1| predicted protein [Escherichia coli O157:H7 str. TW14359] gi|257752538|dbj|BAI24040.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368] gi|257758010|dbj|BAI29507.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009] gi|257763141|dbj|BAI34636.1| conserved predicted protein [Escherichia coli O111:H- str. 11128] gi|260450196|gb|ACX40618.1| iojap-like protein [Escherichia coli DH1] gi|281177786|dbj|BAI54116.1| conserved hypothetical protein [Escherichia coli SE15] gi|281600027|gb|ADA73011.1| hypothetical protein SFxv_0711 [Shigella flexneri 2002017] gi|284920437|emb|CBG33498.1| conserved hypothetical protein [Escherichia coli 042] gi|290761461|gb|ADD55422.1| hypothetical protein G2583_0800 [Escherichia coli O55:H7 str. CB9615] gi|291325276|gb|EFE64691.1| iojap protein 155 [Escherichia coli B088] gi|291428485|gb|EFF01510.1| hypothetical protein ECGG_02277 [Escherichia coli FVEC1412] gi|291433991|gb|EFF06964.1| iojap protein 155 [Escherichia coli B185] gi|291471941|gb|EFF14424.1| iojap protein 155 [Escherichia coli B354] gi|294491406|gb|ADE90162.1| iojap-like ribosome-associated protein [Escherichia coli IHE3034] gi|298279373|gb|EFI20881.1| hypothetical protein ECFG_02469 [Escherichia coli FVEC1302] gi|299878134|gb|EFI86345.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 196-1] gi|300298427|gb|EFJ54812.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 185-1] gi|300304447|gb|EFJ58967.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 200-1] gi|300314190|gb|EFJ63974.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 175-1] gi|300355412|gb|EFJ71282.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 198-1] gi|300396135|gb|EFJ79673.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 69-1] gi|300400501|gb|EFJ84039.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 84-1] gi|300407205|gb|EFJ90743.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 45-1] gi|300412452|gb|EFJ95762.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 115-1] gi|300416752|gb|EFK00063.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 182-1] gi|300449589|gb|EFK13209.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 116-1] gi|300460639|gb|EFK24132.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 187-1] gi|300524397|gb|EFK45466.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 119-7] gi|300529542|gb|EFK50604.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 107-1] gi|300842669|gb|EFK70429.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 124-1] gi|300844506|gb|EFK72266.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 78-1] gi|301077685|gb|EFK92491.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 146-1] gi|305853694|gb|EFM54133.1| hypothetical protein ECNC101_13492 [Escherichia coli NC101] gi|306907349|gb|EFN37854.1| iojap-like protein [Escherichia coli W] gi|307552507|gb|ADN45282.1| putative ACR [Escherichia coli ABU 83972] gi|307627925|gb|ADN72229.1| hypothetical protein UM146_14330 [Escherichia coli UM146] gi|308120871|gb|EFO58133.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 145-7] gi|308926043|gb|EFP71521.1| conserved hypothetical protein [Shigella dysenteriae 1617] gi|310337367|gb|EFQ02505.1| conserved hypothetical protein [Escherichia coli 1827-70] gi|312290174|gb|EFR18057.1| conserved hypothetical protein [Escherichia coli 2362-75] gi|312945184|gb|ADR26011.1| hypothetical protein NRG857_02900 [Escherichia coli O83:H1 str. NRG 857C] gi|313649718|gb|EFS14142.1| hypothetical protein SF2457T_1930 [Shigella flexneri 2a str. 2457T] gi|315059892|gb|ADT74219.1| predicted protein [Escherichia coli W] gi|315135303|dbj|BAJ42462.1| hypothetical protein ECDH1ME8569_0606 [Escherichia coli DH1] gi|315255059|gb|EFU35027.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 85-1] gi|315287070|gb|EFU46484.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 110-3] gi|315292104|gb|EFU51456.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 153-1] gi|315299172|gb|EFU58426.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 16-3] gi|315616444|gb|EFU97061.1| conserved hypothetical protein [Escherichia coli 3431] gi|320175121|gb|EFW50233.1| Iojap protein [Shigella dysenteriae CDC 74-1112] gi|320178427|gb|EFW53395.1| Iojap protein [Shigella boydii ATCC 9905] gi|320185387|gb|EFW60157.1| Iojap protein [Shigella flexneri CDC 796-83] gi|320193044|gb|EFW67684.1| Iojap protein [Escherichia coli O157:H7 str. EC1212] gi|320194181|gb|EFW68813.1| Iojap protein [Escherichia coli WV_060327] gi|320198237|gb|EFW72841.1| Iojap protein [Escherichia coli EC4100B] gi|320638086|gb|EFX07850.1| ribosome-associated protein [Escherichia coli O157:H7 str. G5101] gi|320643492|gb|EFX12662.1| ribosome-associated protein [Escherichia coli O157:H- str. 493-89] gi|320648827|gb|EFX17454.1| ribosome-associated protein [Escherichia coli O157:H- str. H 2687] gi|320654413|gb|EFX22460.1| ribosome-associated protein [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320660094|gb|EFX27624.1| ribosome-associated protein [Escherichia coli O55:H7 str. USDA 5905] gi|320664891|gb|EFX32026.1| ribosome-associated protein [Escherichia coli O157:H7 str. LSU-61] gi|323153641|gb|EFZ39889.1| hypothetical protein ECEPECA14_4441 [Escherichia coli EPECa14] gi|323158909|gb|EFZ44920.1| hypothetical protein ECE128010_4826 [Escherichia coli E128010] gi|323164093|gb|EFZ49901.1| hypothetical protein SS53G_5735 [Shigella sonnei 53G] gi|323170764|gb|EFZ56414.1| hypothetical protein ECLT68_4829 [Escherichia coli LT-68] gi|323179886|gb|EFZ65443.1| hypothetical protein ECOK1180_1295 [Escherichia coli 1180] gi|323185008|gb|EFZ70375.1| hypothetical protein ECOK1357_1667 [Escherichia coli 1357] gi|323191276|gb|EFZ76540.1| hypothetical protein ECRN5871_0565 [Escherichia coli RN587/1] gi|323379544|gb|ADX51812.1| iojap-like protein [Escherichia coli KO11] gi|323938399|gb|EGB34653.1| hypothetical protein ERCG_00435 [Escherichia coli E1520] gi|323943052|gb|EGB39211.1| hypothetical protein ERDG_00389 [Escherichia coli E482] gi|323945112|gb|EGB41174.1| hypothetical protein EREG_03296 [Escherichia coli H120] gi|323952785|gb|EGB48653.1| hypothetical protein ERKG_00558 [Escherichia coli H252] gi|323958396|gb|EGB54102.1| hypothetical protein ERLG_00386 [Escherichia coli H263] gi|323963206|gb|EGB58774.1| hypothetical protein ERGG_00392 [Escherichia coli H489] gi|323967584|gb|EGB63000.1| hypothetical protein ERJG_01162 [Escherichia coli M863] gi|323972092|gb|EGB67306.1| hypothetical protein ERHG_01905 [Escherichia coli TA007] gi|323976380|gb|EGB71470.1| hypothetical protein ERFG_02816 [Escherichia coli TW10509] gi|324006316|gb|EGB75535.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 57-2] gi|324010478|gb|EGB79697.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 60-1] gi|324016093|gb|EGB85312.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 117-3] gi|324116711|gb|EGC10626.1| hypothetical protein ERBG_03387 [Escherichia coli E1167] gi|326341388|gb|EGD65180.1| Iojap protein [Escherichia coli O157:H7 str. 1044] gi|326345833|gb|EGD69572.1| Iojap protein [Escherichia coli O157:H7 str. 1125] gi|327254321|gb|EGE65943.1| hypothetical protein ECSTEC7V_0774 [Escherichia coli STEC_7v] gi|330910399|gb|EGH38909.1| iojap protein [Escherichia coli AA86] gi|331037938|gb|EGI10158.1| ACR, Iojap protein-like protein [Escherichia coli H736] gi|331044547|gb|EGI16674.1| ACR, Iojap protein-like protein [Escherichia coli M605] gi|331049927|gb|EGI21985.1| ACR, Iojap protein-like protein [Escherichia coli M718] gi|331054912|gb|EGI26921.1| ACR, Iojap protein-like protein [Escherichia coli TA206] gi|331060424|gb|EGI32388.1| ACR, Iojap protein-like protein [Escherichia coli TA143] gi|331066214|gb|EGI38098.1| ACR, Iojap protein-like protein [Escherichia coli TA271] gi|331070643|gb|EGI42006.1| ACR, Iojap protein-like protein [Escherichia coli TA280] gi|331076354|gb|EGI47636.1| ACR, Iojap protein-like protein [Escherichia coli H591] gi|331080740|gb|EGI51914.1| ACR, Iojap protein-like protein [Escherichia coli H299] gi|332094309|gb|EGI99360.1| hypothetical protein SB521682_0645 [Shigella boydii 5216-82] gi|332096788|gb|EGJ01778.1| hypothetical protein SD15574_0926 [Shigella dysenteriae 155-74] gi|332097708|gb|EGJ02682.1| hypothetical protein SB359474_0536 [Shigella boydii 3594-74] gi|332104128|gb|EGJ07474.1| conserved hypothetical protein [Shigella sp. D9] gi|332341984|gb|AEE55318.1| conserved hypothetical protein [Escherichia coli UMNK88] gi|332760993|gb|EGJ91281.1| hypothetical protein SF434370_0860 [Shigella flexneri 4343-70] gi|332761140|gb|EGJ91426.1| hypothetical protein SF274771_0795 [Shigella flexneri 2747-71] gi|332763364|gb|EGJ93604.1| hypothetical protein SFK671_0759 [Shigella flexneri K-671] gi|332768261|gb|EGJ98446.1| hypothetical protein SF293071_0805 [Shigella flexneri 2930-71] gi|333007452|gb|EGK26932.1| hypothetical protein SFVA6_1099 [Shigella flexneri VA-6] gi|333007992|gb|EGK27468.1| hypothetical protein SFK218_0959 [Shigella flexneri K-218] gi|333010048|gb|EGK29483.1| hypothetical protein SFK272_0907 [Shigella flexneri K-272] gi|333020881|gb|EGK40141.1| hypothetical protein SFK227_0865 [Shigella flexneri K-227] gi|333021428|gb|EGK40678.1| hypothetical protein SFK304_0864 [Shigella flexneri K-304] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|325263954|ref|ZP_08130687.1| iojap-like protein [Clostridium sp. D5] gi|324030992|gb|EGB92274.1| iojap-like protein [Clostridium sp. D5] Length = 116 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L E K EDI I+ S++ D +I +G + V ++ DN+ Sbjct: 1 MEQARKMARIACKALDEKKGEDIKVIDIA-GVSVLADYFIIANGSNESQVRALVDNVEEC 59 Query: 73 LKK 75 L K Sbjct: 60 LHK 62 >gi|218549787|ref|YP_002383578.1| hypothetical protein EFER_2468 [Escherichia fergusonii ATCC 35469] gi|218357328|emb|CAQ89965.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469] gi|324114759|gb|EGC08727.1| hypothetical protein ERIG_00753 [Escherichia fergusonii B253] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIITLDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|317491126|ref|ZP_07949562.1| hypothetical protein HMPREF0864_00325 [Enterobacteriaceae bacterium 9_2_54FAA] gi|316920673|gb|EFV41996.1| hypothetical protein HMPREF0864_00325 [Enterobacteriaceae bacterium 9_2_54FAA] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + ++KA+DI I+ +S I D M++ +G S++HV SIA +++ + Sbjct: 4 KALQEFIIDKIDDMKAQDIIAIDVA-GKSSITDCMIVCTGTSSRHVHSIATHVVQEAR 60 >gi|311748093|ref|ZP_07721878.1| iojap-like protein [Algoriphagus sp. PR1] gi|126574737|gb|EAZ79118.1| iojap-like protein [Algoriphagus sp. PR1] Length = 115 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 29/59 (49%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ++ ++E KA +I ++ ++ + D VI SG S + +I+D++ + Sbjct: 2 TAEELSKVIINGMEEKKASNIVLMDLRHIKDSVSDFFVICSGNSDTQIEAISDSIEEQV 60 >gi|283784415|ref|YP_003364280.1| hypothetical protein ROD_06551 [Citrobacter rodentium ICC168] gi|282947869|emb|CBG87430.1| conserved hypothetical protein [Citrobacter rodentium ICC168] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|209965209|ref|YP_002298124.1| iojap-related protein, putative [Rhodospirillum centenum SW] gi|209958675|gb|ACI99311.1| iojap-related protein, putative [Rhodospirillum centenum SW] Length = 147 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ L KAED I+ ++ + D MV+ SGRS + V ++AD+L+ LK Sbjct: 32 DLVLQSLDGDKAEDTVVIDLI-GKTSLADYMVVTSGRSARQVGAMADHLLEKLK 84 >gi|91787848|ref|YP_548800.1| Iojap-like protein [Polaromonas sp. JS666] gi|91697073|gb|ABE43902.1| Iojap-related protein [Polaromonas sp. JS666] Length = 274 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +++ L+++KA+DI + T + + + +++ SG S + ++A ++ Sbjct: 14 KKDVQKLQRAIVDGLEDVKAQDIQVFD-TEHITSLFERVIVASGTSNRQTKALAASVRDA 72 Query: 73 LKK 75 ++ Sbjct: 73 VRD 75 >gi|146328738|ref|YP_001209379.1| hypothetical protein DNO_0467 [Dichelobacter nodosus VCS1703A] gi|146232208|gb|ABQ13186.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A] Length = 110 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L++ ++ L+ELKA +I I+ + ++ D M+I SG S +H+ ++AD ++ + K Sbjct: 2 TLENLKNLIINSLEELKAVNIQVIDLSD-KTDFADYMIIASGTSDRHLHALADRVVEHCK 60 Query: 75 KK 76 + Sbjct: 61 EH 62 >gi|260892117|ref|YP_003238214.1| iojap-like protein [Ammonifex degensii KC4] gi|260864258|gb|ACX51364.1| iojap-like protein [Ammonifex degensii KC4] Length = 118 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+E +E K DI +E L +CD VI+SG + V +IA+++ L K+ Sbjct: 4 REIVDLVIEAAQEKKGYDILALEVGKLL-PLCDYFVILSGNNPIQVKAIAEHIEERLAKQ 62 >gi|212712942|ref|ZP_03321070.1| hypothetical protein PROVALCAL_04040 [Providencia alcalifaciens DSM 30120] gi|212684420|gb|EEB43948.1| hypothetical protein PROVALCAL_04040 [Providencia alcalifaciens DSM 30120] Length = 108 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +++ L++ KAEDI I+ +S + D M+I +G S++H+ S+AD LI +K+ Sbjct: 8 ELQKFIIDQLEDAKAEDITSIDV-HGKSSVTDQMIICTGTSSRHLMSVADRLIDACRKQ 65 >gi|193069031|ref|ZP_03049989.1| iojap family protein [Escherichia coli E110019] gi|192957575|gb|EDV88020.1| iojap family protein [Escherichia coli E110019] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|118582012|ref|YP_903262.1| iojap-like protein [Pelobacter propionicus DSM 2379] gi|118504722|gb|ABL01205.1| iojap-like protein [Pelobacter propionicus DSM 2379] Length = 135 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 ++ T+ + +T E + KA DI ++ S S I D +VI SG S + Sbjct: 1 MSMTQAEEEKTDLTSRERAIRCAELASDKKAFDIRALDI-STISSIADYLVIASGGSDRQ 59 Query: 62 VASIADNLISYLKK 75 V +IAD++ LKK Sbjct: 60 VQAIADSIRIGLKK 73 >gi|300937891|ref|ZP_07152682.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 21-1] gi|300457091|gb|EFK20584.1| ribosome-associated protein, iojap-like family protein [Escherichia coli MS 21-1] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 2 QSKALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|209543252|ref|YP_002275481.1| iojap-like protein [Gluconacetobacter diazotrophicus PAl 5] gi|209530929|gb|ACI50866.1| iojap-like protein [Gluconacetobacter diazotrophicus PAl 5] Length = 400 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 L+ +A + E + + K EDI ++ T R+ D MV+ +G + + ++++A ++ L + Sbjct: 286 LEKYLAIITESIADDKGEDIVVLDLT-GRAAFADRMVVATGLADRQISAMATHIERKLGE 344 >gi|255068012|ref|ZP_05319867.1| iojap-like protein [Neisseria sicca ATCC 29256] gi|255047700|gb|EET43164.1| iojap-like protein [Neisseria sicca ATCC 29256] Length = 128 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + T +E L+++KA+DI ++ T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVETAVEALEDIKAKDISVLQ-TQEKTSLFARMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VSLKE 67 >gi|15603787|ref|NP_246861.1| hypothetical protein PM1922 [Pasteurella multocida subsp. multocida str. Pm70] gi|12722356|gb|AAK04006.1| unknown [Pasteurella multocida subsp. multocida str. Pm70] Length = 103 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 41/60 (68%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ + +++ L +LKA DI ++ +S I D+MVI +G S++HV+S+A NLI+ K+ Sbjct: 1 MNTLVDFIIDKLDDLKATDILRLDVR-GKSPITDDMVICTGNSSRHVSSLAQNLITECKQ 59 >gi|110804714|ref|YP_688234.1| hypothetical protein SFV_0689 [Shigella flexneri 5 str. 8401] gi|110614262|gb|ABF02929.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|288818734|ref|YP_003433082.1| plant iojap-like protein [Hydrogenobacter thermophilus TK-6] gi|288788134|dbj|BAI69881.1| plant iojap-like protein [Hydrogenobacter thermophilus TK-6] gi|308752321|gb|ADO45804.1| iojap-like protein [Hydrogenobacter thermophilus TK-6] Length = 110 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + E L+ K EDI ++ ++ + I D VIVS S+ H ++AD +I LKK Sbjct: 1 MTEKLKLIRELLESKKGEDIVILDVSN-FTNIADYFVIVSANSSVHAKALADYIIEELKK 59 Query: 76 K 76 Sbjct: 60 H 60 >gi|237745558|ref|ZP_04576038.1| iojap domain-containing protein [Oxalobacter formigenes HOxBLS] gi|229376909|gb|EEO27000.1| iojap domain-containing protein [Oxalobacter formigenes HOxBLS] Length = 166 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ A V++ L+++KA+DI + T+ + + + +VI SG S++ ++A ++ +K Sbjct: 2 EIEKLQALVIQALEDVKAQDIVLFDTTN-LTSLFERIVIASGNSSRQTKALAASVRDKIK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|114328374|ref|YP_745531.1| iojap superfamily protein [Granulibacter bethesdensis CGDNIH1] gi|114316548|gb|ABI62608.1| iojap protein family [Granulibacter bethesdensis CGDNIH1] Length = 203 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 40/69 (57%), Gaps = 1/69 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 QA+ + LD+ A ++E L++ KAEDI ++ R+ D M+I +G + + ++++A Sbjct: 82 DQAVAARERLDAIQAVIIESLEDDKAEDIMTLDLA-GRAAFTDRMIIATGLADRQISAMA 140 Query: 67 DNLISYLKK 75 +L L+ Sbjct: 141 MHLQQKLRD 149 >gi|323499957|ref|ZP_08104915.1| hypothetical protein VISI1226_03205 [Vibrio sinaloensis DSM 21326] gi|323314974|gb|EGA68027.1| hypothetical protein VISI1226_03205 [Vibrio sinaloensis DSM 21326] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L+ +++ + ++KA+DI I+ +S I D M++ +G S +HVASIAD++ K Sbjct: 2 QLEELNNFLIDKVDDMKAQDIKTIDV-QGKSSITDYMIVCTGTSKRHVASIADHVARESK 60 >gi|319639600|ref|ZP_07994347.1| hypothetical protein HMPREF0604_01971 [Neisseria mucosa C102] gi|317399171|gb|EFV79845.1| hypothetical protein HMPREF0604_01971 [Neisseria mucosa C102] Length = 128 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+++KA+DI +E T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVEVAVNALEDIKAKDISVLE-TQDKTSLFARMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|157146746|ref|YP_001454065.1| hypothetical protein CKO_02520 [Citrobacter koseri ATCC BAA-895] gi|157083951|gb|ABV13629.1| hypothetical protein CKO_02520 [Citrobacter koseri ATCC BAA-895] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIITLDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|256821553|ref|YP_003145516.1| iojap-like protein [Kangiella koreensis DSM 16069] gi|256795092|gb|ACV25748.1| iojap-like protein [Kangiella koreensis DSM 16069] Length = 115 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+ KA+DI + S + D M+I SG S++HV S+A NL+S +K Sbjct: 2 EAEQLKDLVVDQLEGSKAKDIKVLNV-KGLSSVTDYMIIASGTSSRHVKSVAHNLVSSVK 60 Query: 75 KK 76 + Sbjct: 61 DE 62 >gi|119504238|ref|ZP_01626318.1| uncharacterized plant Iojap protein [marine gamma proteobacterium HTCC2080] gi|119459746|gb|EAW40841.1| uncharacterized plant Iojap protein [marine gamma proteobacterium HTCC2080] Length = 117 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 TA D+ V++ L +LKA D I+ S + D +VI SG ST+HV S+ADN+I Sbjct: 5 TASEHDALTGLVLDALDDLKAVDPVVIDV-KALSSVMDFLVIASGTSTRHVKSLADNVIM 63 Query: 72 YLKKK 76 K + Sbjct: 64 RAKSE 68 >gi|296103397|ref|YP_003613543.1| hypothetical protein ECL_03058 [Enterobacter cloacae subsp. cloacae ATCC 13047] gi|295057856|gb|ADF62594.1| hypothetical protein ECL_03058 [Enterobacter cloacae subsp. cloacae ATCC 13047] Length = 105 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI I+ +S I D M+I +G ST+HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDITAIDV-KGKSSITDCMIICTGTSTRHVVSIADHVVQE 58 >gi|332974654|gb|EGK11571.1| Iojap family protein [Kingella kingae ATCC 23330] Length = 130 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q +L + + L+++KA+DI ++ + ++ + M+I SG ST+ V ++ +N+ Sbjct: 4 QELQNLQKMVDIAVNALEDIKAKDIVVLDTSE-KTSLFARMIIASGDSTRQVKALTNNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|319779285|ref|YP_004130198.1| Iojap protein [Taylorella equigenitalis MCE9] gi|317109309|gb|ADU92055.1| Iojap protein [Taylorella equigenitalis MCE9] Length = 132 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ V++ L+++KA++I TS + + D ++I SG S + S+A ++ ++ Sbjct: 2 NIQKLQRIVVDALEDVKAQNIKIFN-TSHLTSLFDRVIIASGSSNRQTRSLAKSVSDAVR 60 Query: 75 KKN 77 +++ Sbjct: 61 ERD 63 >gi|56552559|ref|YP_163398.1| iojap-like protein [Zymomonas mobilis subsp. mobilis ZM4] gi|241762199|ref|ZP_04760281.1| iojap-like protein [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|56544133|gb|AAV90287.1| iojap-like protein [Zymomonas mobilis subsp. mobilis ZM4] gi|241373246|gb|EER62865.1| iojap-like protein [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 133 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M A + + QT+ + + V + L + +A +I I +S I D MVI SGRS++ Sbjct: 1 MPAPSSPRKNQTSFDPEMLLKLVTDSLDDDQALEIATIPLA-GKSSIADYMVIASGRSSR 59 Query: 61 HVASIADNLISYLK 74 V ++A L +K Sbjct: 60 QVTAMAQKLADRIK 73 >gi|241759651|ref|ZP_04757752.1| iojap homolog [Neisseria flavescens SK114] gi|296314813|ref|ZP_06864754.1| iojap-like protein [Neisseria polysaccharea ATCC 43768] gi|241320023|gb|EER56404.1| iojap homolog [Neisseria flavescens SK114] gi|296838361|gb|EFH22299.1| iojap-like protein [Neisseria polysaccharea ATCC 43768] gi|319409667|emb|CBY89968.1| conserved hypothetical protein [Neisseria meningitidis WUE 2594] Length = 128 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+++KA+DI +E T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVEVAVNALEDIKAKDISVLE-TQDKTSLFARMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|71905812|ref|YP_283399.1| Iojap-related protein [Dechloromonas aromatica RCB] gi|71845433|gb|AAZ44929.1| Iojap-related protein [Dechloromonas aromatica RCB] Length = 121 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L+++K +DI I TS + + D ++I +G S + V S+A+N+ +K Sbjct: 2 DIRKLQKIVVSALEDIKGKDIEVIN-TSKLTSMFDRIIIATGDSNRQVKSLANNVQEKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|323137380|ref|ZP_08072458.1| iojap-like protein [Methylocystis sp. ATCC 49242] gi|322397367|gb|EFX99890.1| iojap-like protein [Methylocystis sp. ATCC 49242] Length = 125 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L + KAEDI I+ ++ + D M+I +GRST HV +IAD I K Sbjct: 16 IVQNVLKSLDDSKAEDIISIDLR-GKTALADEMIIATGRSTVHVGAIADKAIKACK 70 >gi|119775718|ref|YP_928458.1| iojap domain-containing protein [Shewanella amazonensis SB2B] gi|119768218|gb|ABM00789.1| iojap domain protein [Shewanella amazonensis SB2B] Length = 108 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +++LKA D+ ++ + S I D MVI SG S HV +IA+NL+S + Sbjct: 2 QSEELKQFVVDKIEDLKARDLVVLDVSKH-SNITDYMVICSGTSKTHVRAIAENLLSKAR 60 Query: 75 KKN 77 + N Sbjct: 61 EAN 63 >gi|197301716|ref|ZP_03166786.1| hypothetical protein RUMLAC_00442 [Ruminococcus lactaris ATCC 29176] gi|197299156|gb|EDY33686.1| hypothetical protein RUMLAC_00442 [Ruminococcus lactaris ATCC 29176] Length = 116 Score = 68.6 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + E L E K EDI I+ S S++ D +I G S V ++ +N+ Sbjct: 1 MNQAKEMARIAYEALSEKKGEDIKVIDI-SGISVLADYFLIAHGNSDSQVNALVENVEEQ 59 Query: 73 LKK 75 L K Sbjct: 60 LHK 62 >gi|23099438|ref|NP_692904.1| hypothetical protein OB1983 [Oceanobacillus iheyensis HTE831] gi|22777667|dbj|BAC13939.1| hypothetical conserved protein [Oceanobacillus iheyensis HTE831] Length = 118 Score = 68.6 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I V E + +AE+I ++ + SL+ D +I G + + V +IA + ++ Sbjct: 2 DKQELIKHVAEACDDKRAENIVALDM-NEVSLVADYFLICHGSNERQVQAIARAVKETVE 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|121602406|ref|YP_988641.1| iojap-like protein [Bartonella bacilliformis KC583] gi|120614583|gb|ABM45184.1| iojap homolog [Bartonella bacilliformis KC583] Length = 130 Score = 68.6 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 21/56 (37%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V+ L+ KAEDI I+ +S + D +VI S RS +HV+S+A++L+ K+ Sbjct: 17 LKVVLNSLENTKAEDIISIDI-QGKSSLADYIVIASARSHRHVSSVANHLLWTWKE 71 >gi|318041819|ref|ZP_07973775.1| hypothetical protein SCB01_08919 [Synechococcus sp. CB0101] Length = 144 Score = 68.6 bits (167), Expect = 2e-10, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D E + KA DI + + S I D VI +G S V +IA ++ Sbjct: 20 NLDDSHQLALLAAEACDDRKAGDIVLLRVEEI-SSIADWFVIATGFSDVQVRAIARSVED 78 Query: 72 YLKKK 76 ++ + Sbjct: 79 KIEDE 83 >gi|194430686|ref|ZP_03063122.1| iojap family protein [Escherichia coli B171] gi|194411268|gb|EDX27654.1| iojap family protein [Escherichia coli B171] Length = 105 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQE 58 >gi|291296600|ref|YP_003507998.1| iojap-like protein [Meiothermus ruber DSM 1279] gi|290471559|gb|ADD28978.1| iojap-like protein [Meiothermus ruber DSM 1279] Length = 114 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + A I V E L++ KAE++ ++ T S D VI +G S H+ ++ + Sbjct: 1 MVQAIDTQRLIHLVKEALEDKKAENVVVLDLT-GVSDTLDYFVIATGTSQPHLQALERAV 59 Query: 70 ISYLKK 75 L + Sbjct: 60 REKLLE 65 >gi|86156642|ref|YP_463427.1| Iojap-like protein [Anaeromyxobacter dehalogenans 2CP-C] gi|85773153|gb|ABC79990.1| Iojap-related protein [Anaeromyxobacter dehalogenans 2CP-C] Length = 107 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + KAED+ ++ + D V+++ S + ++IAD++ +K + Sbjct: 2 AIAAAALDKKAEDVTVLDVR-GLTSYADYFVLMTADSDRQASAIADHVEQTMKAQ 55 >gi|305664430|ref|YP_003860717.1| hypothetical protein FB2170_16401 [Maribacter sp. HTCC2170] gi|88708447|gb|EAR00683.1| hypothetical protein FB2170_16401 [Maribacter sp. HTCC2170] Length = 125 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + D IA +++ ++E+K DI ++ + + +CD +I +G S HV +I ++ Sbjct: 3 KRKASADELIALILQGIEEVKGHDINLLDLREIENTVCDYFIICNGTSNTHVNAIVGSIQ 62 Query: 71 SYLKK 75 + K Sbjct: 63 KTVSK 67 >gi|325285488|ref|YP_004261278.1| iojap-like protein [Cellulophaga lytica DSM 7489] gi|324320942|gb|ADY28407.1| iojap-like protein [Cellulophaga lytica DSM 7489] Length = 125 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 33/65 (50%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + D I +++ ++E+K DI ++ + + +CD V+ +G S HV +I ++ Sbjct: 3 KKTASADELITLILQGIEEVKGHDINLLDLREIENTVCDYFVVCNGTSNTHVNAIVSSIQ 62 Query: 71 SYLKK 75 + K Sbjct: 63 KTVSK 67 >gi|323495450|ref|ZP_08100527.1| hypothetical protein VIBR0546_09719 [Vibrio brasiliensis LMG 20546] gi|323310373|gb|EGA63560.1| hypothetical protein VIBR0546_09719 [Vibrio brasiliensis LMG 20546] Length = 105 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L+ +++ + ++KA+DI I+ +S I D M++ +G S +HVASIA+++ K Sbjct: 2 QLEQLNEFLVDKVDDMKAQDIKTIDV-QGKSSITDYMIVCTGTSKRHVASIAEHVAKESK 60 >gi|291326466|ref|ZP_06573962.1| iojap-like protein [Providencia rettgeri DSM 1131] gi|291314325|gb|EFE54778.1| iojap-like protein [Providencia rettgeri DSM 1131] Length = 108 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +++ L + KAEDI I+ +S I D M+I +G S++H+ S+AD LI +K Sbjct: 8 ELQQFIIDQLDDAKAEDIITIDV-QGKSSITDQMIICTGTSSRHLMSVADRLIEACRKN 65 >gi|159042643|ref|YP_001531437.1| iojap-like protein [Dinoroseobacter shibae DFL 12] gi|157910403|gb|ABV91836.1| iojap-like protein [Dinoroseobacter shibae DFL 12] Length = 110 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D +A + L + KAED+ I +S + D+MV+ SGRST+ VA+I++ L+ LK Sbjct: 2 SDRILALTLTSLDQDKAEDVVSINLR-GKSSMADHMVVCSGRSTRQVAAISEKLVERLKA 60 Query: 76 K 76 + Sbjct: 61 E 61 >gi|37525266|ref|NP_928610.1| hypothetical protein plu1299 [Photorhabdus luminescens subsp. laumondii TTO1] gi|36784693|emb|CAE13593.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii TTO1] Length = 105 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ L+ KA+DI ++ +S I D M++ +G S++H+ S+ADNL+ + Sbjct: 4 KELQQFVIDKLENSKAQDIVSLDV-QGKSSITDCMIVCTGTSSRHLMSVADNLVDDCR 60 >gi|218262672|ref|ZP_03477030.1| hypothetical protein PRABACTJOHN_02709 [Parabacteroides johnsonii DSM 18315] gi|218223248|gb|EEC95898.1| hypothetical protein PRABACTJOHN_02709 [Parabacteroides johnsonii DSM 18315] Length = 119 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 35/64 (54%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + + T++E L+E K ++I ++ T L IC M+I G + V++++D+ + Sbjct: 1 MDQTEELVKTIVEGLQEKKGKNIVTVDLTQLSGSICQYMIICEGSTPTQVSALSDSAWDF 60 Query: 73 LKKK 76 +K Sbjct: 61 AHRK 64 >gi|169832009|ref|YP_001717991.1| iojap-like protein [Candidatus Desulforudis audaxviator MP104C] gi|169638853|gb|ACA60359.1| iojap-like protein [Candidatus Desulforudis audaxviator MP104C] Length = 118 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + E + +DI ++ S +++ D V+VSGRST HV +IAD++ L + Sbjct: 6 RTLVEAAVRAAGEKRGDDILVLDI-SGLTVLSDYFVLVSGRSTTHVKAIADHIREKLGE 63 >gi|330895590|gb|EGH27898.1| iojap domain-containing protein [Pseudomonas syringae pv. japonica str. M301072PT] Length = 123 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I + L+E+K DI I+ ++ I D M+I +G S + + ++ DN+ +K Sbjct: 2 SSEDVINVAIAALEEVKGADILTIDVRD-KTSIADYMLICTGTSNRQLNALVDNVRDKVK 60 >gi|299535728|ref|ZP_07049049.1| hypothetical protein BFZC1_06883 [Lysinibacillus fusiformis ZC1] gi|298728928|gb|EFI69482.1| hypothetical protein BFZC1_06883 [Lysinibacillus fusiformis ZC1] Length = 114 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + + EDI + SL+ D +I G S + V +IA L ++ Sbjct: 2 TSTLLQAAYKAIDDKHGEDIVVLNM-QGISLLADYFIIAHGNSDRQVQAIARELQDVAEQ 60 Query: 76 K 76 + Sbjct: 61 Q 61 >gi|188577782|ref|YP_001914711.1| domain of unknown function superfamily [Xanthomonas oryzae pv. oryzae PXO99A] gi|188522234|gb|ACD60179.1| domain of unknown function superfamily [Xanthomonas oryzae pv. oryzae PXO99A] Length = 116 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 27/55 (49%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ATV E ++ELKA+D+ I+ +S +CD MV+VSG ST+HV SIAD ++ + K+ Sbjct: 2 ATVREAVEELKAKDVVEIDVR-GKSSVCDYMVVVSGTSTRHVKSIADEVVKFAKR 55 >gi|148242081|ref|YP_001227238.1| hypothetical protein SynRCC307_0982 [Synechococcus sp. RCC307] gi|147850391|emb|CAK27885.1| Conserved hypothetical protein [Synechococcus sp. RCC307] Length = 123 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + E + KA DI ++ + + D ++ SG ST V +IA ++ L+ Sbjct: 2 DSEALVQLAAEAADDRKAVDIRLLKV-DDVTTLTDWFLVCSGLSTVQVKAIARSVEDRLE 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|74318458|ref|YP_316198.1| Iojap-like protein [Thiobacillus denitrificans ATCC 25259] gi|74057953|gb|AAZ98393.1| Iojap-related protein [Thiobacillus denitrificans ATCC 25259] Length = 117 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ V+ L+++KA DI ++ TS + + + MVI SG S + ++ADN+ +K Sbjct: 2 NIEDKTRLVVAALEDIKARDIAVLD-TSKLTSLFERMVIASGDSNRQTRALADNVREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|33593306|ref|NP_880950.1| hypothetical protein BP2312 [Bordetella pertussis Tohama I] gi|33600852|ref|NP_888412.1| hypothetical protein BB1867 [Bordetella bronchiseptica RB50] gi|33568452|emb|CAE32364.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] gi|33572662|emb|CAE42585.1| conserved hypothetical protein [Bordetella pertussis Tohama I] gi|332382715|gb|AEE67562.1| hypothetical protein BPTD_2271 [Bordetella pertussis CS] Length = 128 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 10/58 (17%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +++ L+++KA+DI + + + D ++I S S + ++A ++ Sbjct: 2 DIQKLQRAIIDALEDVKAQDIKVFNTSE-LTSLFDRVIIASATSNRQTRALASSVADR 58 >gi|220915358|ref|YP_002490662.1| iojap-like protein [Anaeromyxobacter dehalogenans 2CP-1] gi|219953212|gb|ACL63596.1| iojap-like protein [Anaeromyxobacter dehalogenans 2CP-1] Length = 198 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + KAED+ ++ + D V+++ S + ++IAD++ +K + Sbjct: 100 DKKAEDVTVLDVR-GLTSYADYFVLMTADSDRQASAIADHVEQTMKAQ 146 >gi|197120646|ref|YP_002132597.1| iojap-like protein [Anaeromyxobacter sp. K] gi|196170495|gb|ACG71468.1| iojap-like protein [Anaeromyxobacter sp. K] Length = 198 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + KAED+ ++ + D V+++ S + ++IAD++ +K + Sbjct: 100 DKKAEDVTVLDVR-GLTSYADYFVLMTADSDRQASAIADHVEQTMKAQ 146 >gi|288906050|ref|YP_003431272.1| hypothetical protein GALLO_1859 [Streptococcus gallolyticus UCN34] gi|288732776|emb|CBI14350.1| conserved hypothetical protein [Streptococcus gallolyticus UCN34] Length = 117 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AED+ ++ + + D V+VS +T+ + +IA+N+ +K Sbjct: 2 DKKELLELVVKAADEKRAEDMVVLDLY-GLTSVTDYFVVVSAMNTRQLDAIAENIREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|319899267|ref|YP_004159360.1| hypothetical protein BARCL_1109 [Bartonella clarridgeiae 73] gi|319403231|emb|CBI76790.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 120 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++ L+ +KAEDI I+ RS + D MVI SG S +HV++I D L+ K Sbjct: 7 LKIILGSLENIKAEDIISIDL-QGRSSLADYMVIASGCSQRHVSAITDYLLHVWKD 61 >gi|319953848|ref|YP_004165115.1| iojap-like protein [Cellulophaga algicola DSM 14237] gi|319422508|gb|ADV49617.1| iojap-like protein [Cellulophaga algicola DSM 14237] Length = 124 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 36/66 (54%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + +D I+ ++E ++E+K +I ++ + + +CD +I +G S HV +I ++ Sbjct: 3 KKQTSVDELISFILEGIEEVKGNNISLLDLREIENTVCDYFIICNGTSNTHVNAIVGSIQ 62 Query: 71 SYLKKK 76 + KK Sbjct: 63 KTVSKK 68 >gi|297529314|ref|YP_003670589.1| iojap-like protein [Geobacillus sp. C56-T3] gi|297252566|gb|ADI26012.1| iojap-like protein [Geobacillus sp. C56-T3] Length = 118 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE+I + SL+ D VI G S K V +IA + ++ Sbjct: 4 QEALQLVVRAADDKKAENIVVLNM-KGISLVADYFVICHGNSDKQVQAIAREIQDQAEEH 62 >gi|86131624|ref|ZP_01050222.1| conserved hypothetical protein [Dokdonia donghaensis MED134] gi|85818069|gb|EAQ39237.1| conserved hypothetical protein [Dokdonia donghaensis MED134] Length = 123 Score = 68.6 bits (167), Expect = 3e-10, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 33/67 (49%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D IA ++E ++++K ++I ++ + + +CD +I G S V +I ++ Sbjct: 1 MANKEKNTDQLIAKIVEGIEDVKGQNIDILDLREIENTVCDYFIICDGTSNTQVGAIVNS 60 Query: 69 LISYLKK 75 + K Sbjct: 61 IQKTASK 67 >gi|125973753|ref|YP_001037663.1| iojap-like protein [Clostridium thermocellum ATCC 27405] gi|125713978|gb|ABN52470.1| iojap-like protein [Clostridium thermocellum ATCC 27405] Length = 113 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L+E KA+D+ I+ + S++ D VI SG ST H+ ++AD + + Sbjct: 2 ESRELVEKIVSILEEKKAKDLNIIDIREI-SILADYFVICSGTSTTHIKTLADEVEEKML 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|114769855|ref|ZP_01447465.1| iojap-related protein [alpha proteobacterium HTCC2255] gi|114549560|gb|EAU52442.1| iojap-related protein [alpha proteobacterium HTCC2255] Length = 155 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S + V+ L++ KAEDI I+ +S I D+MV+ SGRST+ VA+I + L S +K Sbjct: 46 SLLDLVLNSLQDDKAEDIVTIDL-KGKSSIADHMVVASGRSTRQVAAITEKLHSRIKD 102 >gi|319793380|ref|YP_004155020.1| iojap-like protein [Variovorax paradoxus EPS] gi|315595843|gb|ADU36909.1| iojap-like protein [Variovorax paradoxus EPS] Length = 229 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 +++ L+++KA+DI + T S + + +++ SG S + ++A ++ Sbjct: 7 AKKDTQKLQRAIIDGLEDVKAQDIQVFD-TEHLSPLFERVIVASGTSNRQTKALAASVRD 65 Query: 72 YLKK 75 +++ Sbjct: 66 AVRE 69 >gi|282599608|ref|ZP_06257321.1| iojap-like protein [Providencia rustigianii DSM 4541] gi|282568703|gb|EFB74238.1| iojap-like protein [Providencia rustigianii DSM 4541] Length = 108 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +++ L++ KAEDI I+ + +S + D M+I +G S++H+ S+AD LI +K+ Sbjct: 8 ELQKFIIDQLEDAKAEDIISIDV-NGKSSVTDQMIICTGTSSRHLMSVADRLIDACRKQ 65 >gi|51891574|ref|YP_074265.1| hypothetical protein STH436 [Symbiobacterium thermophilum IAM 14863] gi|51855263|dbj|BAD39421.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM 14863] Length = 113 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + KA D+ ++ S+ S++ D VI SG S HV +I D++ L KK Sbjct: 1 MAQWAAIAAEGKKARDVRILDIRSI-SVVADYFVICSGTSGTHVRAIVDHVEEELDKK 57 >gi|270263706|ref|ZP_06191975.1| hypothetical protein SOD_e03310 [Serratia odorifera 4Rx13] gi|270042590|gb|EFA15685.1| hypothetical protein SOD_e03310 [Serratia odorifera 4Rx13] Length = 105 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ + +LK +DI ++ +S I D M+I +G ST+HV SIA++++ + Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSTRHVMSIANHVVQEAR 60 >gi|255320875|ref|ZP_05362049.1| conserved hypothetical protein [Acinetobacter radioresistens SK82] gi|255302044|gb|EET81287.1| conserved hypothetical protein [Acinetobacter radioresistens SK82] Length = 117 Score = 68.2 bits (166), Expect = 3e-10, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + C+ V L ++KA+DI ++ +S+ S + D +VI SG ST+HV ++ADN Sbjct: 1 MNSQSQSVQECLKVVHNALTDVKAKDIIELDVSSI-SNVADAIVIASGTSTRHVKALADN 59 Query: 69 LISYLKK 75 + +K Sbjct: 60 VADEARK 66 >gi|238916941|ref|YP_002930458.1| hypothetical protein EUBELI_01010 [Eubacterium eligens ATCC 27750] gi|238872301|gb|ACR72011.1| hypothetical protein EUBELI_01010 [Eubacterium eligens ATCC 27750] Length = 116 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +++ L++ KAEDI I+ ++ S+I D VI SG +T + ++ DN+ Sbjct: 1 MADSKEMLKVIIDALQDKKAEDIRVIDISN-VSVIADYFVIASGSNTNQIQAMVDNVEEE 59 Query: 73 L 73 + Sbjct: 60 M 60 >gi|330686104|gb|EGG97725.1| iojap-like protein [Staphylococcus epidermidis VCU121] Length = 117 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + D + ++ + KAEDI + S + D V+ G + + V SIA + + Sbjct: 2 NSDKLLNIAVDAAENKKAEDIISLNM-QGISDMTDYFVVCHGNNERQVQSIARAVKEAVH 60 Query: 75 KKN 77 +++ Sbjct: 61 EQD 63 >gi|238023196|ref|ZP_04603622.1| hypothetical protein GCWU000324_03123 [Kingella oralis ATCC 51147] gi|237865579|gb|EEP66719.1| hypothetical protein GCWU000324_03123 [Kingella oralis ATCC 51147] Length = 129 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + +L+ A + L+++KA+DI + + ++ + M+I SG ST+ V ++A+N Sbjct: 1 MTEQQPNLEQMTAIAVNALEDIKAKDIIVLNTSD-KTSLFARMIIASGDSTRQVKALANN 59 Query: 69 LISYLKK 75 + LK+ Sbjct: 60 VAVDLKE 66 >gi|322833898|ref|YP_004213925.1| iojap-like protein [Rahnella sp. Y9602] gi|321169099|gb|ADW74798.1| iojap-like protein [Rahnella sp. Y9602] Length = 105 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ + +LKA+DI I+ +S I D M+I +G S++HV SIA +L+ +K Sbjct: 4 KALQDFVVDKVDDLKAQDIITIDV-KGKSSITDCMIICTGTSSRHVMSIAGHLVEEIK 60 >gi|315222445|ref|ZP_07864346.1| ribosome-associated protein, iojap family [Streptococcus anginosus F0211] gi|315188469|gb|EFU22183.1| ribosome-associated protein, iojap family [Streptococcus anginosus F0211] Length = 121 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + Sbjct: 2 DKKELLEIVVKAADEKRAEDITVLDLQE-LTTMTDYFVIASSMNSRQLEAIADNIREKVT 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|121609579|ref|YP_997386.1| iojap-like protein [Verminephrobacter eiseniae EF01-2] gi|121554219|gb|ABM58368.1| iojap-like protein [Verminephrobacter eiseniae EF01-2] Length = 233 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 12/74 (16%), Positives = 35/74 (47%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + +L +++ L+++KA+DI T S + + +++ SG S + Sbjct: 1 MTASTPSETAARKNLAKLQRAIVDGLQDVKAQDIQVFN-TEHLSPLFERVIVASGSSNRQ 59 Query: 62 VASIADNLISYLKK 75 ++A ++ +++ Sbjct: 60 TKALAASVRDAVRE 73 >gi|291550378|emb|CBL26640.1| iojap-related protein [Ruminococcus torques L2-14] Length = 118 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L + K EDI I+ S S++ D +IV+G S V ++ DN+ Sbjct: 1 MNQSKEMAKLAYTALSDKKGEDIQIIDI-SGVSVLADYFLIVNGNSDSQVNALVDNVEEE 59 Query: 73 LKK 75 L K Sbjct: 60 LHK 62 >gi|325290558|ref|YP_004266739.1| iojap-like protein [Syntrophobotulus glycolicus DSM 8271] gi|324965959|gb|ADY56738.1| iojap-like protein [Syntrophobotulus glycolicus DSM 8271] Length = 115 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + V + + + K DI ++ S + D +IV+G + +I ++L Sbjct: 1 MELSQKKLKIVTDYILDKKGHDIVVLDLR-GISAVTDYFIIVTGNTPIQTKAITEHLQEK 59 Query: 73 LKKK 76 K++ Sbjct: 60 FKEE 63 >gi|227543940|ref|ZP_03973989.1| iojap family protein [Lactobacillus reuteri CF48-3A] gi|300909689|ref|ZP_07127150.1| iojap-like protein [Lactobacillus reuteri SD2112] gi|227186091|gb|EEI66162.1| iojap family protein [Lactobacillus reuteri CF48-3A] gi|300893554|gb|EFK86913.1| iojap-like protein [Lactobacillus reuteri SD2112] Length = 118 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AEDI ++ S + D VI++G S + V +I + ++ Sbjct: 2 DSKQLLEMVVKAADGRRAEDIVALKV-DEISPMADYFVIMTGGSDRQVQAITNAIVEKAH 60 Query: 75 KKN 77 ++N Sbjct: 61 EEN 63 >gi|16759601|ref|NP_455218.1| hypothetical protein STY0693 [Salmonella enterica subsp. enterica serovar Typhi str. CT18] gi|16764019|ref|NP_459634.1| hypothetical protein STM0642 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|29142626|ref|NP_805968.1| hypothetical protein t2225 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56414223|ref|YP_151298.1| hypothetical protein SPA2092 [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|62179242|ref|YP_215659.1| hypothetical protein SC0672 [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|161504183|ref|YP_001571295.1| hypothetical protein SARI_02290 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980] gi|161615142|ref|YP_001589107.1| hypothetical protein SPAB_02910 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|167550822|ref|ZP_02344578.1| iojap family protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|168231655|ref|ZP_02656713.1| iojap family protein [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|168236634|ref|ZP_02661692.1| iojap family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|168240490|ref|ZP_02665422.1| iojap family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|168264427|ref|ZP_02686400.1| iojap family protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|168465817|ref|ZP_02699699.1| iojap family protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|194442305|ref|YP_002039884.1| hypothetical protein SNSL254_A0698 [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194447899|ref|YP_002044676.1| hypothetical protein SeHA_C0758 [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194469120|ref|ZP_03075104.1| iojap family protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194737621|ref|YP_002113760.1| hypothetical protein SeSA_A0802 [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|197251574|ref|YP_002145617.1| hypothetical protein SeAg_B0684 [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197263349|ref|ZP_03163423.1| iojap family protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197363146|ref|YP_002142783.1| hypothetical protein SSPA1944 [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|200389876|ref|ZP_03216487.1| iojap family protein [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|204930511|ref|ZP_03221441.1| iojap family protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|205351930|ref|YP_002225731.1| hypothetical protein SG0646 [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|207856108|ref|YP_002242759.1| hypothetical protein SEN0611 [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|213421249|ref|ZP_03354315.1| hypothetical protein Salmonentericaenterica_27359 [Salmonella enterica subsp. enterica serovar Typhi str. E01-6750] gi|213425095|ref|ZP_03357845.1| hypothetical protein SentesTyphi_04990 [Salmonella enterica subsp. enterica serovar Typhi str. E02-1180] gi|213621294|ref|ZP_03374077.1| hypothetical protein SentesTyp_28792 [Salmonella enterica subsp. enterica serovar Typhi str. E98-2068] gi|213649159|ref|ZP_03379212.1| hypothetical protein SentesTy_18858 [Salmonella enterica subsp. enterica serovar Typhi str. J185] gi|213857668|ref|ZP_03384639.1| hypothetical protein SentesT_21236 [Salmonella enterica subsp. enterica serovar Typhi str. M223] gi|224582478|ref|YP_002636276.1| hypothetical protein SPC_0658 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|238911592|ref|ZP_04655429.1| hypothetical protein SentesTe_10702 [Salmonella enterica subsp. enterica serovar Tennessee str. CDC07-0191] gi|289823660|ref|ZP_06543272.1| hypothetical protein Salmonellentericaenterica_00155 [Salmonella enterica subsp. enterica serovar Typhi str. E98-3139] gi|25302199|pir||AE0581 conserved hypothetical protein STY0693 [imported] - Salmonella enterica subsp. enterica serovar Typhi (strain CT18) gi|16419154|gb|AAL19593.1| putative ACR, homolog of plant Iojap protein [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] gi|16501893|emb|CAD05119.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi] gi|29138257|gb|AAO69828.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhi str. Ty2] gi|56128480|gb|AAV77986.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150] gi|62126875|gb|AAX64578.1| putative ACR, homolog of plant Iojap protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] gi|160865530|gb|ABX22153.1| hypothetical protein SARI_02290 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:--] gi|161364506|gb|ABX68274.1| hypothetical protein SPAB_02910 [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7] gi|194400968|gb|ACF61190.1| iojap family protein [Salmonella enterica subsp. enterica serovar Newport str. SL254] gi|194406203|gb|ACF66422.1| iojap family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL476] gi|194455484|gb|EDX44323.1| iojap family protein [Salmonella enterica subsp. enterica serovar Kentucky str. CVM29188] gi|194713123|gb|ACF92344.1| iojap family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633] gi|195631633|gb|EDX50153.1| iojap family protein [Salmonella enterica subsp. enterica serovar Newport str. SL317] gi|197094623|emb|CAR60145.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601] gi|197215277|gb|ACH52674.1| iojap family protein [Salmonella enterica subsp. enterica serovar Agona str. SL483] gi|197241604|gb|EDY24224.1| iojap family protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA23] gi|197290375|gb|EDY29731.1| iojap family protein [Salmonella enterica subsp. enterica serovar Schwarzengrund str. SL480] gi|199602321|gb|EDZ00867.1| iojap family protein [Salmonella enterica subsp. enterica serovar Virchow str. SL491] gi|204320445|gb|EDZ05648.1| iojap family protein [Salmonella enterica subsp. enterica serovar Javiana str. GA_MM04042433] gi|205271711|emb|CAR36542.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91] gi|205324185|gb|EDZ12024.1| iojap family protein [Salmonella enterica subsp. enterica serovar Saintpaul str. SARA29] gi|205334012|gb|EDZ20776.1| iojap family protein [Salmonella enterica subsp. enterica serovar Kentucky str. CDC 191] gi|205340431|gb|EDZ27195.1| iojap family protein [Salmonella enterica subsp. enterica serovar Heidelberg str. SL486] gi|205347120|gb|EDZ33751.1| iojap family protein [Salmonella enterica subsp. enterica serovar Hadar str. RI_05P066] gi|206707911|emb|CAR32199.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Enteritidis str. P125109] gi|224467005|gb|ACN44835.1| hypothetical protein SPC_0658 [Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594] gi|261245915|emb|CBG23716.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. D23580] gi|267992377|gb|ACY87262.1| hypothetical protein STM14_0750 [Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S] gi|301157243|emb|CBW16730.1| conserved hypothetical protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|312911673|dbj|BAJ35647.1| hypothetical protein STMDT12_C07040 [Salmonella enterica subsp. enterica serovar Typhimurium str. T000240] gi|320084912|emb|CBY94702.1| Uncharacterized protein C7orf30 [Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1] gi|321226222|gb|EFX51273.1| Iojap protein [Salmonella enterica subsp. enterica serovar Typhimurium str. TN061786] gi|322613226|gb|EFY10169.1| hypothetical protein SEEM315_19613 [Salmonella enterica subsp. enterica serovar Montevideo str. 315996572] gi|322621294|gb|EFY18151.1| hypothetical protein SEEM971_13051 [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-1] gi|322623714|gb|EFY20552.1| hypothetical protein SEEM973_15976 [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-3] gi|322628986|gb|EFY25765.1| hypothetical protein SEEM974_08553 [Salmonella enterica subsp. enterica serovar Montevideo str. 495297-4] gi|322631708|gb|EFY28462.1| hypothetical protein SEEM201_07729 [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-1] gi|322637556|gb|EFY34258.1| hypothetical protein SEEM202_20919 [Salmonella enterica subsp. enterica serovar Montevideo str. 515920-2] gi|322641896|gb|EFY38526.1| hypothetical protein SEEM954_12577 [Salmonella enterica subsp. enterica serovar Montevideo str. 531954] gi|322646740|gb|EFY43246.1| hypothetical protein SEEM054_11581 [Salmonella enterica subsp. enterica serovar Montevideo str. NC_MB110209-0054] gi|322651441|gb|EFY47821.1| hypothetical protein SEEM675_09806 [Salmonella enterica subsp. enterica serovar Montevideo str. OH_2009072675] gi|322653108|gb|EFY49442.1| hypothetical protein SEEM965_04956 [Salmonella enterica subsp. enterica serovar Montevideo str. CASC_09SCPH15965] gi|322658828|gb|EFY55083.1| hypothetical protein SEEM19N_21571 [Salmonella enterica subsp. enterica serovar Montevideo str. 19N] gi|322664902|gb|EFY61095.1| hypothetical protein SEEM801_08317 [Salmonella enterica subsp. enterica serovar Montevideo str. 81038-01] gi|322668904|gb|EFY65056.1| hypothetical protein SEEM507_02216 [Salmonella enterica subsp. enterica serovar Montevideo str. MD_MDA09249507] gi|322670590|gb|EFY66723.1| hypothetical protein SEEM877_05272 [Salmonella enterica subsp. enterica serovar Montevideo str. 414877] gi|322675331|gb|EFY71407.1| hypothetical protein SEEM867_10463 [Salmonella enterica subsp. enterica serovar Montevideo str. 366867] gi|322682198|gb|EFY78223.1| hypothetical protein SEEM180_18153 [Salmonella enterica subsp. enterica serovar Montevideo str. 413180] gi|322684972|gb|EFY80969.1| hypothetical protein SEEM600_20127 [Salmonella enterica subsp. enterica serovar Montevideo str. 446600] gi|322713707|gb|EFZ05278.1| Iojap-related protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. A50] gi|323128959|gb|ADX16389.1| Uncharacterized protein ybeB [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] gi|323193969|gb|EFZ79171.1| hypothetical protein SEEM581_03445 [Salmonella enterica subsp. enterica serovar Montevideo str. 609458-1] gi|323197939|gb|EFZ83061.1| hypothetical protein SEEM501_19624 [Salmonella enterica subsp. enterica serovar Montevideo str. 556150-1] gi|323202014|gb|EFZ87074.1| hypothetical protein SEEM460_10188 [Salmonella enterica subsp. enterica serovar Montevideo str. 609460] gi|323207147|gb|EFZ92100.1| hypothetical protein SEEM020_04354 [Salmonella enterica subsp. enterica serovar Montevideo str. 507440-20] gi|323213976|gb|EFZ98743.1| hypothetical protein SEEM6152_09198 [Salmonella enterica subsp. enterica serovar Montevideo str. 556152] gi|323214326|gb|EFZ99077.1| hypothetical protein SEEM0077_16810 [Salmonella enterica subsp. enterica serovar Montevideo str. MB101509-0077] gi|323219269|gb|EGA03760.1| hypothetical protein SEEM0047_14921 [Salmonella enterica subsp. enterica serovar Montevideo str. MB102109-0047] gi|323225520|gb|EGA09750.1| hypothetical protein SEEM0055_15720 [Salmonella enterica subsp. enterica serovar Montevideo str. MB110209-0055] gi|323231079|gb|EGA15195.1| hypothetical protein SEEM0052_17928 [Salmonella enterica subsp. enterica serovar Montevideo str. MB111609-0052] gi|323234089|gb|EGA18178.1| hypothetical protein SEEM3312_08763 [Salmonella enterica subsp. enterica serovar Montevideo str. 2009083312] gi|323238216|gb|EGA22274.1| hypothetical protein SEEM5258_08142 [Salmonella enterica subsp. enterica serovar Montevideo str. 2009085258] gi|323242550|gb|EGA26574.1| hypothetical protein SEEM1156_10328 [Salmonella enterica subsp. enterica serovar Montevideo str. 315731156] gi|323248473|gb|EGA32407.1| ribosome-associated protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2009159199] gi|323251312|gb|EGA35184.1| ribosome-associated protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008282] gi|323259239|gb|EGA42882.1| ribosome-associated protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008283] gi|323261647|gb|EGA45222.1| hypothetical protein SEEM8284_22489 [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008284] gi|323264829|gb|EGA48330.1| ribosome-associated protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008285] gi|323272334|gb|EGA55741.1| ribosome-associated protein [Salmonella enterica subsp. enterica serovar Montevideo str. IA_2010008287] gi|326626969|gb|EGE33312.1| hypothetical protein SG9_0657 [Salmonella enterica subsp. enterica serovar Gallinarum str. 9] gi|332987587|gb|AEF06570.1| hypothetical protein STMUK_0647 [Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1] Length = 105 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQ 57 >gi|153001824|ref|YP_001367505.1| iojap-like protein [Shewanella baltica OS185] gi|160876557|ref|YP_001555873.1| iojap-like protein [Shewanella baltica OS195] gi|151366442|gb|ABS09442.1| iojap-like protein [Shewanella baltica OS185] gi|160862079|gb|ABX50613.1| iojap-like protein [Shewanella baltica OS195] Length = 114 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 V++ + +LKA D+ ++ + +S I D MVI SG S HV +IA+NL+ KK Sbjct: 10 ELKQFVVDKIDDLKARDVVVLDVSK-QSNITDYMVICSGTSKTHVKAIAENLVVEAKK 66 >gi|260219513|emb|CBA26358.1| hypothetical protein Csp_E34460 [Curvibacter putative symbiont of Hydra magnipapillata] Length = 239 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 A + V++ L+++KA+DI + T S + + ++I SG S + ++A ++ Sbjct: 7 AKNTQKLQRAVVDGLEDVKAQDIVVFD-TEHLSALFERVIIASGTSNRQTKALAASVRDA 65 Query: 73 LKK 75 +++ Sbjct: 66 VRE 68 >gi|306834202|ref|ZP_07467322.1| iojap-like protein [Streptococcus bovis ATCC 700338] gi|325979015|ref|YP_004288731.1| iojap-like protein [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] gi|304423775|gb|EFM26921.1| iojap-like protein [Streptococcus bovis ATCC 700338] gi|325178943|emb|CBZ48987.1| iojap-like protein [Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069] Length = 117 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AED+ ++ + + D V+VS +T+ + +IA+N+ +K Sbjct: 2 DKKELLELVVKAADEKRAEDMVVLDLY-GLTSVTDYFVVVSAMNTRQLDAIAENIREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|190571258|ref|YP_001975616.1| iojap-related protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|213018656|ref|ZP_03334464.1| iojap-related protein [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|190357530|emb|CAQ54967.1| iojap-related protein [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|212995607|gb|EEB56247.1| iojap-related protein [Wolbachia endosymbiont of Culex quinquefasciatus JHB] Length = 105 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +S T+++ + + K +DI + + +++I M+I SG S++HV ++A++++ LK Sbjct: 4 DTESIKNTIVDVIDQNKGQDIVTFDVQN-KTVIAKYMIIASGDSSRHVKALAEHVMKNLK 62 Query: 75 K 75 + Sbjct: 63 Q 63 >gi|229918240|ref|YP_002886886.1| iojap-like protein [Exiguobacterium sp. AT1b] gi|229469669|gb|ACQ71441.1| iojap-like protein [Exiguobacterium sp. AT1b] Length = 115 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + +AE+I ++ S I D VI G S K V +IA + Sbjct: 2 TAREELELIVKAADDKRAEEIVVLDM-EGISPIADYFVICHGNSEKQVEAIAREIKDVAG 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|157369446|ref|YP_001477435.1| hypothetical protein Spro_1203 [Serratia proteamaculans 568] gi|157321210|gb|ABV40307.1| iojap-like protein [Serratia proteamaculans 568] Length = 105 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI ++ +S I D M+I +G ST+HV SIA++++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSTRHVMSIANHVVQE 58 >gi|315127069|ref|YP_004069072.1| hypothetical protein PSM_A1998 [Pseudoalteromonas sp. SM9913] gi|315015583|gb|ADT68921.1| hypothetical protein PSM_A1998 [Pseudoalteromonas sp. SM9913] Length = 105 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A ++ + ++KA D+ ++ T S + D M++ SG S +HV SIADNL + Sbjct: 2 DSKQLLAFALDKIDDMKARDVIQLDVT-GSSDVTDYMIVCSGTSRRHVLSIADNLAKEAR 60 >gi|196248987|ref|ZP_03147687.1| iojap-like protein [Geobacillus sp. G11MC16] gi|196211863|gb|EDY06622.1| iojap-like protein [Geobacillus sp. G11MC16] Length = 118 Score = 68.2 bits (166), Expect = 4e-10, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE+I + SL+ D VI G S K V +IA + ++ Sbjct: 4 QEALQLVVRAADDKKAENIVVLNM-KGISLVADYFVICHGNSDKQVQAIAREIQDQAEEN 62 >gi|92113667|ref|YP_573595.1| Iojap-related protein [Chromohalobacter salexigens DSM 3043] gi|91796757|gb|ABE58896.1| Iojap-related protein [Chromohalobacter salexigens DSM 3043] Length = 123 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ VM L+ELKA D+ ++ S + + D M++ SG S++HV ++A++++ +K Sbjct: 2 QTEALKTLVMNTLEELKARDVAELDVAS-LTSVTDTMIVASGTSSRHVGALAESVVESVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|253999880|ref|YP_003051943.1| iojap-like protein [Methylovorus sp. SIP3-4] gi|253986559|gb|ACT51416.1| iojap-like protein [Methylovorus sp. SIP3-4] Length = 120 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 L++ V++ L+++KA DI ++ + + + M++ S ST+ ++ADN+ Sbjct: 1 MLELEAMKLAVIDALEDIKAFDITVMDVRK-LTSMTNYMIVASANSTRQAKAVADNVREK 59 Query: 73 LKKK 76 L++K Sbjct: 60 LREK 63 >gi|319946398|ref|ZP_08020635.1| Iojap protein family protein [Streptococcus australis ATCC 700641] gi|319747366|gb|EFV99622.1| Iojap protein family protein [Streptococcus australis ATCC 700641] Length = 117 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ S + + D VI S +++ + +IA+N+ + Sbjct: 4 KELLELVVKAADEKRAEDIVALDVQS-LTSVTDYFVIASSMNSRQLEAIAENIREKV 59 >gi|294668166|ref|ZP_06733273.1| iojap-like protein [Neisseria elongata subsp. glycolytica ATCC 29315] gi|291309874|gb|EFE51117.1| iojap-like protein [Neisseria elongata subsp. glycolytica ATCC 29315] Length = 133 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+++KA+DI +E T ++ + M+I SG S++ V ++A+N+ Sbjct: 8 QELQDLQKMVEIAVSALEDVKAKDIAVLE-TQDKTSLFARMIIASGDSSRQVKALANNVA 66 Query: 71 SYLKK 75 LK+ Sbjct: 67 VDLKE 71 >gi|104783769|ref|YP_610267.1| hypothetical protein PSEEN4828 [Pseudomonas entomophila L48] gi|95112756|emb|CAK17484.1| conserved hypothetical protein [Pseudomonas entomophila L48] Length = 142 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + L+++KA+DI I+ + + D M+I +G S + + ++ + + +K K Sbjct: 12 EELVELTKAALEDVKAQDIQVIDVRD-KHSLTDYMIIATGTSNRQINAMLEKVREAVKAK 70 >gi|239637597|ref|ZP_04678569.1| iojap homolog [Staphylococcus warneri L37603] gi|239596815|gb|EEQ79340.1| iojap homolog [Staphylococcus warneri L37603] Length = 117 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + D + ++ + KAEDI + S + D V+ G + + V SIA + + Sbjct: 2 NSDKLLNIAVDAAENKKAEDIISLNM-QGISDMTDYFVVCHGNNERQVQSIAKAVKEAVH 60 Query: 75 KKN 77 +++ Sbjct: 61 EQD 63 >gi|307150000|ref|YP_003885384.1| iojap-like protein [Cyanothece sp. PCC 7822] gi|306980228|gb|ADN12109.1| iojap-like protein [Cyanothece sp. PCC 7822] Length = 144 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + T+ + + K DI ++ + S + D +IV+G S V +I+D + Sbjct: 21 EADKKTSRLAWTIAQAADDRKGADIVALDVSD-VSYLSDYFIIVTGFSRTQVRAISDAIE 79 Query: 71 SYL 73 Sbjct: 80 EKA 82 >gi|85713007|ref|ZP_01044045.1| Uncharacterized conserved protein, Iojap family protein [Idiomarina baltica OS145] gi|85693176|gb|EAQ31136.1| Uncharacterized conserved protein, Iojap family protein [Idiomarina baltica OS145] Length = 106 Score = 67.8 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ V++ + +LK DI ++ ++ + D MVI SG S HV SIA+ + + K Sbjct: 2 QVEQLREFVIDKVDDLKGRDIQVLDV-HGKTDVADYMVICSGNSKTHVKSIAEYVATQAK 60 >gi|296876991|ref|ZP_06901035.1| iojap-like protein [Streptococcus parasanguinis ATCC 15912] gi|296432026|gb|EFH17829.1| iojap-like protein [Streptococcus parasanguinis ATCC 15912] Length = 117 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ S + + D VI S +++ + +IA+N+ + Sbjct: 4 KELLELVVKAADEKRAEDIVALDVQS-LTSVTDYFVIASSMNSRQLEAIAENIREKV 59 >gi|315607708|ref|ZP_07882702.1| iojap-like protein [Prevotella buccae ATCC 33574] gi|315250644|gb|EFU30639.1| iojap-like protein [Prevotella buccae ATCC 33574] Length = 130 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 30/70 (42%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K L + + + E ++E K I + + I + VI G S V +IA Sbjct: 6 KHNLNLMEETKQLVDIITEGIQEKKGSGIVIADLREIEGSIANYFVICQGSSPAQVEAIA 65 Query: 67 DNLISYLKKK 76 +++ + +KK Sbjct: 66 ESVSDFARKK 75 >gi|169634362|ref|YP_001708098.1| hypothetical protein ABSDF2949 [Acinetobacter baumannii SDF] gi|169797177|ref|YP_001714970.1| hypothetical protein ABAYE3189 [Acinetobacter baumannii AYE] gi|293610385|ref|ZP_06692686.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|169150104|emb|CAM87998.1| conserved hypothetical protein [Acinetobacter baumannii AYE] gi|169153154|emb|CAP02239.1| conserved hypothetical protein [Acinetobacter baumannii] gi|292827617|gb|EFF85981.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|322506791|gb|ADX02245.1| Putative uncharacterized protein [Acinetobacter baumannii 1656-2] gi|323516660|gb|ADX91041.1| hypothetical protein ABTW07_0604 [Acinetobacter baumannii TCDC-AB0715] gi|325124541|gb|ADY84064.1| hypothetical protein BDGL_003478 [Acinetobacter calcoaceticus PHEA-2] Length = 117 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + +C+ V + L ++KA+DI ++ +S+ S + D +VI SG ST+HV ++ADN Sbjct: 1 MNTSNKDVQACLKVVHDALVDVKAKDILQLDVSSI-SNVADAIVIASGTSTRHVKALADN 59 Query: 69 LISYLKK 75 + +K Sbjct: 60 VAEEARK 66 >gi|330828599|ref|YP_004391551.1| iojap-like protein [Aeromonas veronii B565] gi|328803735|gb|AEB48934.1| iojap-like protein [Aeromonas veronii B565] Length = 113 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A +++ + ++K DI ++ +S I D M+I SG S++HV++IA +L S + Sbjct: 4 QELHAFIIDKIDDMKGRDIITLDVR-GKSSITDTMIICSGNSSRHVSAIAHHLASEAR 60 >gi|306832090|ref|ZP_07465244.1| iojap-like protein [Streptococcus gallolyticus subsp. gallolyticus TX20005] gi|304425529|gb|EFM28647.1| iojap-like protein [Streptococcus gallolyticus subsp. gallolyticus TX20005] Length = 117 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AED+ ++ + + D V+VS +T+ + +IA+N+ +K Sbjct: 2 DKKELLELVVKAADEKRAEDMVVLDLY-GLTSVTDYFVVVSAMNTRQLDAIAENIREKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|297539337|ref|YP_003675106.1| iojap-like protein [Methylotenera sp. 301] gi|297258684|gb|ADI30529.1| iojap-like protein [Methylotenera sp. 301] Length = 125 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++L++ V++ ++++K DI ++ + + M++ S S++ +IADN+ Sbjct: 5 VNAVNYLETMKQAVIDAIEDIKGFDITPMDVRK-LTSMTSYMIVASATSSRQAKAIADNV 63 Query: 70 ISYLKKK 76 LK+K Sbjct: 64 REKLKEK 70 >gi|284044128|ref|YP_003394468.1| iojap-like protein [Conexibacter woesei DSM 14684] gi|283948349|gb|ADB51093.1| iojap-like protein [Conexibacter woesei DSM 14684] Length = 124 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 A + E + KA DI ++ + D V+ SG + + V +I D + +K+ Sbjct: 9 SDMAAAIAEYADDRKAIDIVELDLRGVLGY-ADYFVVCSGNTDRQVKAIHDGIHMEMKRT 67 Query: 77 N 77 + Sbjct: 68 H 68 >gi|302879869|ref|YP_003848433.1| iojap-like protein [Gallionella capsiferriformans ES-2] gi|302582658|gb|ADL56669.1| iojap-like protein [Gallionella capsiferriformans ES-2] Length = 120 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V+ L+++KA DI I+ TS S + D M+I S ST+ ++ADN++ Sbjct: 1 MLTTEEKTLAVVAALEDIKATDITVID-TSKLSSLFDRMIIASATSTRQTKALADNVVVK 59 Query: 73 LKK 75 LK+ Sbjct: 60 LKE 62 >gi|121635680|ref|YP_975925.1| hypothetical protein NMC2002 [Neisseria meningitidis FAM18] gi|161869179|ref|YP_001598345.1| hypothetical protein NMCC_0176 [Neisseria meningitidis 053442] gi|254804165|ref|YP_003082386.1| hypothetical protein NMO_0143 [Neisseria meningitidis alpha14] gi|261378680|ref|ZP_05983253.1| iojap-like protein [Neisseria cinerea ATCC 14685] gi|261401916|ref|ZP_05988041.1| iojap-like protein [Neisseria lactamica ATCC 23970] gi|304388636|ref|ZP_07370699.1| iojap-like protein [Neisseria meningitidis ATCC 13091] gi|313667700|ref|YP_004047984.1| hypothetical protein NLA_3540 [Neisseria lactamica ST-640] gi|120867386|emb|CAM11158.1| hypothetical protein NMC2002 [Neisseria meningitidis FAM18] gi|161594732|gb|ABX72392.1| conserved hypothetical protein [Neisseria meningitidis 053442] gi|254667707|emb|CBA03577.1| conserved hypothetical protein [Neisseria meningitidis alpha14] gi|254670379|emb|CBA05876.1| conserved hypothetical protein [Neisseria meningitidis alpha153] gi|254673716|emb|CBA09350.1| conserved hypothetical protein [Neisseria meningitidis alpha275] gi|261393349|emb|CAX50985.1| conserved hypothetical protein [Neisseria meningitidis 8013] gi|269145026|gb|EEZ71444.1| iojap-like protein [Neisseria cinerea ATCC 14685] gi|269207917|gb|EEZ74372.1| iojap-like protein [Neisseria lactamica ATCC 23970] gi|304337408|gb|EFM03579.1| iojap-like protein [Neisseria meningitidis ATCC 13091] gi|308390121|gb|ADO32441.1| hypothetical protein NMBB_2319 [Neisseria meningitidis alpha710] gi|313005162|emb|CBN86594.1| conserved hypothetical protein [Neisseria lactamica 020-06] gi|325127301|gb|EGC50236.1| hypothetical protein NMXN1568_1889 [Neisseria meningitidis N1568] gi|325129334|gb|EGC52169.1| hypothetical protein NMBOX9930304_1841 [Neisseria meningitidis OX99.30304] gi|325131266|gb|EGC53977.1| hypothetical protein NMBM6190_1942 [Neisseria meningitidis M6190] gi|325133351|gb|EGC56016.1| hypothetical protein NMBM13399_2018 [Neisseria meningitidis M13399] gi|325135418|gb|EGC58038.1| hypothetical protein NMBM0579_1917 [Neisseria meningitidis M0579] gi|325137293|gb|EGC59881.1| hypothetical protein NMBES14902_1919 [Neisseria meningitidis ES14902] gi|325141420|gb|EGC63898.1| hypothetical protein NMB9615945_1964 [Neisseria meningitidis 961-5945] gi|325143581|gb|EGC65901.1| hypothetical protein NMBM01240013_1978 [Neisseria meningitidis M01-240013] gi|325199114|gb|ADY94570.1| conserved hypothetical protein [Neisseria meningitidis G2136] gi|325201339|gb|ADY96793.1| conserved hypothetical protein [Neisseria meningitidis M01-240149] gi|325204973|gb|ADZ00427.1| conserved hypothetical protein [Neisseria meningitidis M01-240355] gi|325206928|gb|ADZ02381.1| conserved hypothetical protein [Neisseria meningitidis M04-240196] gi|325208875|gb|ADZ04327.1| conserved hypothetical protein [Neisseria meningitidis NZ-05/33] Length = 128 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+++KA+DI +E T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVGVAVNALEDIKAKDISVLE-TQDKTSLFARMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|85058777|ref|YP_454479.1| hypothetical protein SG0799 [Sodalis glossinidius str. 'morsitans'] gi|84779297|dbj|BAE74074.1| conserved hypothetical protein [Sodalis glossinidius str. 'morsitans'] Length = 105 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 V++ + +LK +DI ++ +S I D MVI +G S++HV SIA++++ Sbjct: 6 LKDFVVDKIDDLKGQDIITLDVR-GKSSITDCMVICTGTSSRHVMSIANHVVQA 58 >gi|226954331|ref|ZP_03824795.1| iojap-like protein [Acinetobacter sp. ATCC 27244] gi|226834909|gb|EEH67292.1| iojap-like protein [Acinetobacter sp. ATCC 27244] Length = 142 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 25/74 (33%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Query: 3 ANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +N+ + T++ + +C+ V E L ++KA+DI ++ +S+ S + D +VI SG ST+H Sbjct: 20 SNSHDLKITTSNKDVHACLKVVHEALTDVKAKDILELDVSSI-SNVADAIVIASGTSTRH 78 Query: 62 VASIADNLISYLKK 75 V ++ADN+ +K Sbjct: 79 VKALADNVADEARK 92 >gi|327404645|ref|YP_004345483.1| iojap-like protein [Fluviicola taffensis DSM 16823] gi|327320153|gb|AEA44645.1| iojap-like protein [Fluviicola taffensis DSM 16823] Length = 135 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 4/80 (5%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 +L N L+ ++E ++E KA+DI ++ ++ S + D VI SG S+ Sbjct: 5 VLTNLRMYKLKNDIDSKVLCDAIIEGMQENKAKDIVVLDLRNISSAVTDFFVICSGESSV 64 Query: 61 HVASIADNL----ISYLKKK 76 V IA + LK+K Sbjct: 65 QVDGIASTVARHTRKELKEK 84 >gi|300774825|ref|ZP_07084688.1| iojap-like protein [Chryseobacterium gleum ATCC 35910] gi|300506640|gb|EFK37775.1| iojap-like protein [Chryseobacterium gleum ATCC 35910] Length = 121 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 36/67 (53%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + I ++E ++++K EDI + +++ + + + VI SG S VA++A ++ Sbjct: 1 MNKTAEKQALIDKIVEAIQDVKGEDIMIFDLSNIENSVAETFVICSGNSNTQVAALAGSV 60 Query: 70 ISYLKKK 76 ++ + Sbjct: 61 EKKVRNE 67 >gi|76798913|ref|ZP_00781118.1| iojap protein family [Streptococcus agalactiae 18RS21] gi|76585733|gb|EAO62286.1| iojap protein family [Streptococcus agalactiae 18RS21] Length = 117 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K Sbjct: 3 KDLLQLVVKAADEKRAEDIVILDL-QPVTSVADYFVIMSASNSRQLEAIADNIREQVK 59 >gi|59711357|ref|YP_204133.1| hypothetical protein VF_0750 [Vibrio fischeri ES114] gi|59479458|gb|AAW85245.1| predicted protein [Vibrio fischeri ES114] Length = 107 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++KAE+I ++ +S I D M++ +G S +HV+SIA N+ K+ Sbjct: 6 KELHDFLFNNVDDMKAENITTLDVR-GKSSITDFMIVCTGTSKRHVSSIASNVSDKAKE 63 >gi|223932244|ref|ZP_03624248.1| iojap-like protein [Streptococcus suis 89/1591] gi|302023397|ref|ZP_07248608.1| hypothetical protein Ssui0_01736 [Streptococcus suis 05HAS68] gi|330832209|ref|YP_004401034.1| iojap-like protein [Streptococcus suis ST3] gi|223899225|gb|EEF65582.1| iojap-like protein [Streptococcus suis 89/1591] gi|329306432|gb|AEB80848.1| iojap-like protein [Streptococcus suis ST3] Length = 119 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ + +AED+ I+ + + D VI S +++ + +IA+N+ + + Sbjct: 5 DLVKVVVQAADDKRAEDLVVIDV-QGVTSLTDYFVIASSMNSRQLEAIAENIREKVAE 61 >gi|117618695|ref|YP_857743.1| iojap superfamily protein [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117560102|gb|ABK37050.1| iojap protein family [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 113 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A +++ + ++K DI ++ +S I D M++ SG S++HV++IA +L S + Sbjct: 4 QELHAFIVDKIDDMKGRDIITLDVR-GKSSITDTMIVCSGNSSRHVSAIAHHLASEAR 60 >gi|299141874|ref|ZP_07035009.1| iojap-like protein [Prevotella oris C735] gi|298576725|gb|EFI48596.1| iojap-like protein [Prevotella oris C735] Length = 119 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA----DN 68 + + + T+ + ++E K +DI I+ + I +I G S + +IA D Sbjct: 1 METTEKLVETITKGIQEKKGKDITIIDLKHIDGAIAKYFIICQGNSPTQIEAIAGSISDT 60 Query: 69 LISYLKKK 76 + LK+K Sbjct: 61 VREDLKEK 68 >gi|171058632|ref|YP_001790981.1| iojap-like protein [Leptothrix cholodnii SP-6] gi|170776077|gb|ACB34216.1| iojap-like protein [Leptothrix cholodnii SP-6] Length = 250 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++K +DI T S + + +V+ SG S + ++A ++ ++ Sbjct: 2 DIRKLQRAIVDGLEDVKGQDIVVFN-TEHLSALFERVVVASGTSNRQTKALAASVRDAVR 60 Query: 75 K 75 Sbjct: 61 D 61 >gi|22537799|ref|NP_688650.1| iojap-related protein [Streptococcus agalactiae 2603V/R] gi|76788208|ref|YP_330273.1| iojap-related protein [Streptococcus agalactiae A909] gi|77406248|ref|ZP_00783316.1| iojap-related protein [Streptococcus agalactiae H36B] gi|77408252|ref|ZP_00784995.1| iojap-related protein [Streptococcus agalactiae COH1] gi|22534692|gb|AAN00523.1|AE014267_6 iojap-related protein [Streptococcus agalactiae 2603V/R] gi|76563265|gb|ABA45849.1| iojap-related protein [Streptococcus agalactiae A909] gi|77173110|gb|EAO76236.1| iojap-related protein [Streptococcus agalactiae COH1] gi|77175151|gb|EAO77952.1| iojap-related protein [Streptococcus agalactiae H36B] Length = 118 Score = 67.8 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K Sbjct: 4 KDLLQLVVKAADEKRAEDIVILDL-QPVTSVADYFVIMSASNSRQLEAIADNIREQVK 60 >gi|281417909|ref|ZP_06248929.1| iojap-like protein [Clostridium thermocellum JW20] gi|281409311|gb|EFB39569.1| iojap-like protein [Clostridium thermocellum JW20] Length = 113 Score = 67.4 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L+E KA+D+ I+ + S++ D VI SG ST H+ ++AD + + Sbjct: 2 ESRELAEKIVSILEEKKAKDLNIIDIREI-SILADYFVICSGTSTTHIKTLADEVEEKML 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|283797995|ref|ZP_06347148.1| iojap-like protein [Clostridium sp. M62/1] gi|291074296|gb|EFE11660.1| iojap-like protein [Clostridium sp. M62/1] gi|295091859|emb|CBK77966.1| iojap-related protein [Clostridium cf. saccharolyticum K10] Length = 117 Score = 67.4 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ L++ K ED+ I+ S++ D +I G + V ++ADN+ Sbjct: 1 MSQSKDMVKLAVKALEDKKGEDVKIIDI-QGVSILADYFIIAGGSNVSQVQAMADNVEEE 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|239815668|ref|YP_002944578.1| iojap-like protein [Variovorax paradoxus S110] gi|239802245|gb|ACS19312.1| iojap-like protein [Variovorax paradoxus S110] Length = 221 Score = 67.4 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 +++ L+++KA+DI + T S + + +++ SG S + ++A ++ Sbjct: 7 AKKDTQKLQRAIIDGLEDVKAQDIQVFD-TEHLSPLFERVIVASGTSNRQTKALAASVRD 65 Query: 72 YLKK 75 +++ Sbjct: 66 AVRE 69 >gi|138896093|ref|YP_001126546.1| hypothetical protein GTNG_2456 [Geobacillus thermodenitrificans NG80-2] gi|134267606|gb|ABO67801.1| Conserved hypothetical protein [Geobacillus thermodenitrificans NG80-2] Length = 121 Score = 67.4 bits (164), Expect = 5e-10, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE+I + SL+ D VI G S K V +IA + ++ Sbjct: 7 QEALQLVVRAADDKKAENIVVLNM-KGISLVADYFVICHGNSDKQVQAIAREIQDQAEEN 65 >gi|295132679|ref|YP_003583355.1| hypothetical protein ZPR_0809 [Zunongwangia profunda SM-A87] gi|294980694|gb|ADF51159.1| conserved hypothetical protein [Zunongwangia profunda SM-A87] Length = 123 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 36/67 (53%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + D IA +++ ++++K DI ++ ++ + +CD VI +G S V +I ++ Sbjct: 1 MTKKETNSDQLIAHIIKGIEDVKGNDIDILDLRAIDNTVCDYFVICNGTSNTQVNAIVNS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 VQKSVSK 67 >gi|213023010|ref|ZP_03337457.1| hypothetical protein Salmonelentericaenterica_10560 [Salmonella enterica subsp. enterica serovar Typhi str. 404ty] Length = 84 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQ 57 >gi|15834770|ref|NP_296529.1| hypothetical protein TC0150 [Chlamydia muridarum Nigg] gi|270284937|ref|ZP_06194331.1| hypothetical protein CmurN_00753 [Chlamydia muridarum Nigg] gi|270288963|ref|ZP_06195265.1| hypothetical protein CmurW_00793 [Chlamydia muridarum Weiss] gi|301336335|ref|ZP_07224537.1| hypothetical protein CmurM_00830 [Chlamydia muridarum MopnTet14] gi|7190187|gb|AAF39027.1| conserved hypothetical protein [Chlamydia muridarum Nigg] Length = 119 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++ + + K + ++ S + D + V G HV +IAD ++ LKK Sbjct: 7 NLLKGIVRAIDDKKGRNPVILDV-QGISQLTDYFIFVEGNVGVHVKAIADTIVEELKK 63 >gi|242373896|ref|ZP_04819470.1| iojap family protein [Staphylococcus epidermidis M23864:W1] gi|242348450|gb|EES40052.1| iojap family protein [Staphylococcus epidermidis M23864:W1] Length = 117 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + +E + KAED+ + S + D V+ G + + V SIA + + Sbjct: 2 SSEELLNIAVEATENKKAEDVISLNM-QGISDMTDYFVVCHGNNERQVQSIARAVKEAVH 60 Query: 75 KKN 77 ++N Sbjct: 61 EQN 63 >gi|197335097|ref|YP_002155512.1| iojap family protein [Vibrio fischeri MJ11] gi|197316587|gb|ACH66034.1| iojap family protein [Vibrio fischeri MJ11] Length = 105 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++KAE+I ++ +S I D M++ +G S +HV+SIA N+ K+ Sbjct: 4 KELHDFLFNNVDDMKAENITTLDVR-GKSSITDFMIVCTGTSKRHVSSIASNVSDKAKE 61 >gi|221194766|ref|ZP_03567823.1| iojap family protein [Atopobium rimae ATCC 49626] gi|221185670|gb|EEE18060.1| iojap family protein [Atopobium rimae ATCC 49626] Length = 121 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 KA DIC ++ T S +CD VI +G + V +I D + ++K Sbjct: 7 ELATIAATAADNKKAHDICVLDLTE-LSDVCDYFVICTGDNAPMVDAIVDEVREKVRKN 64 >gi|56477685|ref|YP_159274.1| hypothetical protein ebA3971 [Aromatoleum aromaticum EbN1] gi|56313728|emb|CAI08373.1| conserved hypothetical protein,predicted iojap-related protein family [Aromatoleum aromaticum EbN1] Length = 123 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + TV++ L+++KA+DI I T + + D +V+ SG S + +++ N+ ++ Sbjct: 2 DIRKLQKTVVDALEDIKAKDIEVINTTK-LTSLFDRIVVASGDSNRQTRALSRNVQDKVR 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|50086087|ref|YP_047597.1| hypothetical protein ACIAD3076 [Acinetobacter sp. ADP1] gi|49532063|emb|CAG69775.1| conserved hypothetical protein [Acinetobacter sp. ADP1] Length = 117 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 42/67 (62%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 T ++ +C+ V + L ++KA+DI ++ +++ S + D ++I SG ST+HV ++ADN Sbjct: 1 MNSTQHNVQTCLKVVHDALTDVKAKDILELDVSNI-SNVADAIIIASGTSTRHVKALADN 59 Query: 69 LISYLKK 75 + +K Sbjct: 60 VADEARK 66 >gi|281420563|ref|ZP_06251562.1| iojap-like protein [Prevotella copri DSM 18205] gi|281405336|gb|EFB36016.1| iojap-like protein [Prevotella copri DSM 18205] Length = 119 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA----DN 68 + + + T+ E ++E K +DI + T + I +I G S V +IA D Sbjct: 1 MNTVKQLVETIKEGIQEKKGQDIVIADLTEIDGSIAKYFIICQGGSPTQVEAIAGSVGDI 60 Query: 69 LISYLKKK 76 + LK+K Sbjct: 61 VRKNLKEK 68 >gi|119493574|ref|ZP_01624238.1| Iojap-related protein [Lyngbya sp. PCC 8106] gi|119452564|gb|EAW33747.1| Iojap-related protein [Lyngbya sp. PCC 8106] Length = 138 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 14/71 (19%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T ++ + + V + ++ KAEDI ++ + S + D +I +G S V + Sbjct: 14 TAQELDLDEERTRQTVRLVAQAAEDRKAEDITVLKVSE-VSYLADYFIIATGFSHVQVRA 72 Query: 65 IADNLISYLKK 75 I + +++ Sbjct: 73 IYQAISKQVEQ 83 >gi|238920814|ref|YP_002934329.1| hypothetical protein NT01EI_2940 [Edwardsiella ictaluri 93-146] gi|238870383|gb|ACR70094.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 105 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI I+ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIAAIDVC-GKSSITDCMIICTGTSSRHVISIADHVVQ 57 >gi|184155779|ref|YP_001844119.1| hypothetical protein LAF_1303 [Lactobacillus fermentum IFO 3956] gi|227515629|ref|ZP_03945678.1| iojap family protein [Lactobacillus fermentum ATCC 14931] gi|260663505|ref|ZP_05864395.1| iojap protein 155 [Lactobacillus fermentum 28-3-CHN] gi|183227123|dbj|BAG27639.1| conserved hypothetical protein [Lactobacillus fermentum IFO 3956] gi|227086059|gb|EEI21371.1| iojap family protein [Lactobacillus fermentum ATCC 14931] gi|260552046|gb|EEX25099.1| iojap protein 155 [Lactobacillus fermentum 28-3-CHN] Length = 119 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AEDI ++ SL+ D VI++G S + V +IA+ ++ Sbjct: 2 QSKELLEMVVKAADGRRAEDIVALKV-DQISLMADYFVIMTGSSNRQVQAIANAIVEKAH 60 Query: 75 KKN 77 +++ Sbjct: 61 EQH 63 >gi|319939794|ref|ZP_08014150.1| iojap protein family [Streptococcus anginosus 1_2_62CV] gi|319811007|gb|EFW07322.1| iojap protein family [Streptococcus anginosus 1_2_62CV] Length = 121 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 QELLEIVVKAADEKRAEDITVLDLQE-LTTMTDYFVIASSMNSRQLEAIADNIREKVTE 61 >gi|317403472|gb|EFV83980.1| hypothetical protein HMPREF0005_01914 [Achromobacter xylosoxidans C54] Length = 134 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L+++KA+DI T + + D +VI S S + ++A ++ Sbjct: 2 DIQKLQRAVIDALEDVKAQDIKVFNTTH-LTSLFDRVVIASATSNRQTRALASSVSDR 58 >gi|87198084|ref|YP_495341.1| Iojap-related protein [Novosphingobium aromaticivorans DSM 12444] gi|87133765|gb|ABD24507.1| Iojap-related protein [Novosphingobium aromaticivorans DSM 12444] Length = 153 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V++ L + +A+++ I +S + D MVI SGRST+ VAS+A L +K+ Sbjct: 47 LHDLVLKSLDDDQAQEVVSIPL-EGKSSVADYMVIASGRSTRQVASMAQKLAERIKQN 103 >gi|312867196|ref|ZP_07727406.1| iojap-like protein [Streptococcus parasanguinis F0405] gi|311097325|gb|EFQ55559.1| iojap-like protein [Streptococcus parasanguinis F0405] Length = 117 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ S + + D VI S +++ + +IA+N+ + Sbjct: 4 KELLELVVKAADEKRAEDIVALDVQS-LTSVTDYFVIASSMNSRQLEAIAENIREKV 59 >gi|25011743|ref|NP_736138.1| iojap-related protein [Streptococcus agalactiae NEM316] gi|77414184|ref|ZP_00790348.1| iojap-related protein [Streptococcus agalactiae 515] gi|24413283|emb|CAD47362.1| unknown [Streptococcus agalactiae NEM316] gi|77159755|gb|EAO70902.1| iojap-related protein [Streptococcus agalactiae 515] gi|319745591|gb|EFV97892.1| Iojap protein family protein [Streptococcus agalactiae ATCC 13813] Length = 118 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K Sbjct: 4 KDLLQLVVKAADEKRAEDIVILDL-QPVTSVADYFVIMSASNSRQLEAIADNIREQVK 60 >gi|59802382|ref|YP_209094.1| hypothetical protein NGO2081 [Neisseria gonorrhoeae FA 1090] gi|194100029|ref|YP_002003168.1| hypothetical protein NGK_2543 [Neisseria gonorrhoeae NCCP11945] gi|239998031|ref|ZP_04717955.1| hypothetical protein Ngon3_00903 [Neisseria gonorrhoeae 35/02] gi|240013214|ref|ZP_04720127.1| hypothetical protein NgonD_00935 [Neisseria gonorrhoeae DGI18] gi|240015658|ref|ZP_04722198.1| hypothetical protein NgonFA_00573 [Neisseria gonorrhoeae FA6140] gi|240079796|ref|ZP_04724339.1| hypothetical protein NgonF_00546 [Neisseria gonorrhoeae FA19] gi|240112002|ref|ZP_04726492.1| hypothetical protein NgonM_00175 [Neisseria gonorrhoeae MS11] gi|240114750|ref|ZP_04728812.1| hypothetical protein NgonPID1_00583 [Neisseria gonorrhoeae PID18] gi|240116950|ref|ZP_04731012.1| hypothetical protein NgonPID_00568 [Neisseria gonorrhoeae PID1] gi|240120285|ref|ZP_04733247.1| hypothetical protein NgonPI_00610 [Neisseria gonorrhoeae PID24-1] gi|240122591|ref|ZP_04735547.1| hypothetical protein NgonP_01356 [Neisseria gonorrhoeae PID332] gi|240124776|ref|ZP_04737662.1| hypothetical protein NgonSK_00880 [Neisseria gonorrhoeae SK-92-679] gi|240127294|ref|ZP_04739955.1| hypothetical protein NgonS_01335 [Neisseria gonorrhoeae SK-93-1035] gi|254492810|ref|ZP_05105981.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291] gi|260441437|ref|ZP_05795253.1| hypothetical protein NgonDG_10207 [Neisseria gonorrhoeae DGI2] gi|268593881|ref|ZP_06128048.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02] gi|268595939|ref|ZP_06130106.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|268598056|ref|ZP_06132223.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11] gi|268600398|ref|ZP_06134565.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18] gi|268602631|ref|ZP_06136798.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1] gi|268681180|ref|ZP_06148042.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332] gi|268683350|ref|ZP_06150212.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679] gi|268685658|ref|ZP_06152520.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035] gi|291044800|ref|ZP_06570509.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|293397888|ref|ZP_06642094.1| iojap protein 155 [Neisseria gonorrhoeae F62] gi|59719277|gb|AAW90682.1| conserved hypothetical protein [Neisseria gonorrhoeae FA 1090] gi|193935319|gb|ACF31143.1| Conserved hypothetical protein [Neisseria gonorrhoeae NCCP11945] gi|226511850|gb|EEH61195.1| conserved hypothetical protein [Neisseria gonorrhoeae 1291] gi|268547270|gb|EEZ42688.1| conserved hypothetical protein [Neisseria gonorrhoeae 35/02] gi|268549727|gb|EEZ44746.1| conserved hypothetical protein [Neisseria gonorrhoeae FA19] gi|268582187|gb|EEZ46863.1| conserved hypothetical protein [Neisseria gonorrhoeae MS11] gi|268584529|gb|EEZ49205.1| conserved hypothetical protein [Neisseria gonorrhoeae PID18] gi|268586762|gb|EEZ51438.1| conserved hypothetical protein [Neisseria gonorrhoeae PID1] gi|268621464|gb|EEZ53864.1| conserved hypothetical protein [Neisseria gonorrhoeae PID332] gi|268623634|gb|EEZ56034.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-92-679] gi|268625942|gb|EEZ58342.1| conserved hypothetical protein [Neisseria gonorrhoeae SK-93-1035] gi|291011694|gb|EFE03690.1| conserved hypothetical protein [Neisseria gonorrhoeae DGI2] gi|291611834|gb|EFF40903.1| iojap protein 155 [Neisseria gonorrhoeae F62] gi|317165475|gb|ADV09016.1| hypothetical protein NGTW08_2065 [Neisseria gonorrhoeae TCDC-NG08107] Length = 128 Score = 67.4 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+++KA+DI +E T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVGVAVNALEDIKAKDISVLE-TQDKTSLFARMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|237755667|ref|ZP_04584278.1| iojap-related protein [Sulfurihydrogenibium yellowstonense SS-5] gi|237692179|gb|EEP61176.1| iojap-related protein [Sulfurihydrogenibium yellowstonense SS-5] Length = 120 Score = 67.4 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 33/61 (54%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E +E K EDI +E + +I D M+I++G H +IADN+I LK Sbjct: 2 ETLEIVKKIIEKAEEKKGEDIVVLEIGKINPIIADYMIIITGTVPIHTRAIADNIIGGLK 61 Query: 75 K 75 + Sbjct: 62 E 62 >gi|126175473|ref|YP_001051622.1| iojap-like protein [Shewanella baltica OS155] gi|217972281|ref|YP_002357032.1| iojap-like protein [Shewanella baltica OS223] gi|304410300|ref|ZP_07391919.1| iojap-like protein [Shewanella baltica OS183] gi|307301989|ref|ZP_07581747.1| iojap-like protein [Shewanella baltica BA175] gi|125998678|gb|ABN62753.1| iojap-like protein [Shewanella baltica OS155] gi|217497416|gb|ACK45609.1| iojap-like protein [Shewanella baltica OS223] gi|304351709|gb|EFM16108.1| iojap-like protein [Shewanella baltica OS183] gi|306914027|gb|EFN44448.1| iojap-like protein [Shewanella baltica BA175] gi|315268751|gb|ADT95604.1| iojap-like protein [Shewanella baltica OS678] Length = 109 Score = 67.4 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 V++ + +LKA D+ ++ + +S I D MVI SG S HV +IA+NL+ KK Sbjct: 5 ELKQFVVDKIDDLKARDVVVLDVSK-QSNITDYMVICSGTSKTHVKAIAENLVVEAKK 61 >gi|289805908|ref|ZP_06536537.1| hypothetical protein Salmonellaentericaenterica_16287 [Salmonella enterica subsp. enterica serovar Typhi str. AG3] Length = 78 Score = 67.4 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQ 57 >gi|256004484|ref|ZP_05429463.1| iojap-like protein [Clostridium thermocellum DSM 2360] gi|255991489|gb|EEU01592.1| iojap-like protein [Clostridium thermocellum DSM 2360] gi|316940053|gb|ADU74087.1| iojap-like protein [Clostridium thermocellum DSM 1313] Length = 113 Score = 67.4 bits (164), Expect = 7e-10, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L+E KA+D+ I+ + S++ D VI SG ST H+ ++AD + + Sbjct: 2 ESRELAEKIVSILEEKKAKDLNIIDIREI-SILADYFVICSGTSTTHIKTLADEVEEKML 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|94967053|ref|YP_589101.1| Iojap-related protein [Candidatus Koribacter versatilis Ellin345] gi|94549103|gb|ABF39027.1| Iojap-related protein [Candidatus Koribacter versatilis Ellin345] Length = 163 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 28/62 (45%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + +A + +E KAE+I +E S D VI +G + + + +I+D + Sbjct: 2 SKSESRKAVALAVSAAQEKKAENIAILELDKSSSGFTDYFVICTGSNPRQLQAISDEVDQ 61 Query: 72 YL 73 L Sbjct: 62 KL 63 >gi|313888415|ref|ZP_07822083.1| iojap-like protein [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845612|gb|EFR33005.1| iojap-like protein [Peptoniphilus harei ACS-146-V-Sch2b] Length = 114 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ ++ K DI ++ + I D VIVSG S+ V ++A + L Sbjct: 2 TTQEKLDIIVKSCEDKKGIDIKVLDI-KGMTSIADYFVIVSGNSSTQVDALAREIDEKLS 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|303236873|ref|ZP_07323452.1| iojap-like protein [Prevotella disiens FB035-09AN] gi|302483041|gb|EFL46057.1| iojap-like protein [Prevotella disiens FB035-09AN] Length = 119 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 33/65 (50%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + T+ + ++E K I + + + IC VI G S + V +IA+++ Y Sbjct: 1 MNDTKNLVETITKGIQEKKGHGIVIADLSKIDGTICQYFVICHGNSPQQVEAIAESVSDY 60 Query: 73 LKKKN 77 +++ + Sbjct: 61 VREIH 65 >gi|282878238|ref|ZP_06287034.1| iojap-like protein [Prevotella buccalis ATCC 35310] gi|281299656|gb|EFA92029.1| iojap-like protein [Prevotella buccalis ATCC 35310] Length = 119 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN---- 68 + + + ++E K +DI + +++ I + VI G S V +I+++ Sbjct: 1 MKQSKQLVDIITKGIQEKKGQDIVIADLSNIEGAIANYFVICQGNSPTQVEAISESIGDT 60 Query: 69 LISYLKKK 76 + LK+K Sbjct: 61 VREDLKEK 68 >gi|322388981|ref|ZP_08062551.1| Iojap protein family protein [Streptococcus parasanguinis ATCC 903] gi|321144286|gb|EFX39694.1| Iojap protein family protein [Streptococcus parasanguinis ATCC 903] Length = 117 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ S + + D VI S +++ + +IA+N+ + Sbjct: 4 KELLELVVKAADEKRAEDIVALDVQS-LTSVTDYFVIASSMNSRQLEAIAENIREKV 59 >gi|145298093|ref|YP_001140934.1| iojap domain-containing protein [Aeromonas salmonicida subsp. salmonicida A449] gi|142850865|gb|ABO89186.1| iojap domain protein [Aeromonas salmonicida subsp. salmonicida A449] Length = 113 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A +++ + ++K DI ++ +S I D M++ SG S++HV++IA NL S + Sbjct: 4 QELQAFIVDKIDDMKGRDIITLDVR-GQSSITDTMIVCSGNSSRHVSAIAHNLASEAR 60 >gi|258511980|ref|YP_003185414.1| iojap-like protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257478706|gb|ACV59025.1| iojap-like protein [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 117 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +++ + KA D+ + + + D VI S S V ++A + L Sbjct: 3 PNVEQIARRAATACLDKKATDVVVMNVQE-LTPLADYFVICSASSRPQVEAVARAVRDDL 61 Query: 74 KK 75 + Sbjct: 62 AE 63 >gi|225010889|ref|ZP_03701356.1| iojap-like protein [Flavobacteria bacterium MS024-3C] gi|225004936|gb|EEG42891.1| iojap-like protein [Flavobacteria bacterium MS024-3C] Length = 124 Score = 67.0 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 34/67 (50%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 L +D+ I+ ++ ++E+K DI ++ + + CD +I +G S HV ++ + Sbjct: 1 MLDKKGDVDNLISLILNGIEEVKGLDIQLLDLREIENTACDYFIICNGTSNTHVNAVVGS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 VQKIVSK 67 >gi|294649342|ref|ZP_06726774.1| iojap family protein [Acinetobacter haemolyticus ATCC 19194] gi|292824782|gb|EFF83553.1| iojap family protein [Acinetobacter haemolyticus ATCC 19194] Length = 132 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 25/74 (33%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Query: 3 ANTEKQALQTAD-HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 +N+ + T++ + +C+ V E L ++KA+DI ++ +S+ S + D +VI SG ST+H Sbjct: 10 SNSHDLKITTSNKDVHACLKVVHEALTDVKAKDILELDVSSI-SNVADAIVIASGTSTRH 68 Query: 62 VASIADNLISYLKK 75 V ++ADN+ +K Sbjct: 69 VKALADNVADEARK 82 >gi|298208155|ref|YP_003716334.1| hypothetical protein CA2559_07936 [Croceibacter atlanticus HTCC2559] gi|83848076|gb|EAP85946.1| hypothetical protein CA2559_07936 [Croceibacter atlanticus HTCC2559] Length = 123 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 33/67 (49%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D I+ ++E ++ +K +DI ++ + + +CD VI +G S V ++ + Sbjct: 1 MAKKEIKTDELISYIVEGIENVKGQDIDILDLREIENTVCDYFVICNGTSNTQVNALVGS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 IQKTVSK 67 >gi|288927651|ref|ZP_06421498.1| conserved hypothetical protein [Prevotella sp. oral taxon 317 str. F0108] gi|288330485|gb|EFC69069.1| conserved hypothetical protein [Prevotella sp. oral taxon 317 str. F0108] Length = 119 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + T+++ ++E K +I + + I + VI G S V +IA+++ Sbjct: 1 MTRTNNLVNTIIKGIQEKKGSNIVVADLKEIEGAITNYFVICQGNSPTQVEAIAESIGET 60 Query: 73 LKKK 76 ++K+ Sbjct: 61 VRKE 64 >gi|260911510|ref|ZP_05918098.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295] gi|260634374|gb|EEX52476.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str. F0295] Length = 119 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + T+++ ++E K +I + + I + VI G S V +IA+++ Sbjct: 1 MTRTNNLVNTIIKGIQEKKGSNIVVADLKEIEGAITNYFVICQGNSPTQVEAIAESIGET 60 Query: 73 LKKK 76 ++K+ Sbjct: 61 VRKE 64 >gi|154494840|ref|ZP_02033845.1| hypothetical protein PARMER_03884 [Parabacteroides merdae ATCC 43184] gi|154085390|gb|EDN84435.1| hypothetical protein PARMER_03884 [Parabacteroides merdae ATCC 43184] Length = 119 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 36/64 (56%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D ++ + T++E L+E K ++I ++ T L IC M+I G + V++++D+ + Sbjct: 1 MDQTEALVKTIVEGLQEKKGKNIVTVDLTQLSGSICQYMIICEGSTPTQVSALSDSAWDF 60 Query: 73 LKKK 76 +K Sbjct: 61 AHRK 64 >gi|34495973|ref|NP_900188.1| hypothetical protein CV_0518 [Chromobacterium violaceum ATCC 12472] gi|34101827|gb|AAQ58195.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 122 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E L+++K +DI ++ TS + + M++ +G S + V ++A+++ LK Sbjct: 2 EIQEISKLAIEALEDIKGKDIIELD-TSKLTSLFQRMIVATGDSNRQVKALANSVQVKLK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|86140537|ref|ZP_01059096.1| hypothetical protein MED217_15335 [Leeuwenhoekiella blandensis MED217] gi|85832479|gb|EAQ50928.1| hypothetical protein MED217_15335 [Leeuwenhoekiella blandensis MED217] Length = 123 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 38/68 (55%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D I T++E ++E+K ++I ++ + +++CD ++ +G S VA+I ++ Sbjct: 1 MSKKEVSTDQLITTILEGIEEVKGQNIDLLDLREIENMVCDYFIVCNGTSNTQVAAIVNS 60 Query: 69 LISYLKKK 76 + + KK Sbjct: 61 IQKTVSKK 68 >gi|332292420|ref|YP_004431029.1| iojap-like protein [Krokinobacter diaphorus 4H-3-7-5] gi|332170506|gb|AEE19761.1| iojap-like protein [Krokinobacter diaphorus 4H-3-7-5] Length = 123 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 33/67 (49%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + D IA ++E ++++K ++I ++ + + +CD +I G S V +I + Sbjct: 1 MVNKEKNTDQLIAKIVEGIEDVKGQNIDILDLRDIENTVCDYFIICDGTSNTQVGAIVSS 60 Query: 69 LISYLKK 75 + K Sbjct: 61 IQKTASK 67 >gi|126653881|ref|ZP_01725728.1| YqeL [Bacillus sp. B14905] gi|169829297|ref|YP_001699455.1| hypothetical protein Bsph_3847 [Lysinibacillus sphaericus C3-41] gi|126589606|gb|EAZ83745.1| YqeL [Bacillus sp. B14905] gi|168993785|gb|ACA41325.1| Hypothetical yqeL protein [Lysinibacillus sphaericus C3-41] Length = 114 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + + EDI + SL+ D +I G S + V +IA L +K Sbjct: 2 TSTLLQAAYKAIDDKHGEDIVVLNM-QGISLLADYFIIAHGNSDRQVQAIARELQDVAEK 60 >gi|120597866|ref|YP_962440.1| iojap-like protein [Shewanella sp. W3-18-1] gi|146293961|ref|YP_001184385.1| iojap-like protein [Shewanella putrefaciens CN-32] gi|120557959|gb|ABM23886.1| iojap-like protein [Shewanella sp. W3-18-1] gi|145565651|gb|ABP76586.1| iojap-like protein [Shewanella putrefaciens CN-32] gi|319427337|gb|ADV55411.1| iojap-like protein [Shewanella putrefaciens 200] Length = 109 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ + +LKA DI I+ + +S I D MVI SG S HV +IA+NL+ K Sbjct: 5 ELKQFVVDKIDDLKARDIVVIDVSK-QSNITDYMVICSGTSKTHVKAIAENLVVEAK 60 >gi|226226608|ref|YP_002760714.1| hypothetical protein GAU_1202 [Gemmatimonas aurantiaca T-27] gi|226089799|dbj|BAH38244.1| hypothetical protein [Gemmatimonas aurantiaca T-27] Length = 127 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ELKA DI ++ + + D VI SG S HV ++A+ + + LK Sbjct: 15 RAAALASELKATDIVVLDLR-GVTDMTDFFVIASGTSDTHVRAVAEYVQAGLK 66 >gi|331091109|ref|ZP_08339951.1| hypothetical protein HMPREF9477_00594 [Lachnospiraceae bacterium 2_1_46FAA] gi|330405331|gb|EGG84867.1| hypothetical protein HMPREF9477_00594 [Lachnospiraceae bacterium 2_1_46FAA] Length = 117 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + E L E K EDI I + + S + D +I +G + V ++ +N+ Sbjct: 1 MEQAKNMARLAYEALSEKKGEDIRVINISEI-STLADYFIIANGTNESQVNALVENVEEK 59 Query: 73 LKK 75 L+K Sbjct: 60 LEK 62 >gi|309378267|emb|CBX23098.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 128 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L+++KA+DI +E T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVEVAVNALEDIKAKDISVLE-TQDKTSLFAKMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|260912844|ref|ZP_05919330.1| iojap family protein [Pasteurella dagmatis ATCC 43325] gi|260633222|gb|EEX51387.1| iojap family protein [Pasteurella dagmatis ATCC 43325] Length = 103 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + +++ L +LKA +I ++ +S I D+MVI +G S++HV+S+A NLI+ K+ Sbjct: 1 MSTLVDFIIDKLDDLKATEILRLDVR-GKSPITDDMVICTGNSSRHVSSLAQNLITECKQ 59 >gi|315645933|ref|ZP_07899054.1| iojap-like protein [Paenibacillus vortex V453] gi|315278694|gb|EFU42008.1| iojap-like protein [Paenibacillus vortex V453] Length = 115 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + ++ KA D+ ++ SLI D VI G S V +IA + + Sbjct: 6 NELLNVAVAAAEDKKAMDLVVLDLR-GISLIADYFVICHGNSDTQVQAIATEIRKRAHDE 64 >gi|77411882|ref|ZP_00788214.1| iojap-related protein [Streptococcus agalactiae CJB111] gi|77162042|gb|EAO73021.1| iojap-related protein [Streptococcus agalactiae CJB111] Length = 118 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AEDI ++ + + D VI+S +++ + +IADN+ +K Sbjct: 4 KDLLQLVVKAADEKRAEDIVILDL-QPVTSVADYFVIMSASNSRQLEAIADNIREQVK 60 >gi|325279235|ref|YP_004251777.1| iojap-like protein [Odoribacter splanchnicus DSM 20712] gi|324311044|gb|ADY31597.1| iojap-like protein [Odoribacter splanchnicus DSM 20712] Length = 134 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++E L++ KA I I+ + + C VI G S H+A + D + Sbjct: 1 MLKTEQVVNKIIEALEDNKAHRIVKIDLRKIENCFCSFFVICHGTSGTHIAGLTDAVEEK 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|24380161|ref|NP_722116.1| hypothetical protein SMU.1797c [Streptococcus mutans UA159] gi|24378163|gb|AAN59422.1|AE015007_9 conserved hypothetical protein [Streptococcus mutans UA159] Length = 117 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + +++ E +AEDI ++ + + D VI+ +++ + +IA+N+ + Sbjct: 4 KKLLELIVKAADEKRAEDIVVMDL-QGLTTLTDYFVIMHATNSRQLEAIAENIREKV 59 >gi|78484830|ref|YP_390755.1| Iojap-related protein [Thiomicrospira crunogena XCL-2] gi|78363116|gb|ABB41081.1| Conserved hypothetical protein with DUF 143 [Thiomicrospira crunogena XCL-2] Length = 120 Score = 67.0 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 A ++ L++ KA DI ++ + S D MVI +G ST HV S + + Sbjct: 1 MMDSQQVEALIVSTLEDSKARDIQVLDVSK-LSSFTDKMVIATGTSTTHVRSTGNAVAQA 59 Query: 73 LKK 75 K+ Sbjct: 60 FKE 62 >gi|210612749|ref|ZP_03289464.1| hypothetical protein CLONEX_01666 [Clostridium nexile DSM 1787] gi|210151442|gb|EEA82450.1| hypothetical protein CLONEX_01666 [Clostridium nexile DSM 1787] Length = 116 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L + K EDI I+ ++ S++ D +I +G + V ++ D++ Sbjct: 1 MEESRKMAKIACAALADKKGEDIKVIDISN-VSVLADYFIIANGTNDSQVHAMVDSVEEE 59 Query: 73 LKK 75 L+K Sbjct: 60 LEK 62 >gi|189463183|ref|ZP_03011968.1| hypothetical protein BACCOP_03896 [Bacteroides coprocola DSM 17136] gi|189430162|gb|EDU99146.1| hypothetical protein BACCOP_03896 [Bacteroides coprocola DSM 17136] Length = 119 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + + E ++E K +I + T++ IC VI G S V +I D++ Y Sbjct: 1 MDETKDLVKKITEGIQEKKGRNIVIADLTNIEDTICKYFVICQGNSPSQVLAIVDSVKEY 60 Query: 73 LKK 75 ++K Sbjct: 61 VRK 63 >gi|307262086|ref|ZP_07543740.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|306868265|gb|EFN00088.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 12 str. 1096] Length = 128 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M+I +G S +HVAS AD L + K+ Sbjct: 27 QNLVEFLTKTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTADRLSAEAKQ 84 >gi|172035975|ref|YP_001802476.1| putative Iojap-related protein [Cyanothece sp. ATCC 51142] gi|171697429|gb|ACB50410.1| putative Iojap-related protein [Cyanothece sp. ATCC 51142] Length = 147 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + T+ E + K DI ++ T + S + D VIV+G S V +IA+ + Sbjct: 21 TSDQQIQNLALTIAEAADDRKGSDITILKVTEI-SYLTDYFVIVTGFSRTQVKAIAEAIE 79 Query: 71 SYLKKKN 77 + + + Sbjct: 80 EKVYQTH 86 >gi|89069778|ref|ZP_01157114.1| iojap-related protein [Oceanicola granulosus HTCC2516] gi|89044724|gb|EAR50835.1| iojap-related protein [Oceanicola granulosus HTCC2516] Length = 121 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 DS +A ++ L + KAE+I I+ RS + D M+I SGRST+ V SIA+ L LK Sbjct: 8 TSDSILAAILTSLDDDKAEEITQIDLR-GRSEMGDWMIIASGRSTRQVVSIAEKLTDRLK 66 Query: 75 KK 76 + Sbjct: 67 TE 68 >gi|148544457|ref|YP_001271827.1| iojap-like protein [Lactobacillus reuteri DSM 20016] gi|184153822|ref|YP_001842163.1| hypothetical protein LAR_1167 [Lactobacillus reuteri JCM 1112] gi|227363115|ref|ZP_03847250.1| iojap family protein [Lactobacillus reuteri MM2-3] gi|325682779|ref|ZP_08162295.1| Iojap family protein [Lactobacillus reuteri MM4-1A] gi|148531491|gb|ABQ83490.1| iojap-like protein [Lactobacillus reuteri DSM 20016] gi|183225166|dbj|BAG25683.1| conserved hypothetical protein [Lactobacillus reuteri JCM 1112] gi|227071833|gb|EEI10121.1| iojap family protein [Lactobacillus reuteri MM2-3] gi|324977129|gb|EGC14080.1| Iojap family protein [Lactobacillus reuteri MM4-1A] Length = 118 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AEDI ++ S + D VI++G S + V +I + ++ Sbjct: 2 DSKQLLEMVVKAADGRRAEDIIALKV-DEISPMADYFVIMTGGSDRQVQAITNAIVEKAH 60 Query: 75 KKN 77 ++N Sbjct: 61 EEN 63 >gi|330838589|ref|YP_004413169.1| iojap-like protein [Selenomonas sputigena ATCC 35185] gi|329746353|gb|AEB99709.1| iojap-like protein [Selenomonas sputigena ATCC 35185] Length = 117 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + KA+DI + L + D ++ S + V +IADN+ + +K Sbjct: 6 EEMSRAIARAASDKKAQDIVIMRMAELTTA-ADYFIVCSANTATQVRAIADNIEDEMLEK 64 Query: 77 N 77 + Sbjct: 65 H 65 >gi|117926621|ref|YP_867238.1| iojap-like protein [Magnetococcus sp. MC-1] gi|117610377|gb|ABK45832.1| iojap-like protein [Magnetococcus sp. MC-1] Length = 226 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K Q + T+ L + K EDI ++ RS + D +IV+GRST HV ++A Sbjct: 5 KSDDQIKAEITQAAHTIQAKLDDKKGEDIVLVDL-EGRSGLADFFIIVTGRSTTHVRALA 63 Query: 67 DNLISYLKKKN 77 D + + N Sbjct: 64 DEVDQVASQLN 74 >gi|261253671|ref|ZP_05946244.1| hypothetical protein VIA_003698 [Vibrio orientalis CIP 102891] gi|260937062|gb|EEX93051.1| hypothetical protein VIA_003698 [Vibrio orientalis CIP 102891] Length = 105 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L+ +++ + ++KA+DI I+ +S I D M++ +G S +HVASIA+++ K Sbjct: 2 QLEELNNFLVDKVDDMKAQDIKTIDV-QGKSSITDFMIVCTGTSKRHVASIAEHVAKESK 60 >gi|218288653|ref|ZP_03492930.1| iojap-like protein [Alicyclobacillus acidocaldarius LAA1] gi|218241310|gb|EED08485.1| iojap-like protein [Alicyclobacillus acidocaldarius LAA1] Length = 117 Score = 67.0 bits (163), Expect = 9e-10, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 23/62 (37%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +++ + KA D+ + + + D VI S S V ++A + L Sbjct: 3 PNVEQIARRAATACLDKKATDVVVMNVQE-LTPVADYFVICSASSRPQVEAVARAVRDDL 61 Query: 74 KK 75 + Sbjct: 62 AE 63 >gi|329115067|ref|ZP_08243822.1| Putative protein ybeB [Acetobacter pomorum DM001] gi|326695510|gb|EGE47196.1| Putative protein ybeB [Acetobacter pomorum DM001] Length = 122 Score = 66.6 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D L+ +A + L++ KAEDI I+ R+ D MVI +G + + ++++A ++ Sbjct: 2 APDMLEQSLALITASLEDDKAEDIVVIDLA-GRASFADRMVIATGLADRQISAMAQHIER 60 Query: 72 YLKK 75 L+ Sbjct: 61 KLRD 64 >gi|163786152|ref|ZP_02180600.1| hypothetical protein FBALC1_13242 [Flavobacteriales bacterium ALC-1] gi|159878012|gb|EDP72068.1| hypothetical protein FBALC1_13242 [Flavobacteriales bacterium ALC-1] Length = 123 Score = 66.6 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 33/67 (49%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D I T++ ++E+K ++I ++ + + +CD ++ G S V +I ++ Sbjct: 1 MTKEKTSADQLITTIIGGIEEVKGKEITILDLREIENTVCDYFIVCEGTSNTQVNAIVNS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 IQKQVSK 67 >gi|332528325|ref|ZP_08404325.1| Iojap-like protein [Hylemonella gracilis ATCC 19624] gi|332042196|gb|EGI78522.1| Iojap-like protein [Hylemonella gracilis ATCC 19624] Length = 280 Score = 66.6 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 14/75 (18%), Positives = 34/75 (45%), Gaps = 1/75 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M T + +++ L+++KA+DI T S + + +V+ SG S + Sbjct: 1 MKPETTMTDNAVKKDIQKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVVVASGTSNR 59 Query: 61 HVASIADNLISYLKK 75 ++A ++ +++ Sbjct: 60 QTKALAVSVRDAVRE 74 >gi|313903968|ref|ZP_07837348.1| iojap-like protein [Eubacterium cellulosolvens 6] gi|313471117|gb|EFR66439.1| iojap-like protein [Eubacterium cellulosolvens 6] Length = 117 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 A + L++ KA DI ++ + + S I D +I SG + V ++AD++ Sbjct: 1 MPEAKEMAALAVAALEDKKALDIKILDISDI-STIADYFIIASGSNRNQVQAMADSVDET 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|188996910|ref|YP_001931161.1| iojap-like protein [Sulfurihydrogenibium sp. YO3AOP1] gi|188931977|gb|ACD66607.1| iojap-like protein [Sulfurihydrogenibium sp. YO3AOP1] Length = 120 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 33/61 (54%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E +E K EDI +E + +I D M+I++G H +IADN+I LK Sbjct: 2 ETLEIVKKIIEKAEEKKGEDIVALEIGKINPIIADYMIIITGTVPIHTRAIADNIIGGLK 61 Query: 75 K 75 + Sbjct: 62 E 62 >gi|94497820|ref|ZP_01304386.1| Iojap-related protein [Sphingomonas sp. SKA58] gi|94422709|gb|EAT07744.1| Iojap-related protein [Sphingomonas sp. SKA58] Length = 129 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 +A+ + + A VM+ L + +A++ I +S I D+MVI SGRS++ VA++A Sbjct: 9 DTASSAESVAALHALVMQSLDDDQAQETISIPL-EGKSSIADHMVIASGRSSRQVAAMAQ 67 Query: 68 NLISYLKKK 76 +L +KK+ Sbjct: 68 HLAERIKKE 76 >gi|145630673|ref|ZP_01786452.1| hypothetical protein CGSHi22421_01984 [Haemophilus influenzae R3021] gi|145633409|ref|ZP_01789139.1| hypothetical protein CGSHi3655_04235 [Haemophilus influenzae 3655] gi|145636762|ref|ZP_01792428.1| hypothetical protein CGSHiHH_06595 [Haemophilus influenzae PittHH] gi|145641825|ref|ZP_01797400.1| hypothetical protein CGSHiR3021_01107 [Haemophilus influenzae R3021] gi|319774986|ref|YP_004137474.1| hypothetical protein HICON_03190 [Haemophilus influenzae F3047] gi|319896456|ref|YP_004134649.1| hypothetical protein HIBPF00380 [Haemophilus influenzae F3031] gi|329123112|ref|ZP_08251682.1| Iojap family protein [Haemophilus aegyptius ATCC 11116] gi|144983799|gb|EDJ91249.1| hypothetical protein CGSHi22421_01984 [Haemophilus influenzae R3021] gi|144985972|gb|EDJ92574.1| hypothetical protein CGSHi3655_04235 [Haemophilus influenzae 3655] gi|145270060|gb|EDK09997.1| hypothetical protein CGSHiHH_06595 [Haemophilus influenzae PittHH] gi|145273447|gb|EDK13318.1| hypothetical protein CGSHiR3021_01107 [Haemophilus influenzae 22.4-21] gi|317431958|emb|CBY80306.1| conserved hypothetical protein [Haemophilus influenzae F3031] gi|317449577|emb|CBY85782.1| conserved hypothetical protein [Haemophilus influenzae F3047] gi|327471667|gb|EGF17109.1| Iojap family protein [Haemophilus aegyptius ATCC 11116] Length = 102 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +ME L LK DI H + +S I DNM+I +G S++ V+++ADNLI+ KK Sbjct: 3 LVEFLMETLDGLKGTDIVHFDVR-GKSSITDNMIICTGTSSRQVSAMADNLITECKK 58 >gi|113969337|ref|YP_733130.1| iojap-like protein [Shewanella sp. MR-4] gi|114046564|ref|YP_737114.1| iojap-like protein [Shewanella sp. MR-7] gi|117919446|ref|YP_868638.1| iojap-like protein [Shewanella sp. ANA-3] gi|113884021|gb|ABI38073.1| iojap-like protein [Shewanella sp. MR-4] gi|113888006|gb|ABI42057.1| iojap-like protein [Shewanella sp. MR-7] gi|117611778|gb|ABK47232.1| iojap-like protein [Shewanella sp. ANA-3] Length = 114 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ + +LKA D+ I+ ++ +S I D MVI SG S HV +IA+NL+ K Sbjct: 10 ELKQFVVDKIDDLKARDVVVIDVSN-QSNITDYMVICSGTSKTHVKAIAENLVLEAK 65 >gi|148358908|ref|YP_001250115.1| hypothetical protein LPC_0793 [Legionella pneumophila str. Corby] gi|296106956|ref|YP_003618656.1| hypothetical protein lpa_02028 [Legionella pneumophila 2300/99 Alcoy] gi|148280681|gb|ABQ54769.1| conserved hypothetical protein; DUF143 [Legionella pneumophila str. Corby] gi|295648857|gb|ADG24704.1| hypothetical protein lpa_02028 [Legionella pneumophila 2300/99 Alcoy] Length = 112 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +++ L++++A DI I+ ++ I D MVI SGRS++HV SIA ++ Sbjct: 1 MLEKNPTLEKLLKSLEDIQAIDIKIIDV-HKQTTITDFMVITSGRSSRHVKSIAQKVLED 59 Query: 73 LK 74 +K Sbjct: 60 MK 61 >gi|78213338|ref|YP_382117.1| Iojap-related protein [Synechococcus sp. CC9605] gi|78197797|gb|ABB35562.1| Iojap-related protein [Synechococcus sp. CC9605] Length = 118 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V + + KA DI I S + D MVI G+S V +IA ++ L+ Sbjct: 2 DSEKLAELVADACDDRKATDIRLIRV-DEVSSLADWMVIAGGQSDVQVRAIARSVEDRLE 60 Query: 75 KK 76 + Sbjct: 61 TE 62 >gi|67921824|ref|ZP_00515341.1| Iojap-related protein [Crocosphaera watsonii WH 8501] gi|67856416|gb|EAM51658.1| Iojap-related protein [Crocosphaera watsonii WH 8501] Length = 131 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 T + + T+++ + K DI ++ T + S + D VI++G S V +IA+ + Sbjct: 5 TTDQSIQNLALTIVQAADDRKGSDISVLKVTEI-SYLTDYFVIITGFSRTQVKAIAEAIE 63 Query: 71 SYLKKKN 77 + + + Sbjct: 64 EKVYQSH 70 >gi|268317811|ref|YP_003291530.1| iojap-like protein [Rhodothermus marinus DSM 4252] gi|262335345|gb|ACY49142.1| iojap-like protein [Rhodothermus marinus DSM 4252] Length = 152 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 10/58 (17%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ + KA+D+ ++ S + D V+ +G+S + +IA+ + +++ Sbjct: 24 LARHAVDAALDKKAQDLVVMDMRQ-VSGVADYFVLCTGQSDLQIRAIAEAIEERIEQH 80 >gi|256375336|ref|YP_003098996.1| iojap-like protein [Actinosynnema mirum DSM 43827] gi|255919639|gb|ACU35150.1| iojap-like protein [Actinosynnema mirum DSM 43827] Length = 148 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + KA D+ ++ + +I D VI S + + V +I D + Sbjct: 1 MAATDEARRLALVAANAASDKKAHDVILLDVSEQL-VITDCFVIASAPNERQVGAIVDGV 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EEKLRE 65 >gi|153853137|ref|ZP_01994546.1| hypothetical protein DORLON_00531 [Dorea longicatena DSM 13814] gi|149753923|gb|EDM63854.1| hypothetical protein DORLON_00531 [Dorea longicatena DSM 13814] Length = 130 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D E L++ K ED+C I+ ++ S++ D VI +G S V ++ +N+ Sbjct: 13 NMDQAKEMAKIAFEALEDKKGEDVCAIDISA-VSVLADYFVIANGNSDSQVRALVENVEE 71 Query: 72 YLKK 75 + K Sbjct: 72 KMHK 75 >gi|281426189|ref|ZP_06257102.1| iojap-like protein [Prevotella oris F0302] gi|281399765|gb|EFB30596.1| iojap-like protein [Prevotella oris F0302] Length = 119 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 30/68 (44%), Gaps = 4/68 (5%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA----DN 68 + + + T+ + ++E K +DI I + I +I G S + +IA D Sbjct: 1 METTEKLVETITKGIQEKKGKDITIINLKHIDGAIAKYFIICQGNSPTQIEAIAGSISDT 60 Query: 69 LISYLKKK 76 + LK+K Sbjct: 61 VREDLKEK 68 >gi|317505298|ref|ZP_07963227.1| Iojap family protein [Prevotella salivae DSM 15606] gi|315663601|gb|EFV03339.1| Iojap family protein [Prevotella salivae DSM 15606] Length = 119 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 31/61 (50%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + T+ + ++E K +DI I+ + I +I G S + +IA ++ +++ Sbjct: 4 TETLVKTITKGIQEKKGQDITIIDLKHIDGAIAKYFIICQGNSPTQIEAIAGSISDMVRE 63 Query: 76 K 76 + Sbjct: 64 E 64 >gi|198242522|ref|YP_002214631.1| hypothetical protein SeD_A0744 [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|197937038|gb|ACH74371.1| iojap family protein [Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853] gi|326622386|gb|EGE28731.1| iojap family protein [Salmonella enterica subsp. enterica serovar Dublin str. 3246] Length = 105 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDNLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQ 57 >gi|302386387|ref|YP_003822209.1| iojap-like protein [Clostridium saccharolyticum WM1] gi|302197015|gb|ADL04586.1| iojap-like protein [Clostridium saccharolyticum WM1] Length = 120 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + T L + K EDI I+ S++ D +I SG +T V ++ DN+ Sbjct: 1 MIQSVEMVKTAYAALSDKKGEDIRIIDIRK-VSVMADYFIIASGTNTNQVQAMVDNVEEE 59 Query: 73 LKKK 76 L KK Sbjct: 60 LGKK 63 >gi|257092733|ref|YP_003166374.1| iojap-like protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257045257|gb|ACV34445.1| iojap-like protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 125 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L V++ L+++K DI I TS + + D +VI G S + V S+A N+ ++ Sbjct: 2 KLPQLEKLVVDALEDIKGRDIEVIN-TSRLTALFDRIVIACGDSNRQVKSLARNVQDKVR 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|15606493|ref|NP_213873.1| hypothetical protein aq_1272 [Aquifex aeolicus VF5] gi|2983719|gb|AAC07282.1| hypothetical protein aq_1272 [Aquifex aeolicus VF5] Length = 109 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + E L+ KAEDI ++ + + + D VI + ST H ++AD L L+K+ Sbjct: 2 EKLKLIKELLENKKAEDIVILDVSK-LTNLADYFVIATANSTTHARALADYLEEELEKR 59 >gi|146318029|ref|YP_001197741.1| hypothetical protein SSU05_0374 [Streptococcus suis 05ZYH33] gi|146320212|ref|YP_001199923.1| hypothetical protein SSU98_0365 [Streptococcus suis 98HAH33] gi|253751235|ref|YP_003024376.1| hypothetical protein SSUSC84_0328 [Streptococcus suis SC84] gi|253753136|ref|YP_003026276.1| hypothetical protein SSU0342 [Streptococcus suis P1/7] gi|253754959|ref|YP_003028099.1| hypothetical protein SSUBM407_0331 [Streptococcus suis BM407] gi|145688835|gb|ABP89341.1| Uncharacterized plant Iojap protein-like protein [Streptococcus suis 05ZYH33] gi|145691018|gb|ABP91523.1| Uncharacterized plant Iojap protein-like protein [Streptococcus suis 98HAH33] gi|251815524|emb|CAZ51106.1| conserved hypothetical protein [Streptococcus suis SC84] gi|251817423|emb|CAZ55163.1| conserved hypothetical protein [Streptococcus suis BM407] gi|251819381|emb|CAR44801.1| conserved hypothetical protein [Streptococcus suis P1/7] gi|292557802|gb|ADE30803.1| Iojap-related protein [Streptococcus suis GZ1] gi|319757512|gb|ADV69454.1| hypothetical protein SSUJS14_0351 [Streptococcus suis JS14] Length = 119 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ + +AED+ I+ + + D VI S +++ + +IA+N+ + Sbjct: 5 DLVKVVVQAADDKRAEDLVVIDV-QGVTSLTDYFVIASSMNSRQLEAIAENIREKV 59 >gi|33597010|ref|NP_884653.1| hypothetical protein BPP2418 [Bordetella parapertussis 12822] gi|33566461|emb|CAE37714.1| conserved hypothetical protein [Bordetella parapertussis] Length = 128 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 9/58 (15%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +++ L+++KA+DI + + + D ++I S S + ++ ++ Sbjct: 2 DIQKLQRAIIDALEDVKAQDIKVFNTSE-LTSLFDRVIIASATSNRQTRALTSSVADR 58 >gi|319404623|emb|CBI78229.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 120 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L+++KAEDI I+ R + D MVI SG S +HV +I D L+S K Sbjct: 7 LKIILSSLEDIKAEDIISIDLR-GRFSLADYMVIASGCSQRHVLAITDRLLSVWK 60 >gi|307264286|ref|ZP_07545875.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|306870350|gb|EFN02105.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 128 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M+I +G S +HVAS AD L + K+ Sbjct: 27 QNLVEFLTKTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTADRLSAEAKQ 84 >gi|148560004|ref|YP_001259678.1| iojap-like protein [Brucella ovis ATCC 25840] gi|260884552|ref|ZP_05896166.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|261222957|ref|ZP_05937238.1| conserved hypothetical protein [Brucella ceti B1/94] gi|261325869|ref|ZP_05965066.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|265987403|ref|ZP_06099960.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] gi|265998916|ref|ZP_06111473.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|148371261|gb|ABQ61240.1| iojap-related protein [Brucella ovis ATCC 25840] gi|260874080|gb|EEX81149.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] gi|260921541|gb|EEX88194.1| conserved hypothetical protein [Brucella ceti B1/94] gi|261301849|gb|EEY05346.1| conserved hypothetical protein [Brucella neotomae 5K33] gi|262553605|gb|EEZ09374.1| conserved hypothetical protein [Brucella ceti M490/95/1] gi|264659600|gb|EEZ29861.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 156 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L Sbjct: 34 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHL 92 Query: 70 ISYLKK 75 + L++ Sbjct: 93 VQALRE 98 >gi|172056807|ref|YP_001813267.1| iojap-like protein [Exiguobacterium sibiricum 255-15] gi|171989328|gb|ACB60250.1| iojap-like protein [Exiguobacterium sibiricum 255-15] Length = 115 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + ++ + + +AEDI ++ +S+ S I D VI G S K V +IA + Sbjct: 2 TVEQELKLIVNAIDDKRAEDIVVLDMSSI-SPIADYFVICEGNSEKQVQAIAREVKEVAH 60 Query: 75 KK 76 K Sbjct: 61 KN 62 >gi|320547433|ref|ZP_08041720.1| Iojap protein family protein [Streptococcus equinus ATCC 9812] gi|320447910|gb|EFW88666.1| Iojap protein family protein [Streptococcus equinus ATCC 9812] Length = 117 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ E +AED+ ++ + + D V+VS +T+ + +IA+N+ +K Sbjct: 2 DKKELLELVVKAADEKRAEDMVVLDLY-GLTSVTDYFVVVSAMNTRQLDAIAENIREKVK 60 >gi|152996862|ref|YP_001341697.1| iojap-like protein [Marinomonas sp. MWYL1] gi|150837786|gb|ABR71762.1| iojap-like protein [Marinomonas sp. MWYL1] Length = 117 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 Q D +A +E L+++K + I + + + + D MVI +G S +HV ++ N Sbjct: 1 MSQLNLTADQILAFAVEALEDVKGDKITVLNVANH-TDMMDYMVICTGTSKRHVNALGQN 59 Query: 69 LISYLKKK 76 + +LK K Sbjct: 60 VFEHLKGK 67 >gi|239996936|ref|ZP_04717460.1| iojap domain protein [Alteromonas macleodii ATCC 27126] Length = 105 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V + + ++K D+ ++ +S I D M+I SG S +HV+SIA+N++ K Sbjct: 2 ESQQLKQFVKDKIDDMKGRDVIELDVR-GKSSITDTMIICSGNSKRHVSSIAENVMVEAK 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|167771624|ref|ZP_02443677.1| hypothetical protein ANACOL_02996 [Anaerotruncus colihominis DSM 17241] gi|167666264|gb|EDS10394.1| hypothetical protein ANACOL_02996 [Anaerotruncus colihominis DSM 17241] Length = 115 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + + L E KA+DI +E + I D VI SG S V +++D + L Sbjct: 2 TSNEMVKKIARFLSEKKAKDIMALEIRE-LTTIGDYFVIASGGSDTQVKALSDAVEEGL 59 >gi|311105292|ref|YP_003978145.1| hypothetical protein AXYL_02106 [Achromobacter xylosoxidans A8] gi|310759981|gb|ADP15430.1| hypothetical protein AXYL_02106 [Achromobacter xylosoxidans A8] Length = 133 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L+++KA+DI T + + D +VI S S + ++A ++ Sbjct: 2 DIQKLQRAVIDALEDVKAQDIKVYNTTH-LTSLFDRVVIASATSNRQTRALASSVADR 58 >gi|260435315|ref|ZP_05789285.1| iojap like protein [Synechococcus sp. WH 8109] gi|260413189|gb|EEX06485.1| iojap like protein [Synechococcus sp. WH 8109] Length = 118 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V + + KA DI I S + D MVI G+S V +IA ++ L+ Sbjct: 2 DSEKLAELVADACDDRKATDIRLIRV-DEVSSLADWMVIAGGQSDVQVRAIARSVEDRLE 60 Query: 75 KK 76 + Sbjct: 61 TE 62 >gi|88808800|ref|ZP_01124310.1| Iojap-related protein [Synechococcus sp. WH 7805] gi|88787788|gb|EAR18945.1| Iojap-related protein [Synechococcus sp. WH 7805] Length = 121 Score = 66.6 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + KA DI I S + D MVI G+S V +IA ++ L+ Sbjct: 2 DSEQLAELAADACDDRKAVDIQLIRV-DEVSSLADWMVIAGGQSDVQVRAIARSVEDRLE 60 Query: 75 KK 76 + Sbjct: 61 DE 62 >gi|260591352|ref|ZP_05856810.1| iojap-like protein [Prevotella veroralis F0319] gi|260536718|gb|EEX19335.1| iojap-like protein [Prevotella veroralis F0319] Length = 117 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + +++ K I + + + IC+ +I G ST+ V +IA+++ Y Sbjct: 1 MKETKRLVELITKGIQDKKGHGIVIADLSGIDGTICNYFIICQGNSTQQVEAIAESVSDY 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|56421055|ref|YP_148373.1| hypothetical protein GK2520 [Geobacillus kaustophilus HTA426] gi|56380897|dbj|BAD76805.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426] Length = 118 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE I + SL+ D VI G S K V +IA + ++ Sbjct: 4 QEALQLVVRAADDKKAEQIVVLNM-KGISLVADYFVICHGNSDKQVQAIAREIQDQAEEH 62 >gi|225628392|ref|ZP_03786426.1| iojap-related protein [Brucella ceti str. Cudo] gi|237816205|ref|ZP_04595200.1| iojap-related protein [Brucella abortus str. 2308 A] gi|260547057|ref|ZP_05822795.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260568912|ref|ZP_05839380.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261757487|ref|ZP_06001196.1| conserved hypothetical protein [Brucella sp. F5/99] gi|294851082|ref|ZP_06791758.1| hypothetical protein BAZG_03215 [Brucella sp. NVSL 07-0026] gi|297249096|ref|ZP_06932804.1| hypothetical protein BAYG_03139 [Brucella abortus bv. 5 str. B3196] gi|225616238|gb|EEH13286.1| iojap-related protein [Brucella ceti str. Cudo] gi|237788667|gb|EEP62880.1| iojap-related protein [Brucella abortus str. 2308 A] gi|260095422|gb|EEW79300.1| conserved hypothetical protein [Brucella abortus NCTC 8038] gi|260154296|gb|EEW89378.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261737471|gb|EEY25467.1| conserved hypothetical protein [Brucella sp. F5/99] gi|294821725|gb|EFG38721.1| hypothetical protein BAZG_03215 [Brucella sp. NVSL 07-0026] gi|297174229|gb|EFH33586.1| hypothetical protein BAYG_03139 [Brucella abortus bv. 5 str. B3196] Length = 157 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L Sbjct: 35 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHL 93 Query: 70 ISYLKK 75 + L++ Sbjct: 94 VQALRE 99 >gi|88705580|ref|ZP_01103290.1| iojap-related protein [Congregibacter litoralis KT71] gi|88700093|gb|EAQ97202.1| iojap-related protein [Congregibacter litoralis KT71] Length = 118 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V E L +LK + ++ S + D ++I SG S++HV S+ADN+ K Sbjct: 2 NLVTEALDDLKGVNPVTLDVRE-LSNVMDYLIICSGTSSRHVKSLADNVSRMSK 54 >gi|226311580|ref|YP_002771474.1| hypothetical protein BBR47_19930 [Brevibacillus brevis NBRC 100599] gi|226094528|dbj|BAH42970.1| conserved hypothetical protein [Brevibacillus brevis NBRC 100599] Length = 118 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ V++ ++ KAE++ ++ S+I D +I G + + V +I + Sbjct: 3 KTVEDLAQLVVKAAEDKKAENLKVLDIRK-LSVIADYFMICHGNNERQVQAIVREIRDQA 61 Query: 74 KKK 76 K Sbjct: 62 HKN 64 >gi|299144201|ref|ZP_07037281.1| iojap-like protein [Peptoniphilus sp. oral taxon 386 str. F0131] gi|298518686|gb|EFI42425.1| iojap-like protein [Peptoniphilus sp. oral taxon 386 str. F0131] Length = 116 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +++ ++ K DI ++ S I D VIVSG S+ V ++AD + + ++ Sbjct: 3 NKKLDIIVKSCEDKKGTDIKVLDI-KGLSSIADYFVIVSGNSSNQVNALADEIEDKMSEE 61 >gi|223044361|ref|ZP_03614395.1| iojap protein family [Staphylococcus capitis SK14] gi|314933762|ref|ZP_07841127.1| iojap-like protein [Staphylococcus caprae C87] gi|222442230|gb|EEE48341.1| iojap protein family [Staphylococcus capitis SK14] gi|313653912|gb|EFS17669.1| iojap-like protein [Staphylococcus caprae C87] Length = 117 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + +E + KAED+ + S + D V+ G + + V SIA + + Sbjct: 2 SSEELLNIAVEATENKKAEDVISLNM-QGISDMTDYFVVCHGNNERQVQSIARAVKEAVH 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|170077494|ref|YP_001734132.1| iojap-related protein [Synechococcus sp. PCC 7002] gi|169885163|gb|ACA98876.1| iojap-related protein [Synechococcus sp. PCC 7002] Length = 127 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + KAEDI ++ S + D V+ +G S V +IAD + L+ K Sbjct: 14 RLVWDIAAAADDRKAEDIAILKV-DQISYLADFFVVATGFSRTQVRAIADAIEERLETK 71 >gi|70726324|ref|YP_253238.1| hypothetical protein SH1323 [Staphylococcus haemolyticus JCSC1435] gi|68447048|dbj|BAE04632.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435] Length = 117 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + ++ + KAEDI + S + D V+ G + + V SIA + Sbjct: 2 NSEELLNIAVDATENKKAEDIVSLNM-KGISDMTDYFVVCHGNNERQVQSIARAVKEAAH 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|319944362|ref|ZP_08018636.1| Iojap family protein [Lautropia mirabilis ATCC 51599] gi|319742323|gb|EFV94736.1| Iojap family protein [Lautropia mirabilis ATCC 51599] Length = 144 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 11/68 (16%), Positives = 31/68 (45%), Gaps = 7/68 (10%) Query: 15 HLDSCIATVMECLKELKAEDICHIEN-------TSLRSLICDNMVIVSGRSTKHVASIAD 67 + V++ L+++KA+DI + + S + D +V+ + S + ++A Sbjct: 2 SISELQYLVVDALEDVKAQDIRVFDTGPQRNAKSPALSDLFDRVVVATATSNRQTRALAA 61 Query: 68 NLISYLKK 75 ++ ++ Sbjct: 62 HVQDRARE 69 >gi|300767175|ref|ZP_07077087.1| iojap-like protein [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|300494994|gb|EFK30150.1| iojap-like protein [Lactobacillus plantarum subsp. plantarum ATCC 14917] Length = 118 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E + +A+DI ++ SL+ D VI+S S + V +IADN++ +++ Sbjct: 2 DSKELLQLTVEAADDKRADDIVALDVAE-VSLMADYFVILSADSKRQVQAIADNIVDFVR 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|148239763|ref|YP_001225150.1| hypothetical protein SynWH7803_1427 [Synechococcus sp. WH 7803] gi|147848302|emb|CAK23853.1| Conserved hypothetical protein [Synechococcus sp. WH 7803] Length = 121 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + E + KA DI I S + D MVI G+S V +IA ++ L+ Sbjct: 2 DSEQLAELAAEACDDRKAVDIQLIRV-DEVSSLADWMVIAGGQSDVQVRAIARSVEDRLE 60 Query: 75 KK 76 + Sbjct: 61 DE 62 >gi|255529947|ref|YP_003090319.1| iojap-like protein [Pedobacter heparinus DSM 2366] gi|255342931|gb|ACU02257.1| iojap-like protein [Pedobacter heparinus DSM 2366] Length = 124 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 28/58 (48%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++E K DI ++ +L S + D +I + S V +IAD++ + KK Sbjct: 13 LSEIAVHGIQEKKGNDIVRLDLRALNSSVSDYFIICNADSATQVKAIADSVEEEIYKK 70 >gi|323486896|ref|ZP_08092212.1| hypothetical protein HMPREF9474_03963 [Clostridium symbiosum WAL-14163] gi|323399759|gb|EGA92141.1| hypothetical protein HMPREF9474_03963 [Clostridium symbiosum WAL-14163] Length = 117 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ L++ K EDI I+ S++ D +I +G + V ++ D++ Sbjct: 1 MTQASKMAKIAVKALEDKKGEDIRIIDIRD-VSILADYFIIANGNNASQVQAMVDSVEEE 59 Query: 73 LKKK 76 L K+ Sbjct: 60 LLKE 63 >gi|253574702|ref|ZP_04852042.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786 str. D14] gi|251845748|gb|EES73756.1| conserved hypothetical protein [Paenibacillus sp. oral taxon 786 str. D14] Length = 115 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ + KA +I ++ SLI D VI G S V +IA + Sbjct: 4 SSNELMNLAVQAADDKKAMNIVALDL-KGISLIADYFVICHGNSDTQVQAIATEIRKRAH 62 Query: 75 K 75 + Sbjct: 63 E 63 >gi|33863096|ref|NP_894656.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9313] gi|33635013|emb|CAE20999.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9313] Length = 126 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++T+ + E + KA DI I S + D MVI G S V +IA ++ Sbjct: 1 MRTSMDSEQLAEMAAEACDDRKATDIQLIRI-DEVSSLADWMVIAGGLSEVQVRAIAKSV 59 Query: 70 ISYL 73 L Sbjct: 60 EDRL 63 >gi|304320603|ref|YP_003854246.1| iojap-related protein [Parvularcula bermudensis HTCC2503] gi|303299505|gb|ADM09104.1| iojap-related protein [Parvularcula bermudensis HTCC2503] Length = 166 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +A V L + +A+D+ I+ +S + D M+I SGRS +HVASIAD ++ LK+ Sbjct: 41 LAIVQSQLDDDQAQDVVTIDL-EGKSDVADAMIIASGRSQRHVASIADKMMRALKE 95 >gi|323344885|ref|ZP_08085109.1| Iojap family protein [Prevotella oralis ATCC 33269] gi|323094155|gb|EFZ36732.1| Iojap family protein [Prevotella oralis ATCC 33269] Length = 120 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 11/63 (17%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + T+ + ++E K +DI ++ + I + +I G S V +I +++ Sbjct: 1 MEQIKLLVKTITKGIQEKKGQDITIVDLQGIDGTIANYFIICQGNSPTQVEAITESVGDT 60 Query: 73 LKK 75 +++ Sbjct: 61 VRQ 63 >gi|289550637|ref|YP_003471541.1| Iojap-related protein [Staphylococcus lugdunensis HKU09-01] gi|289180169|gb|ADC87414.1| Iojap-related protein [Staphylococcus lugdunensis HKU09-01] Length = 117 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ + KAEDI ++ S + D V+ G + + V SIA + + Sbjct: 2 SSEQLLTMTVKATENKKAEDIVSLDM-KGISDMTDYFVVCHGNNERQVQSIARAVKEMAQ 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|77359973|ref|YP_339548.1| hypothetical protein PSHAa1027 [Pseudoalteromonas haloplanktis TAC125] gi|76874884|emb|CAI86105.1| conserved protein of unknown function [Pseudoalteromonas haloplanktis TAC125] Length = 105 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A ++ ++++KA D+ HI+ T+ S I D MV+ SG S +HV SIADNL + Sbjct: 2 DSKQLLAFAIDKIEDMKARDVIHIDVTAT-SDITDYMVVCSGTSKRHVLSIADNLAKEAR 60 >gi|291515859|emb|CBK65069.1| iojap-related protein [Alistipes shahii WAL 8301] Length = 116 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D I T++ +++ K ++I ++ + IC + V+ + ST V +IA + + + Sbjct: 1 MDKLIETIVSAIEDKKGKNIVSLDLSGFDGAICSHFVVCNADSTTQVCAIAAEIEEKVFE 60 Query: 76 K 76 K Sbjct: 61 K 61 >gi|28378244|ref|NP_785136.1| hypothetical protein lp_1532 [Lactobacillus plantarum WCFS1] gi|254556452|ref|YP_003062869.1| hypothetical protein JDM1_1285 [Lactobacillus plantarum JDM1] gi|308180394|ref|YP_003924522.1| hypothetical protein LPST_C1209 [Lactobacillus plantarum subsp. plantarum ST-III] gi|28271079|emb|CAD63984.1| unknown [Lactobacillus plantarum WCFS1] gi|254045379|gb|ACT62172.1| conserved hypothetical protein [Lactobacillus plantarum JDM1] gi|308045885|gb|ADN98428.1| hypothetical protein LPST_C1209 [Lactobacillus plantarum subsp. plantarum ST-III] Length = 118 Score = 66.3 bits (161), Expect = 1e-09, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E + +A+DI ++ SL+ D VI+S S + V +IADN++ +++ Sbjct: 2 DSKELLQLTVEAADDKRADDIVALDVAE-VSLMADYFVILSADSKRQVQAIADNIVDFVR 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|313114989|ref|ZP_07800482.1| ribosome-associated protein, iojap family [Faecalibacterium cf. prausnitzii KLE1255] gi|310622680|gb|EFQ06142.1| ribosome-associated protein, iojap family [Faecalibacterium cf. prausnitzii KLE1255] Length = 127 Score = 66.3 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + L + KA D+ ++ +++ D VI SG ST VAS+AD + Sbjct: 1 MENFNDSKALAIEIAKILDKKKAHDVRVLKV-ESLTVLTDYFVIASGTSTTQVASLADEV 59 Query: 70 ISYLKKK 76 L +K Sbjct: 60 EYELSQK 66 >gi|191638675|ref|YP_001987841.1| YqeL [Lactobacillus casei BL23] gi|227534818|ref|ZP_03964867.1| Iojap family protein [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|239632048|ref|ZP_04675079.1| iojap family protein [Lactobacillus paracasei subsp. paracasei 8700:2] gi|301066730|ref|YP_003788753.1| Iojap family protein [Lactobacillus casei str. Zhang] gi|190712977|emb|CAQ66983.1| YqeL [Lactobacillus casei BL23] gi|227187574|gb|EEI67641.1| Iojap family protein [Lactobacillus paracasei subsp. paracasei ATCC 25302] gi|239526513|gb|EEQ65514.1| iojap family protein [Lactobacillus paracasei subsp. paracasei 8700:2] gi|300439137|gb|ADK18903.1| Iojap family protein [Lactobacillus casei str. Zhang] gi|327382716|gb|AEA54192.1| Iojap-like protein [Lactobacillus casei LC2W] gi|327385903|gb|AEA57377.1| Iojap-like protein [Lactobacillus casei BD-II] Length = 119 Score = 66.3 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++ +AEDI ++ SL+ D VI+SG S + V +I D + Sbjct: 1 MIDSKTMLEVAVKAGDSKRAEDIVALDMR-GVSLLADYFVIMSGTSDRQVQAIVDEIEDK 59 >gi|16272009|ref|NP_438207.1| hypothetical protein HI0034 [Haemophilus influenzae Rd KW20] gi|68248585|ref|YP_247697.1| hypothetical protein NTHI0042 [Haemophilus influenzae 86-028NP] gi|148825685|ref|YP_001290438.1| hypothetical protein CGSHiEE_03140 [Haemophilus influenzae PittEE] gi|260580662|ref|ZP_05848489.1| conserved hypothetical protein [Haemophilus influenzae RdAW] gi|1175561|sp|P44471|Y034_HAEIN RecName: Full=Uncharacterized protein HI_0034 gi|1572979|gb|AAC21712.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20] gi|68056784|gb|AAX87037.1| conserved hypothetical protein [Haemophilus influenzae 86-028NP] gi|148715845|gb|ABQ98055.1| hypothetical protein CGSHiEE_03140 [Haemophilus influenzae PittEE] gi|260092724|gb|EEW76660.1| conserved hypothetical protein [Haemophilus influenzae RdAW] gi|309972832|gb|ADO96033.1| Conserved hypothetical protein [Haemophilus influenzae R2846] Length = 102 Score = 66.3 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +ME L LK DI H + +S I DNM+I +G S++ V+++ADNLI+ KK Sbjct: 3 LVEFLMETLDGLKGTDIVHFDVR-GKSSITDNMIICTGTSSRQVSAMADNLITECKK 58 >gi|228473606|ref|ZP_04058358.1| iojap-related protein [Capnocytophaga gingivalis ATCC 33624] gi|228274978|gb|EEK13788.1| iojap-related protein [Capnocytophaga gingivalis ATCC 33624] Length = 118 Score = 66.3 bits (161), Expect = 2e-09, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 37/67 (55%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ + +++++E + ++K +DI ++ S+ + +C VI +G S V++I+ + Sbjct: 1 MSEKNNTEQMLSSILEGILKVKGQDITILDLRSIENAVCSYFVICTGGSNTQVSAISGAV 60 Query: 70 ISYLKKK 76 +K Sbjct: 61 QRQTPQK 67 >gi|220924596|ref|YP_002499898.1| iojap-like protein [Methylobacterium nodulans ORS 2060] gi|219949203|gb|ACL59595.1| iojap-like protein [Methylobacterium nodulans ORS 2060] Length = 109 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 1/50 (2%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 CL+++KAED I+ ++ I D M+I SGRS +HV SIAD L+ LK Sbjct: 6 RCLEDMKAEDTVEIDLA-GKTSIADAMIITSGRSHRHVGSIADKLLQELK 54 >gi|308048538|ref|YP_003912104.1| iojap-like protein [Ferrimonas balearica DSM 9799] gi|307630728|gb|ADN75030.1| iojap-like protein [Ferrimonas balearica DSM 9799] Length = 110 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + +LKA DI ++ + RS +CD MV+ +G S HV SIA++L+ K Sbjct: 5 ELKDFAVDKVDDLKARDIVVLDVSD-RSDVCDFMVVCTGTSKTHVRSIAEHLVVEAKD 61 >gi|284037882|ref|YP_003387812.1| iojap-like protein [Spirosoma linguale DSM 74] gi|283817175|gb|ADB39013.1| iojap-like protein [Spirosoma linguale DSM 74] Length = 131 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 32/61 (52%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ ++E KA+DI ++ +++ ICD V+ SG S + +I+ ++ + Sbjct: 10 TAEQIRDFVVRGMQEKKAQDIVVMDLRKVKNAICDYFVLCSGNSDTQIDAISTSIEEEVY 69 Query: 75 K 75 K Sbjct: 70 K 70 >gi|71279203|ref|YP_268455.1| iojap-related protein [Colwellia psychrerythraea 34H] gi|71144943|gb|AAZ25416.1| iojap-related protein [Colwellia psychrerythraea 34H] Length = 106 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + A V+E L+++K DI + + ++ D M+I SG S +HV SIA ++ + Sbjct: 2 QTEQLKAFVIEKLEDMKGRDIIALNISD-KASFADYMIICSGNSNRHVKSIAQSVAMECR 60 Query: 75 KK 76 + Sbjct: 61 AQ 62 >gi|332524162|ref|ZP_08400391.1| hypothetical protein RBXJA2T_00255 [Rubrivivax benzoatilyticus JA2] gi|332107500|gb|EGJ08724.1| hypothetical protein RBXJA2T_00255 [Rubrivivax benzoatilyticus JA2] Length = 223 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 10/60 (16%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA++I T S + + ++I + S + ++A ++ +K Sbjct: 2 DIRKLQRAIVDGLEDVKAQNIAVFN-TEALSPLFERVIIATATSNRQTKALASSVRETVK 60 >gi|295094855|emb|CBK83946.1| iojap-related protein [Coprococcus sp. ART55/1] Length = 116 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L++ KA DI I+ + + S +CD +VI G + K V +++DN+ Sbjct: 1 MADSREMLKIACAALEDKKAFDIKIIDISRI-STLCDYIVIADGTNKKQVQALSDNVEDN 59 Query: 73 LKK 75 + + Sbjct: 60 MHE 62 >gi|323691940|ref|ZP_08106190.1| hypothetical protein HMPREF9475_01053 [Clostridium symbiosum WAL-14673] gi|323503998|gb|EGB19810.1| hypothetical protein HMPREF9475_01053 [Clostridium symbiosum WAL-14673] Length = 117 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ L++ K EDI I+ S++ D +I +G + V ++ D++ Sbjct: 1 MTQASKMAKIAVKALEDKKGEDIRIIDIRD-VSILADYFIIANGNNASQVQAMVDSVEEE 59 Query: 73 LKKK 76 L K+ Sbjct: 60 LLKE 63 >gi|313896260|ref|ZP_07829813.1| iojap-like protein [Selenomonas sp. oral taxon 137 str. F0430] gi|312975059|gb|EFR40521.1| iojap-like protein [Selenomonas sp. oral taxon 137 str. F0430] Length = 114 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + CI V + E KA DI ++ L S D VI S + V +I DN+ Sbjct: 1 MTEQEKCI-AVCKAADEKKARDIVTMDMRGLMST-NDYFVICSANTATQVRAIVDNIEEK 58 Query: 73 LKK 75 L++ Sbjct: 59 LEE 61 >gi|149370158|ref|ZP_01890009.1| hypothetical protein SCB49_03754 [unidentified eubacterium SCB49] gi|149356649|gb|EDM45205.1| hypothetical protein SCB49_03754 [unidentified eubacterium SCB49] Length = 125 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 32/67 (47%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D I ++ ++E+K DI ++ L + + D +I +G S HV +I ++ Sbjct: 3 MAKKHAETDQLITQAIKGIEEVKGLDIEILDLRELENTVTDYFIICNGTSNTHVNAIVNS 62 Query: 69 LISYLKK 75 + + K Sbjct: 63 IQKTVSK 69 >gi|301168635|emb|CBW28225.1| predicted protein [Haemophilus influenzae 10810] Length = 102 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +ME L+ LK DI H + +S I DNM+I +G S++ V+++ADNLI+ KK Sbjct: 3 LVEFLMETLEGLKGTDIVHFDVR-GKSSITDNMIICTGTSSRQVSAMADNLITECKK 58 >gi|164687830|ref|ZP_02211858.1| hypothetical protein CLOBAR_01474 [Clostridium bartlettii DSM 16795] gi|164603105|gb|EDQ96570.1| hypothetical protein CLOBAR_01474 [Clostridium bartlettii DSM 16795] Length = 116 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + + + +DI I S +CD +I + S++ V +IAD++ Sbjct: 2 TVEQMVKVAYDAIDDKLGQDISIINIGQ-VSSLCDYFIIATASSSRQVKAIADSVQDAFT 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|227539017|ref|ZP_03969066.1| iojap protein family protein [Sphingobacterium spiritivorum ATCC 33300] gi|227241220|gb|EEI91235.1| iojap protein family protein [Sphingobacterium spiritivorum ATCC 33300] Length = 124 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 25/58 (43%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ++E K +I ++ ++ S + D VI ST V +IA ++ + Sbjct: 10 SSKLAEIAVHGMQEKKGNEIVRLDLRNINSSVSDYFVICHADSTTQVNAIAKSVEEEI 67 >gi|89897969|ref|YP_515079.1| chloroplast development gene iojap superfamily protein [Chlamydophila felis Fe/C-56] gi|89331341|dbj|BAE80934.1| chloroplast development gene iojAP superfamily [Chlamydophila felis Fe/C-56] Length = 119 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + + + + K + ++ ++ S + D + G HV ++AD ++ LK+ N Sbjct: 7 NLLKVIAKVIDNKKGNNPVVLDVRAI-SQLTDYFIFAEGNIGVHVKALADTIVQELKEHN 65 >gi|309798775|ref|ZP_07693039.1| iojap family protein [Streptococcus infantis SK1302] gi|308117592|gb|EFO55004.1| iojap family protein [Streptococcus infantis SK1302] Length = 116 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQE-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|42520921|ref|NP_966836.1| iojap-related protein [Wolbachia endosymbiont of Drosophila melanogaster] gi|58698302|ref|ZP_00373219.1| iojap protein family [Wolbachia endosymbiont of Drosophila ananassae] gi|99034968|ref|ZP_01314771.1| hypothetical protein Wendoof_01000394 [Wolbachia endosymbiont of Drosophila willistoni TSC#14030-0811.24] gi|225630968|ref|YP_002727759.1| iojap-related protein [Wolbachia sp. wRi] gi|225631310|ref|ZP_03787985.1| iojap-related protein [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|42410662|gb|AAS14770.1| iojap-related protein [Wolbachia endosymbiont of Drosophila melanogaster] gi|58535175|gb|EAL59257.1| iojap protein family [Wolbachia endosymbiont of Drosophila ananassae] gi|225590985|gb|EEH12192.1| iojap-related protein [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225592949|gb|ACN95968.1| iojap-related protein [Wolbachia sp. wRi] Length = 105 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 38/65 (58%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++S +T+ E + + K DI + + +++I M+I SG S++HV ++A+++I Sbjct: 2 LSDMESIRSTIEEIIDQNKGHDIVTFDVQN-KTVIAKYMIIASGDSSRHVKALAEHVIKS 60 Query: 73 LKKKN 77 LK + Sbjct: 61 LKPHD 65 >gi|332289420|ref|YP_004420272.1| iojap-like ribosome-associated protein [Gallibacterium anatis UMN179] gi|330432316|gb|AEC17375.1| iojap-like ribosome-associated protein [Gallibacterium anatis UMN179] Length = 100 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 25/58 (43%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + T++E L LKA+DI ++ +S I D++VI +G S++HVAS+A+NLI+Y K+ Sbjct: 1 MLETIVEQLDNLKAKDILVLDV-KGKSPITDDLVICTGNSSRHVASLAENLIAYCKQH 57 >gi|300770525|ref|ZP_07080404.1| iojap-like protein [Sphingobacterium spiritivorum ATCC 33861] gi|300763001|gb|EFK59818.1| iojap-like protein [Sphingobacterium spiritivorum ATCC 33861] Length = 124 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 25/58 (43%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ++E K +I ++ ++ S + D VI ST V +IA ++ + Sbjct: 10 SSKLAEIAVHGMQEKKGNEIVRLDLRNINSSVSDYFVICHADSTTQVNAIAKSVEEEI 67 >gi|315658132|ref|ZP_07911004.1| iojap-like protein [Staphylococcus lugdunensis M23590] gi|315496461|gb|EFU84784.1| iojap-like protein [Staphylococcus lugdunensis M23590] Length = 117 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ + KAEDI ++ S + D V+ G + + V SIA + + Sbjct: 2 SSEQLLTMTVKATENKKAEDIVSLDM-KGISDMTDYFVVCHGNNERQVQSIARAVKEMAQ 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|160947229|ref|ZP_02094396.1| hypothetical protein PEPMIC_01162 [Parvimonas micra ATCC 33270] gi|158446363|gb|EDP23358.1| hypothetical protein PEPMIC_01162 [Parvimonas micra ATCC 33270] Length = 102 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + +++ L + AE++ I+ +S I + VI +G + H +I D + LKK N Sbjct: 2 EKLDIILKALDDKIAENVVSIDL-KGKSSIAEYFVIATGSAVNHNQAICDEIEFQLKKNN 60 >gi|54023344|ref|YP_117586.1| hypothetical protein nfa13770 [Nocardia farcinica IFM 10152] gi|54014852|dbj|BAD56222.1| hypothetical protein [Nocardia farcinica IFM 10152] Length = 134 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + E A D+ ++ + +I D VI S + + V +I DN+ Sbjct: 1 MSASAEAIEMAEVAARAADEKLASDVVVLDVSEQL-VITDCFVIASAPNERQVNAIVDNV 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EEKLRR 65 >gi|285019236|ref|YP_003376947.1| iojap-related protein [Xanthomonas albilineans GPE PC73] gi|283474454|emb|CBA16955.1| hypothetical iojap-related protein [Xanthomonas albilineans] Length = 137 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 25/55 (45%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 V E ++ELKA+++ I+ +S + D +VIVSG ST+HV SIAD +I Y K+ + Sbjct: 26 VREAVEELKAKEVVEIDVR-GKSSVTDYLVIVSGTSTRHVKSIADEVIKYAKRLD 79 >gi|290579867|ref|YP_003484259.1| hypothetical protein SmuNN2025_0341 [Streptococcus mutans NN2025] gi|254996766|dbj|BAH87367.1| hypothetical protein [Streptococcus mutans NN2025] Length = 120 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + +++ E +AEDI ++ + + D VI+ +++ + +IA+N+ + Sbjct: 4 KKLLELIVKAADEKRAEDIVVMDL-QGLTTLTDYFVIMHATNSRQLEAIAENIREKV 59 >gi|199597213|ref|ZP_03210645.1| Iojap family protein [Lactobacillus rhamnosus HN001] gi|258508729|ref|YP_003171480.1| Iojap-related protein [Lactobacillus rhamnosus GG] gi|258539905|ref|YP_003174404.1| Iojap-related protein [Lactobacillus rhamnosus Lc 705] gi|199592017|gb|EDZ00092.1| Iojap family protein [Lactobacillus rhamnosus HN001] gi|257148656|emb|CAR87629.1| Iojap-related protein [Lactobacillus rhamnosus GG] gi|257151581|emb|CAR90553.1| Iojap-related protein [Lactobacillus rhamnosus Lc 705] gi|259650035|dbj|BAI42197.1| conserved hypothetical protein [Lactobacillus rhamnosus GG] Length = 119 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++ +AEDI ++ SL+ D VI+SG S + V +I D + Sbjct: 1 MIDAKTMLEIAVKAGDSKRAEDIVALDMR-GVSLLADYFVIMSGTSDRQVQAIVDEIEEK 59 >gi|150004473|ref|YP_001299217.1| hypothetical protein BVU_1921 [Bacteroides vulgatus ATCC 8482] gi|254882795|ref|ZP_05255505.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA] gi|294778232|ref|ZP_06743658.1| iojap-like protein [Bacteroides vulgatus PC510] gi|319644312|ref|ZP_07998806.1| iojap protein 155 [Bacteroides sp. 3_1_40A] gi|149932897|gb|ABR39595.1| conserved hypothetical protein [Bacteroides vulgatus ATCC 8482] gi|254835588|gb|EET15897.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA] gi|294447860|gb|EFG16434.1| iojap-like protein [Bacteroides vulgatus PC510] gi|317384207|gb|EFV65180.1| iojap protein 155 [Bacteroides sp. 3_1_40A] Length = 119 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 33/64 (51%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ + + E ++E K ++I + T++ IC VI G S V +I D++ Y Sbjct: 1 MNEAETLVKKITEGIQEKKGKNIVIADLTAINDTICSYFVICQGNSPSQVTAIVDSVKEY 60 Query: 73 LKKK 76 + K+ Sbjct: 61 VHKE 64 >gi|295103260|emb|CBL00804.1| iojap-related protein [Faecalibacterium prausnitzii SL3/3] Length = 127 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L + KA+D+ ++ +++ D VI SG ST VAS+AD + Sbjct: 1 MDNFNDSKALAIEIAKILDKKKAQDVRVLKV-ESLTVLTDYFVIASGTSTTQVASLADEV 59 Query: 70 ISYLKKK 76 L +K Sbjct: 60 EYELSQK 66 >gi|126657779|ref|ZP_01728933.1| putative iojap protein [Cyanothece sp. CCY0110] gi|126620996|gb|EAZ91711.1| putative iojap protein [Cyanothece sp. CCY0110] Length = 147 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + T+ + + KA DI ++ T S + D VIV+G S V +IAD + Sbjct: 21 TSDKQIQNLALTIAQAADDRKASDITILKVTE-VSYLTDYFVIVTGFSRTQVKAIADAIE 79 Query: 71 SYLKKKN 77 + + + Sbjct: 80 EKVYQTH 86 >gi|257439123|ref|ZP_05614878.1| iojap-like protein [Faecalibacterium prausnitzii A2-165] gi|257198374|gb|EEU96658.1| iojap-like protein [Faecalibacterium prausnitzii A2-165] Length = 126 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + L + KA D+ ++ +++ D VI SG ST V ++AD + Sbjct: 1 MENKIDSKTLAIEIAKILDKKKAVDVRVLKV-ESLTVLTDYFVIASGTSTTQVGALADEV 59 Query: 70 ISYLKKK 76 L +K Sbjct: 60 EYELSQK 66 >gi|322374819|ref|ZP_08049333.1| iojap-like protein [Streptococcus sp. C300] gi|321280319|gb|EFX57358.1| iojap-like protein [Streptococcus sp. C300] Length = 117 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQN-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|187478702|ref|YP_786726.1| hypothetical protein BAV2211 [Bordetella avium 197N] gi|115423288|emb|CAJ49821.1| conserved hypothetical protein [Bordetella avium 197N] Length = 136 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ L+++KA+DI T + + D ++I S S + ++A ++ Sbjct: 2 DIQKLQRAVIDALEDVKAQDIKVFSTTH-LTSLFDRVIIASATSNRQTRALASSVAD 57 >gi|313201851|ref|YP_004040509.1| iojap-like protein [Methylovorus sp. MP688] gi|312441167|gb|ADQ85273.1| iojap-like protein [Methylovorus sp. MP688] Length = 114 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V++ L+++KA DI ++ + + + M++ S ST+ ++ADN+ L++K Sbjct: 4 AVIDALEDIKAFDITVMDVRK-LTSMTNYMIVASANSTRQAKAVADNVREKLREK 57 >gi|160946010|ref|ZP_02093236.1| hypothetical protein FAEPRAM212_03543 [Faecalibacterium prausnitzii M21/2] gi|158443741|gb|EDP20746.1| hypothetical protein FAEPRAM212_03543 [Faecalibacterium prausnitzii M21/2] Length = 127 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L + KA+D+ ++ +++ D VI SG ST VAS+AD + Sbjct: 1 MDNFNDSKALAIEIAKILDKKKAQDVRVLKV-ESLTVLTDYFVIASGTSTTQVASLADEV 59 Query: 70 ISYLKKK 76 L +K Sbjct: 60 EYELSQK 66 >gi|24372753|ref|NP_716795.1| iojap domain-containing protein [Shewanella oneidensis MR-1] gi|24346824|gb|AAN54240.1|AE015560_13 iojap domain protein [Shewanella oneidensis MR-1] Length = 109 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ + +LKA D+ I+ ++ +S I D MVI SG S HV +IA+NL+ K Sbjct: 5 ELKQFVVDKIDDLKARDVVVIDVSN-QSNITDYMVICSGTSKTHVKAIAENLVIEAK 60 >gi|288800839|ref|ZP_06406296.1| conserved hypothetical protein [Prevotella sp. oral taxon 299 str. F0039] gi|288332300|gb|EFC70781.1| conserved hypothetical protein [Prevotella sp. oral taxon 299 str. F0039] Length = 119 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 29/59 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 ++ + T+++ ++E K +I ++ + I + VI G S + +I+D++ Sbjct: 1 MKEINKLVETIVKGIQEKKGSNITIVDLRDIDGSIANYFVICQGSSPNQIEAISDSIAE 59 >gi|157150230|ref|YP_001449766.1| iojap-related protein [Streptococcus gordonii str. Challis substr. CH1] gi|157075024|gb|ABV09707.1| iojap-related protein [Streptococcus gordonii str. Challis substr. CH1] Length = 121 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ + Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKAAE 61 >gi|116495167|ref|YP_806901.1| Iojap family protein [Lactobacillus casei ATCC 334] gi|116105317|gb|ABJ70459.1| Iojap family protein [Lactobacillus casei ATCC 334] Length = 119 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++ +AEDI ++ SL+ D VI+SG S + V +I D + Sbjct: 1 MIDSKTMLEVAVKAGDSKRAEDIVALDMR-GVSLLADYFVIMSGTSDRQVQAIVDEIEDK 59 >gi|320109258|ref|YP_004184848.1| iojap-like protein [Terriglobus saanensis SP1PR4] gi|319927779|gb|ADV84854.1| iojap-like protein [Terriglobus saanensis SP1PR4] Length = 201 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 27/60 (45%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D +A ++ KAEDI + S + D +I +G + + +I+D + LK Sbjct: 5 ETDQLLAAAVDACDSKKAEDIRILALDVSESALTDYFLICNGTNDRQNVAISDEIEYRLK 64 >gi|121604636|ref|YP_981965.1| iojap-like protein [Polaromonas naphthalenivorans CJ2] gi|120593605|gb|ABM37044.1| iojap-like protein [Polaromonas naphthalenivorans CJ2] Length = 289 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 9/70 (12%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + + + + +++ L+++KA++I + T + + + +++ SG S + ++ Sbjct: 7 KTPSTEGKKDVQKLQRAIIDGLEDVKAQNIQVFD-TEHITSLFERVIVASGTSNRQTKAL 65 Query: 66 ADNLISYLKK 75 A ++ ++ Sbjct: 66 AASVRDAVRD 75 >gi|261418462|ref|YP_003252144.1| iojap-like protein [Geobacillus sp. Y412MC61] gi|319767577|ref|YP_004133078.1| iojap-like protein [Geobacillus sp. Y412MC52] gi|261374919|gb|ACX77662.1| iojap-like protein [Geobacillus sp. Y412MC61] gi|317112443|gb|ADU94935.1| iojap-like protein [Geobacillus sp. Y412MC52] Length = 118 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V+ + KAE I + SL+ D VI G S K V +IA + ++ Sbjct: 4 QEALQLVVRAADDKKAEQIVILNM-KGISLVADYFVICHGNSDKQVQAIAREIQDQAEEH 62 >gi|325523576|gb|EGD01873.1| iojap domain protein [Burkholderia sp. TJI49] Length = 137 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Query: 26 CLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 L+++KA+DI TS + + D +V+ SG S + ++A ++ +K+ Sbjct: 1 ALEDVKAQDIKVFN-TSHLTELFDRVVVASGTSNRQTKALASSVREKVKE 49 >gi|145588799|ref|YP_001155396.1| iojap-like protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] gi|145047205|gb|ABP33832.1| iojap-like protein [Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1] Length = 129 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L +++ L+++KA+DI + T S + D ++I +G S + S+A ++ + Sbjct: 2 DLRKLQRVIIDALEDVKAQDIRVYDTTK-LSELFDRVIIATGSSNRQTRSLAMSVKEEV 59 >gi|52841607|ref|YP_095406.1| hypothetical protein lpg1377 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54294263|ref|YP_126678.1| hypothetical protein lpl1328 [Legionella pneumophila str. Lens] gi|52628718|gb|AAU27459.1| hypothetical protein lpg1377 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53754095|emb|CAH15568.1| hypothetical protein lpl1328 [Legionella pneumophila str. Lens] gi|307610078|emb|CBW99617.1| hypothetical protein LPW_13861 [Legionella pneumophila 130b] Length = 112 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +++ L++++A DI I+ ++ I D MV+ SGRS++HV SIA ++ Sbjct: 1 MLEKNPTLEKLLKSLEDIQAIDIKIIDV-HKQTTITDFMVVTSGRSSRHVKSIAQKVLED 59 Query: 73 LK 74 +K Sbjct: 60 MK 61 >gi|145629109|ref|ZP_01784908.1| hypothetical protein CGSHi22121_09915 [Haemophilus influenzae 22.1-21] gi|145635218|ref|ZP_01790922.1| hypothetical protein CGSHiAA_02381 [Haemophilus influenzae PittAA] gi|145639677|ref|ZP_01795280.1| hypothetical protein CGSHiII_09176 [Haemophilus influenzae PittII] gi|148827190|ref|YP_001291943.1| hypothetical protein CGSHiGG_02665 [Haemophilus influenzae PittGG] gi|144978612|gb|EDJ88335.1| hypothetical protein CGSHi22121_09915 [Haemophilus influenzae 22.1-21] gi|145267497|gb|EDK07497.1| hypothetical protein CGSHiAA_02381 [Haemophilus influenzae PittAA] gi|145271234|gb|EDK11148.1| hypothetical protein CGSHiII_09176 [Haemophilus influenzae PittII] gi|148718432|gb|ABQ99559.1| hypothetical protein CGSHiGG_02665 [Haemophilus influenzae PittGG] gi|309750647|gb|ADO80631.1| Conserved hypothetical protein [Haemophilus influenzae R2866] Length = 102 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 36/57 (63%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +ME L LK DI H + +S I DNM+I +G S++ V+++ADNLI+ KK Sbjct: 3 LVEFLMETLDGLKGTDIVHFDVR-GKSSITDNMIICTGMSSRQVSAMADNLITECKK 58 >gi|325688142|gb|EGD30161.1| Iojap protein family protein [Streptococcus sanguinis SK72] gi|332363934|gb|EGJ41713.1| Iojap protein family protein [Streptococcus sanguinis SK355] Length = 121 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ + Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKAAE 61 >gi|15677848|ref|NP_275015.1| hypothetical protein NMB2023 [Neisseria meningitidis MC58] gi|218767404|ref|YP_002341916.1| hypothetical protein NMA0417 [Neisseria meningitidis Z2491] gi|7227285|gb|AAF42346.1| conserved hypothetical protein [Neisseria meningitidis MC58] gi|121051412|emb|CAM07705.1| hypothetical protein NMA0417 [Neisseria meningitidis Z2491] gi|316983901|gb|EFV62880.1| conserved hypothetical protein [Neisseria meningitidis H44/76] gi|325139345|gb|EGC61885.1| hypothetical protein NMBCU385_1754 [Neisseria meningitidis CU385] gi|325201070|gb|ADY96525.1| conserved hypothetical protein [Neisseria meningitidis H44/76] Length = 128 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L + + L ++KA+DI +E T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QELQDLQKMVGVAVNALGDIKAKDISVLE-TQDKTSLFARMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VDLKE 67 >gi|167037835|ref|YP_001665413.1| iojap-like protein [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|167040733|ref|YP_001663718.1| iojap-like protein [Thermoanaerobacter sp. X514] gi|256752169|ref|ZP_05493035.1| iojap-like protein [Thermoanaerobacter ethanolicus CCSD1] gi|300914771|ref|ZP_07132087.1| iojap-like protein [Thermoanaerobacter sp. X561] gi|307723995|ref|YP_003903746.1| iojap-like protein [Thermoanaerobacter sp. X513] gi|320116252|ref|YP_004186411.1| iojap-like protein [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166854973|gb|ABY93382.1| iojap-like protein [Thermoanaerobacter sp. X514] gi|166856669|gb|ABY95077.1| iojap-like protein [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|256748983|gb|EEU62021.1| iojap-like protein [Thermoanaerobacter ethanolicus CCSD1] gi|300889706|gb|EFK84852.1| iojap-like protein [Thermoanaerobacter sp. X561] gi|307581056|gb|ADN54455.1| iojap-like protein [Thermoanaerobacter sp. X513] gi|319929343|gb|ADV80028.1| iojap-like protein [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 117 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 L ++ + L++ KA DI + + I D +I +G S HV ++ D + Sbjct: 1 MIELKEKVSKIYNVLEDKKAFDIKILYIGD-LTTIADYFIIATGNSDTHVKALTDEVEKK 59 Query: 73 LKKK 76 L ++ Sbjct: 60 LWEE 63 >gi|291615204|ref|YP_003525361.1| iojap-like protein [Sideroxydans lithotrophicus ES-1] gi|291585316|gb|ADE12974.1| iojap-like protein [Sideroxydans lithotrophicus ES-1] Length = 117 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V+ L+++KA DI I+ TS S + D MV+ S +ST+ ++A +++ Sbjct: 1 MLSTEEKTQAVVAALEDVKALDISVID-TSKLSPLFDRMVVASAQSTRQTKALASSVVVK 59 Query: 73 LKK 75 LK+ Sbjct: 60 LKE 62 >gi|327439584|dbj|BAK15949.1| uncharacterized homolog of plant Iojap protein [Solibacillus silvestris StLB046] Length = 117 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + + + + + EDI + SL+ D +I G S + V +IA + ++ Sbjct: 3 ETLLNITYKAIDDKRGEDIVALNM-QGISLLADYFIIAEGSSERQVQAIAREIKEKAEE 60 >gi|229552532|ref|ZP_04441257.1| Iojap family protein [Lactobacillus rhamnosus LMS2-1] gi|229314084|gb|EEN80057.1| Iojap family protein [Lactobacillus rhamnosus LMS2-1] Length = 119 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++ +AEDI ++ SL+ D VI+SG S + V +I D + Sbjct: 1 MIDAKTMLEIAVKAGDSKRAEDIVALDIR-GVSLLADYFVIMSGTSDRQVQAIVDEIEEK 59 >gi|218660429|ref|ZP_03516359.1| iojap-like protein [Rhizobium etli IE4771] Length = 93 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 29/74 (39%), Positives = 45/74 (60%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 LA K A + AD + V+ L++ KAEDI I+ +S + D M++VSGRS +H Sbjct: 21 LAVVPKSAERGADAAARALEAVLASLEDSKAEDIVTIDIA-GKSALGDYMIVVSGRSNRH 79 Query: 62 VASIADNLISYLKK 75 V +I+D+L++ LK Sbjct: 80 VMAISDHLLTDLKD 93 >gi|212638660|ref|YP_002315180.1| hypothetical protein Aflv_0817 [Anoxybacillus flavithermus WK1] gi|212560140|gb|ACJ33195.1| Uncharacterized conserved protein, Iojap family [Anoxybacillus flavithermus WK1] Length = 118 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++ + KAE+I + SL+ D +I G S K V +IA + ++ Sbjct: 4 RDILRIAVQAADDKKAENIVALNM-KGISLVADYFMICHGNSDKQVQAIAREIKEKAEEH 62 >gi|221134242|ref|ZP_03560547.1| iojap-like protein [Glaciecola sp. HTCC2999] Length = 111 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 20/67 (29%), Positives = 38/67 (56%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ DS V++ ++++K DI I +S + D M++ SG S +HV SIA+N Sbjct: 2 KIEAKLDHDSLKKFVIDKIEDMKGRDIIDINV-EGKSTVTDTMLVCSGNSKRHVRSIAEN 60 Query: 69 LISYLKK 75 ++ +K+ Sbjct: 61 VVIEMKR 67 >gi|126700139|ref|YP_001089036.1| hypothetical protein CD2522 [Clostridium difficile 630] gi|254976115|ref|ZP_05272587.1| hypothetical protein CdifQC_12409 [Clostridium difficile QCD-66c26] gi|255093505|ref|ZP_05322983.1| hypothetical protein CdifC_12714 [Clostridium difficile CIP 107932] gi|255101685|ref|ZP_05330662.1| hypothetical protein CdifQCD-6_12809 [Clostridium difficile QCD-63q42] gi|255307554|ref|ZP_05351725.1| hypothetical protein CdifA_13257 [Clostridium difficile ATCC 43255] gi|255315247|ref|ZP_05356830.1| hypothetical protein CdifQCD-7_12882 [Clostridium difficile QCD-76w55] gi|255517916|ref|ZP_05385592.1| hypothetical protein CdifQCD-_12451 [Clostridium difficile QCD-97b34] gi|255651032|ref|ZP_05397934.1| hypothetical protein CdifQCD_12656 [Clostridium difficile QCD-37x79] gi|255656505|ref|ZP_05401914.1| hypothetical protein CdifQCD-2_12584 [Clostridium difficile QCD-23m63] gi|260684099|ref|YP_003215384.1| hypothetical protein CD196_2364 [Clostridium difficile CD196] gi|260687758|ref|YP_003218892.1| hypothetical protein CDR20291_2411 [Clostridium difficile R20291] gi|296450047|ref|ZP_06891809.1| iojap-like protein [Clostridium difficile NAP08] gi|296878428|ref|ZP_06902434.1| iojap-like protein [Clostridium difficile NAP07] gi|306520894|ref|ZP_07407241.1| iojap homolog [Clostridium difficile QCD-32g58] gi|115251576|emb|CAJ69409.1| conserved hypothetical protein [Clostridium difficile] gi|260210262|emb|CBA64532.1| conserved hypothetical protein [Clostridium difficile CD196] gi|260213775|emb|CBE05714.1| conserved hypothetical protein [Clostridium difficile R20291] gi|296261055|gb|EFH07888.1| iojap-like protein [Clostridium difficile NAP08] gi|296430512|gb|EFH16353.1| iojap-like protein [Clostridium difficile NAP07] Length = 116 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + +++ +D I S +CD +I + S + V +IADN+ L Sbjct: 2 TVEQMTKIAYDAIEDKLGQDTVIINIGK-VSSLCDYFIITTASSQRQVKAIADNVEDELA 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|315612644|ref|ZP_07887556.1| iojap-like protein [Streptococcus sanguinis ATCC 49296] gi|315315231|gb|EFU63271.1| iojap-like protein [Streptococcus sanguinis ATCC 49296] Length = 117 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|255038785|ref|YP_003089406.1| iojap-like protein [Dyadobacter fermentans DSM 18053] gi|254951541|gb|ACT96241.1| iojap-like protein [Dyadobacter fermentans DSM 18053] Length = 127 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 31/70 (44%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 K+ V++ + E K DI ++ +++ I D VI SG S + ++ Sbjct: 1 MKERKNKELSSKDLTELVVKGMTEKKGLDIAILDLRKVKNSITDFFVICSGNSDTQIDAL 60 Query: 66 ADNLISYLKK 75 A+++ + K Sbjct: 61 ANSVEEEVYK 70 >gi|116618825|ref|YP_819196.1| Iojap family protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] gi|116097672|gb|ABJ62823.1| Iojap family protein [Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293] Length = 124 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 32/67 (47%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 TA ++ + T +E + KA +I ++ SL+ D VI ST+ V +IA Sbjct: 1 MTTTALNVQDTLNTAVEAVDNKKANNIVALDMRK-VSLMADYFVIADAASTRQVQAIATE 59 Query: 69 LISYLKK 75 + +++ Sbjct: 60 VKDKIQE 66 >gi|91792217|ref|YP_561868.1| Iojap-related protein [Shewanella denitrificans OS217] gi|91714219|gb|ABE54145.1| Iojap-related protein [Shewanella denitrificans OS217] Length = 109 Score = 65.5 bits (159), Expect = 2e-09, Method: Composition-based stats. Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A V++ + +LKA+D+ ++ T+ +S I D MVI SG S HV +IA+NLI K Sbjct: 2 QSTELKAFVVDKVDDLKAKDVVVLDVTN-QSNITDYMVICSGTSKTHVRAIAENLIVQAK 60 >gi|329943189|ref|ZP_08291963.1| hypothetical protein G5Q_0873 [Chlamydophila psittaci Cal10] gi|328814736|gb|EGF84726.1| hypothetical protein G5Q_0873 [Chlamydophila psittaci Cal10] Length = 119 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + + + K + ++ ++ S + D + G HV ++AD ++ LK+ N Sbjct: 7 DLLKVIAKVIDNKKGNNPVVLDVRAI-SQLTDYFIFAEGNVGVHVKALADTIVQELKEHN 65 >gi|320529176|ref|ZP_08030268.1| ribosome-associated protein, iojap family [Selenomonas artemidis F0399] gi|320138806|gb|EFW30696.1| ribosome-associated protein, iojap family [Selenomonas artemidis F0399] Length = 114 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 2/63 (3%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + CI V + E KA DI ++ L S D VI S + V +I +N+ Sbjct: 1 MTEQEKCI-AVCKAADEKKARDIVTMDMRGLMST-NDYFVICSANTATQVRAIVNNIEEK 58 Query: 73 LKK 75 L++ Sbjct: 59 LEE 61 >gi|78224392|ref|YP_386139.1| Iojap-related protein [Geobacter metallireducens GS-15] gi|78195647|gb|ABB33414.1| Iojap-related protein [Geobacter metallireducens GS-15] Length = 131 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 5/71 (7%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T+K L + C + + KA D+ ++ S I D +V+ SGRS + V + Sbjct: 2 TDKPTLAPLERALECARLAL----DKKALDVKILKIGR-LSSIADYLVLASGRSDRQVQA 56 Query: 65 IADNLISYLKK 75 IAD++ LKK Sbjct: 57 IADSVKKGLKK 67 >gi|223937994|ref|ZP_03629893.1| iojap-like protein [bacterium Ellin514] gi|223893395|gb|EEF59857.1| iojap-like protein [bacterium Ellin514] Length = 125 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 E KAE+I ++ + S + D V+ SG S H+ +I D + L Sbjct: 2 DSKKLALLCRELADNRKAENIVIMDVRA-LSTVTDYFVVASGTSEPHLRAIMDEITERLH 60 Query: 75 KKN 77 ++ Sbjct: 61 TEH 63 >gi|125717441|ref|YP_001034574.1| hypothetical protein SSA_0581 [Streptococcus sanguinis SK36] gi|125497358|gb|ABN44024.1| Conserved uncharacterized protein [Streptococcus sanguinis SK36] gi|324990739|gb|EGC22675.1| Iojap protein family protein [Streptococcus sanguinis SK353] Length = 121 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|330998243|ref|ZP_08322069.1| iojap-like protein [Paraprevotella xylaniphila YIT 11841] gi|329568935|gb|EGG50733.1| iojap-like protein [Paraprevotella xylaniphila YIT 11841] Length = 119 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 29/62 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + E ++E K ++I + T++ IC +I G S V +IA+++ Sbjct: 1 MNETQQLVNAITEGIQEKKGKNIVVADLTNIGDTICQYFIICQGNSPSQVRAIAESIEES 60 Query: 73 LK 74 + Sbjct: 61 AR 62 >gi|296531960|ref|ZP_06894748.1| Iojap superfamily protein [Roseomonas cervicalis ATCC 49957] gi|296267715|gb|EFH13552.1| Iojap superfamily protein [Roseomonas cervicalis ATCC 49957] Length = 234 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 16/73 (21%), Positives = 36/73 (49%), Gaps = 1/73 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 K+ T +D + + L++ KAED+ ++ S R+ D M++ +G + + + Sbjct: 57 KAPKRQKLTPPQIDLIVQAAVRSLEDDKAEDVVVLDVAS-RAAFADRMIVATGLADRQIQ 115 Query: 64 SIADNLISYLKKK 76 ++A +L L + Sbjct: 116 AMAAHLDKVLAEH 128 >gi|126724476|ref|ZP_01740319.1| Iojap-related protein [Rhodobacterales bacterium HTCC2150] gi|126705640|gb|EBA04730.1| Iojap-related protein [Rhodobacterales bacterium HTCC2150] Length = 149 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A + L+E KA+D+ ++ ++ I D MV+ SGRST+ V ++A+ L LK Sbjct: 35 DLLAFIEATLEESKADDMVTVDLR-GKTSIADYMVVCSGRSTRQVVALAEVLAEKLK 90 >gi|46580029|ref|YP_010837.1| iojap-like protein [Desulfovibrio vulgaris str. Hildenborough] gi|120602561|ref|YP_966961.1| iojap-like protein [Desulfovibrio vulgaris DP4] gi|46449445|gb|AAS96096.1| iojap-related protein [Desulfovibrio vulgaris str. Hildenborough] gi|120562790|gb|ABM28534.1| iojap-like protein [Desulfovibrio vulgaris DP4] gi|311233973|gb|ADP86827.1| iojap-like protein [Desulfovibrio vulgaris RCH1] Length = 134 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 T+++ T +D + ++ L+E KA DI + +S + +VIV+ S +H Sbjct: 2 QTKEKKFVTLPTVDK-VKAIIGWLEEKKARDIVAYDLA-GQSPFAEALVIVTAGSVRHGQ 59 Query: 64 SIADNLISYLKKKN 77 S+AD++++ + N Sbjct: 60 SLADHMLAMCNENN 73 >gi|254456363|ref|ZP_05069792.1| iojap family protein [Candidatus Pelagibacter sp. HTCC7211] gi|207083365|gb|EDZ60791.1| iojap family protein [Candidatus Pelagibacter sp. HTCC7211] Length = 116 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + V+ L KAEDI I+ +S + D M+I SG S++H+ S+++ ++ Sbjct: 1 MDKISDLKTIVINTLDINKAEDIVTIDLKD-KSSMADYMIIASGTSSRHIQSLSEQVLEK 59 Query: 73 LKK 75 LK Sbjct: 60 LKD 62 >gi|90022983|ref|YP_528810.1| Poly(A) polymerase, PcnB [Saccharophagus degradans 2-40] gi|89952583|gb|ABD82598.1| Iojap-related protein [Saccharophagus degradans 2-40] Length = 114 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L++LK +DI ++ TS S + D ++IV+G S +HV S+A+N++ K Sbjct: 5 QLAKLINDALEDLKGQDITVLDVTS-LSNVMDTLIIVTGTSNRHVKSLANNVVVDTK 60 >gi|313157289|gb|EFR56714.1| iojap-like protein [Alistipes sp. HGB5] Length = 116 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D I T++ +++ K +DI ++ + IC ++ + ST V +IA ++ + + Sbjct: 1 MDKLIETIVSAIEDKKGKDIVSLDLSGFDGAICSRFIVCNADSTTQVCAIAASIEEKVLE 60 >gi|302519023|ref|ZP_07271365.1| conserved hypothetical protein [Streptomyces sp. SPB78] gi|302427918|gb|EFK99733.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 286 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A+ D I + + A DI + + + S I D ++ S + + V SI D Sbjct: 131 AVTATDRSIELIKAASQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDA 189 Query: 69 LISYLKK 75 + L K Sbjct: 190 IEERLAK 196 >gi|325853958|ref|ZP_08171474.1| iojap-like protein [Prevotella denticola CRIS 18C-A] gi|327313951|ref|YP_004329388.1| iojap-like protein [Prevotella denticola F0289] gi|325484295|gb|EGC87225.1| iojap-like protein [Prevotella denticola CRIS 18C-A] gi|326944035|gb|AEA19920.1| iojap-like protein [Prevotella denticola F0289] Length = 119 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 33/63 (52%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +A + + +++ K I + + + IC VI G ST+ V +IA+++ Y Sbjct: 1 MEETKNLVALITKGIQDKKGRGIVIADLSGIDGTICRYFVICQGNSTQQVEAIAESVSDY 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|161619760|ref|YP_001593647.1| Iojap-related protein [Brucella canis ATCC 23365] gi|163845418|ref|YP_001623073.1| Iojap-related protein [Brucella suis ATCC 23445] gi|189024917|ref|YP_001935685.1| iojap-related protein [Brucella abortus S19] gi|254689994|ref|ZP_05153248.1| iojap-related protein [Brucella abortus bv. 6 str. 870] gi|254694485|ref|ZP_05156313.1| iojap-related protein [Brucella abortus bv. 3 str. Tulya] gi|254698145|ref|ZP_05159973.1| iojap-related protein [Brucella abortus bv. 2 str. 86/8/59] gi|254700483|ref|ZP_05162311.1| iojap-related protein [Brucella suis bv. 5 str. 513] gi|254703606|ref|ZP_05165434.1| iojap-related protein [Brucella suis bv. 3 str. 686] gi|254708308|ref|ZP_05170136.1| iojap-related protein [Brucella pinnipedialis M163/99/10] gi|254708840|ref|ZP_05170651.1| iojap-related protein [Brucella pinnipedialis B2/94] gi|254714680|ref|ZP_05176491.1| iojap-related protein [Brucella ceti M644/93/1] gi|254717578|ref|ZP_05179389.1| iojap-related protein [Brucella ceti M13/05/1] gi|254731028|ref|ZP_05189606.1| iojap-related protein [Brucella abortus bv. 4 str. 292] gi|256030366|ref|ZP_05443980.1| iojap-related protein [Brucella pinnipedialis M292/94/1] gi|256061863|ref|ZP_05451997.1| iojap-related protein [Brucella neotomae 5K33] gi|256160536|ref|ZP_05458225.1| iojap-related protein [Brucella ceti M490/95/1] gi|256255742|ref|ZP_05461278.1| iojap-related protein [Brucella ceti B1/94] gi|256258249|ref|ZP_05463785.1| iojap-related protein [Brucella abortus bv. 9 str. C68] gi|260168039|ref|ZP_05754850.1| iojap-related protein [Brucella sp. F5/99] gi|306841620|ref|ZP_07474315.1| iojap-related protein [Brucella sp. BO2] gi|306844823|ref|ZP_07477408.1| iojap-related protein [Brucella sp. BO1] gi|161336571|gb|ABX62876.1| Iojap-related protein [Brucella canis ATCC 23365] gi|163676141|gb|ABY40251.1| Iojap-related protein [Brucella suis ATCC 23445] gi|189020489|gb|ACD73211.1| iojap-related protein [Brucella abortus S19] gi|306274995|gb|EFM56765.1| iojap-related protein [Brucella sp. BO1] gi|306288311|gb|EFM59679.1| iojap-related protein [Brucella sp. BO2] Length = 123 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L Sbjct: 1 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHL 59 Query: 70 ISYLKK 75 + L++ Sbjct: 60 VQALRE 65 >gi|30248375|ref|NP_840445.1| domain of unknown function DUF143:Iojap-related protein [Nitrosomonas europaea ATCC 19718] gi|30138261|emb|CAD84269.1| Domain of unknown function DUF143:Iojap-related protein [Nitrosomonas europaea ATCC 19718] Length = 121 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + T + L++LKA +I ++ + + +C M++ S ST+ ++A ++ Sbjct: 1 MKSPEKLLETAIMALEDLKASNIHVMDVSK-LTSLCTTMIVASADSTRQTRALASHVQEK 59 Query: 73 LK 74 +K Sbjct: 60 VK 61 >gi|328945653|gb|EGG39804.1| Iojap superfamily protein [Streptococcus sanguinis SK1087] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|33865366|ref|NP_896925.1| hypothetical protein SYNW0832 [Synechococcus sp. WH 8102] gi|33632535|emb|CAE07347.1| conserved hypothetical protein [Synechococcus sp. WH 8102] Length = 120 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 E + KA DI I S + D MVI G+S V +IA ++ L+ Sbjct: 2 DSQQLADLAAEACDDRKASDIRLIRV-DEVSSLADWMVIAGGQSDVQVRAIARSVEDRLE 60 Query: 75 KK 76 + Sbjct: 61 TE 62 >gi|254499199|ref|ZP_05111879.1| conserved hypothetical protein [Legionella drancourtii LLAP12] gi|254351589|gb|EET10444.1| conserved hypothetical protein [Legionella drancourtii LLAP12] Length = 110 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++ L++++A DI I+ ++ I D M+I SGR+++HV ++A ++ Sbjct: 1 MSAQNPMLPKLIHALEDIQAVDIKVIDV-HKQTTITDYMIIASGRASRHVKAVAQKVMED 59 Query: 73 LK 74 +K Sbjct: 60 MK 61 >gi|15618824|ref|NP_225110.1| iojap superfamily protein [Chlamydophila pneumoniae CWL029] gi|15836448|ref|NP_300972.1| iojap superfamily protein [Chlamydophila pneumoniae J138] gi|16752121|ref|NP_445488.1| iojap-related protein [Chlamydophila pneumoniae AR39] gi|33242278|ref|NP_877219.1| Iojap [Chlamydophila pneumoniae TW-183] gi|4377236|gb|AAD19053.1| IojAP superfamily ortholog [Chlamydophila pneumoniae CWL029] gi|8163529|gb|AAF73719.1| iojap-related protein [Chlamydophila pneumoniae AR39] gi|8979289|dbj|BAA99123.1| IojAP superfamily ortholog [Chlamydophila pneumoniae J138] gi|33236789|gb|AAP98876.1| Iojap [Chlamydophila pneumoniae TW-183] gi|269302703|gb|ACZ32803.1| iojap-like protein [Chlamydophila pneumoniae LPCoLN] Length = 119 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + + K ++ ++ S D V V G HV ++A+ ++ LKK+ Sbjct: 7 DLLKVAAKAIDDKKGNNLVVLDVR-TISEFTDYFVFVEGSVNVHVKALANTIVEELKKQ 64 >gi|171780306|ref|ZP_02921210.1| hypothetical protein STRINF_02094 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] gi|171281654|gb|EDT47089.1| hypothetical protein STRINF_02094 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] Length = 117 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +A V++ E +AED+ ++ + D V+VS +T+ + +IA+N+ +K+ Sbjct: 4 EELLAVVVKAADEKRAEDMVVLDLY-GLTSATDYFVVVSAMNTRQLDAIAENIREKVKE 61 >gi|332287770|ref|YP_004422671.1| iojap-related protein [Chlamydophila psittaci 6BC] gi|313848343|emb|CBY17346.1| conserved hypothetical protein [Chlamydophila psittaci RD1] gi|325507031|gb|ADZ18669.1| iojap-related protein [Chlamydophila psittaci 6BC] gi|328915027|gb|AEB55860.1| conserved hypothetical protein [Chlamydophila psittaci 6BC] Length = 119 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + + + K + ++ ++ S + D + G HV ++AD ++ LK+ N Sbjct: 7 DLLKVIAKVIDNKKGNNPVVLDVRAI-SQLTDYFIFAEGNVGVHVKALADTIVQELKEHN 65 >gi|325577710|ref|ZP_08147985.1| Iojap family protein [Haemophilus parainfluenzae ATCC 33392] gi|301154765|emb|CBW14228.1| predicted protein [Haemophilus parainfluenzae T3T1] gi|325160455|gb|EGC72581.1| Iojap family protein [Haemophilus parainfluenzae ATCC 33392] Length = 102 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 22/58 (37%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S + V++ L +LK +I H + +S I +NM+I +G S++ V+++ADNLI+ KK Sbjct: 2 SLVEFVIDKLDDLKGTEIVHFDV-KGKSSITENMIICTGTSSRQVSAMADNLIAECKK 58 >gi|149278171|ref|ZP_01884309.1| hypothetical protein PBAL39_11457 [Pedobacter sp. BAL39] gi|149230937|gb|EDM36318.1| hypothetical protein PBAL39_11457 [Pedobacter sp. BAL39] Length = 124 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 27/57 (47%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++E K DI ++ L S + D +I + S+ V +IAD++ + K Sbjct: 13 LSEIAVHGIQEKKGNDIVRLDLRELNSSVSDYFIICNADSSTQVKAIADSVEDEIYK 69 >gi|62290703|ref|YP_222496.1| iojap-like protein [Brucella abortus bv. 1 str. 9-941] gi|260755530|ref|ZP_05867878.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260758753|ref|ZP_05871101.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260762587|ref|ZP_05874924.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|261214801|ref|ZP_05929082.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|261219412|ref|ZP_05933693.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261315807|ref|ZP_05955004.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261316333|ref|ZP_05955530.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261322474|ref|ZP_05961671.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261750987|ref|ZP_05994696.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261754240|ref|ZP_05997949.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] gi|62196835|gb|AAX75135.1| iojap-related protein [Brucella abortus bv. 1 str. 9-941] gi|260669071|gb|EEX56011.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] gi|260673013|gb|EEX59834.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] gi|260675638|gb|EEX62459.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] gi|260916408|gb|EEX83269.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] gi|260924501|gb|EEX91069.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295164|gb|EEX98660.1| conserved hypothetical protein [Brucella ceti M644/93/1] gi|261295556|gb|EEX99052.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261304833|gb|EEY08330.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261740740|gb|EEY28666.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] gi|261743993|gb|EEY31919.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 140 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L Sbjct: 18 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHL 76 Query: 70 ISYLKK 75 + L++ Sbjct: 77 VQALRE 82 >gi|297617843|ref|YP_003703002.1| iojap-like protein [Syntrophothermus lipocalidus DSM 12680] gi|297145680|gb|ADI02437.1| iojap-like protein [Syntrophothermus lipocalidus DSM 12680] Length = 106 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + E KA D+ ++ +++ D VI SGRST V IA+N+ L ++ Sbjct: 5 ELAKRIADVASEEKAVDVVVLDVRE-MTVLADYFVIASGRSTIQVKMIAENIEDMLLEE 62 >gi|89891683|ref|ZP_01203186.1| conserved hypothetical protein [Flavobacteria bacterium BBFL7] gi|89516018|gb|EAS18682.1| conserved hypothetical protein [Flavobacteria bacterium BBFL7] Length = 124 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 12/68 (17%), Positives = 33/68 (48%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + D+ IA ++ ++++K DI ++ + + + +I +G S V +I ++ Sbjct: 2 MTKEKVSTDALIAQMIAGIEDVKGNDITIMDLREIENTVTSYFIICNGNSNTQVNAIVNS 61 Query: 69 LISYLKKK 76 + + K+ Sbjct: 62 IQRKVSKE 69 >gi|327489036|gb|EGF20831.1| Iojap protein family protein [Streptococcus sanguinis SK1058] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|327458842|gb|EGF05190.1| Iojap protein family protein [Streptococcus sanguinis SK1057] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|163857415|ref|YP_001631713.1| hypothetical protein Bpet3103 [Bordetella petrii DSM 12804] gi|163261143|emb|CAP43445.1| hypothetical protein Bpet3103 [Bordetella petrii] Length = 134 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L+++KA+DI T + + D +VI S S + ++A ++ Sbjct: 2 DIQKLQRAVIDALEDVKAQDIKVFNTTH-LTSLFDRVVIASATSNRQTRALAASVADR 58 >gi|103486070|ref|YP_615631.1| Iojap-related protein [Sphingopyxis alaskensis RB2256] gi|98976147|gb|ABF52298.1| Iojap-related protein [Sphingopyxis alaskensis RB2256] Length = 132 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 4/79 (5%) Query: 1 MLANTEKQALQTA---DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGR 57 M++ T+ A A D +D+ A ++ L E +A++ I +S I D+MVI SGR Sbjct: 1 MISATQGAAPGAAPANDSVDALHALILHQLDEDQAQETISIPLA-GKSSIADHMVIASGR 59 Query: 58 STKHVASIADNLISYLKKK 76 ST+HV++IA+ L +K++ Sbjct: 60 STRHVSAIAEKLAQRIKQE 78 >gi|300312856|ref|YP_003776948.1| hypothetical protein Hsero_3561 [Herbaspirillum seropedicae SmR1] gi|300075641|gb|ADJ65040.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1] Length = 256 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+++KA++I + T + + D + I SG S + ++A ++ +K Sbjct: 2 DIKKLQTLVVDALEDVKAQEIRIYDTTH-LTSLFDRVAIASGTSNRQTKALAASVRDKVK 60 Query: 75 KK 76 K Sbjct: 61 AK 62 >gi|150024697|ref|YP_001295523.1| hypothetical protein FP0602 [Flavobacterium psychrophilum JIP02/86] gi|149771238|emb|CAL42707.1| Protein of unknown function [Flavobacterium psychrophilum JIP02/86] Length = 123 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 37/68 (54%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + D +A +++ ++E+K DI ++ +L + +CD VI +G S V +I ++ Sbjct: 1 MAKKEINNDVLLANIIKGIEEVKGNDITILDLRALENTVCDYFVICNGNSNTQVNAIVNS 60 Query: 69 LISYLKKK 76 + + K+ Sbjct: 61 IQKVVSKE 68 >gi|265995708|ref|ZP_06108265.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] gi|262766992|gb|EEZ12610.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 156 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++ D+L Sbjct: 34 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVTDHL 92 Query: 70 ISYLKK 75 + L++ Sbjct: 93 VQALRE 98 >gi|270293287|ref|ZP_06199496.1| iojap-related protein [Streptococcus sp. M143] gi|270278136|gb|EFA23984.1| iojap-related protein [Streptococcus sp. M143] Length = 116 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAQ 61 >gi|54297287|ref|YP_123656.1| hypothetical protein lpp1332 [Legionella pneumophila str. Paris] gi|53751072|emb|CAH12483.1| hypothetical protein lpp1332 [Legionella pneumophila str. Paris] Length = 112 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +++ L++++A DI I+ ++ I D MV+ SGRS++HV SIA ++ Sbjct: 1 MLEKNPTLEKLLKSLEDIQAIDIKIIDV-HKQTTITDFMVVTSGRSSRHVKSIAQKVLED 59 Query: 73 LK 74 +K Sbjct: 60 MK 61 >gi|78184413|ref|YP_376848.1| Iojap-related protein [Synechococcus sp. CC9902] gi|78168707|gb|ABB25804.1| Iojap-related protein [Synechococcus sp. CC9902] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + + KA DI I S + D MVI G+S V +IA ++ L Sbjct: 2 DSEQLAELAADACDDRKAVDIRLIRV-DEVSSLADWMVIAGGQSDVQVRAIAQSVEDRL 59 >gi|116751064|ref|YP_847751.1| iojap-like protein [Syntrophobacter fumaroxidans MPOB] gi|116700128|gb|ABK19316.1| iojap-like protein [Syntrophobacter fumaroxidans MPOB] Length = 150 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + S E +LKA D+ +E + S D VI SG+S + V IAD++ Sbjct: 20 KKPMDSKSKAFLCAEEADKLKAADVVLLEVSK-YSSFADYFVICSGKSGRQVQGIADSIE 78 Query: 71 SYLKK 75 LK+ Sbjct: 79 RSLKE 83 >gi|322392351|ref|ZP_08065812.1| Iojap protein family protein [Streptococcus peroris ATCC 700780] gi|321144886|gb|EFX40286.1| Iojap protein family protein [Streptococcus peroris ATCC 700780] Length = 117 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQE-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|307706096|ref|ZP_07642915.1| conserved hypothetical protein [Streptococcus mitis SK321] gi|307618496|gb|EFN97644.1| conserved hypothetical protein [Streptococcus mitis SK321] Length = 117 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|307246523|ref|ZP_07528595.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307255509|ref|ZP_07537315.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307259960|ref|ZP_07541673.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306852586|gb|EFM84819.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306861551|gb|EFM93539.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306865988|gb|EFM97863.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 11 str. 56153] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M+I +G S +HVAS AD L + K+ Sbjct: 20 QNLVEFLTKTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTADRLSAEAKQ 77 >gi|153008392|ref|YP_001369607.1| iojap-like protein [Ochrobactrum anthropi ATCC 49188] gi|151560280|gb|ABS13778.1| iojap-like protein [Ochrobactrum anthropi ATCC 49188] Length = 159 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L Sbjct: 34 MDESNLVSQTFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHL 92 Query: 70 ISYLKK 75 + L++ Sbjct: 93 LQALRE 98 >gi|53729248|ref|ZP_00133778.2| COG0799: Uncharacterized homolog of plant Iojap protein [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|190150932|ref|YP_001969457.1| hypothetical protein APP7_1663 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|307248648|ref|ZP_07530662.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307250880|ref|ZP_07532808.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307253264|ref|ZP_07535138.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307257679|ref|ZP_07539438.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|189916063|gb|ACE62315.1| hypothetical protein APP7_1663 [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|306854859|gb|EFM87048.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306857130|gb|EFM89258.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306859251|gb|EFM91290.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306863854|gb|EFM95778.1| Plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 10 str. D13039] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M+I +G S +HVAS AD L + K+ Sbjct: 20 QNLVEFLTKTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTADRLSAEAKQ 77 >gi|225849253|ref|YP_002729417.1| iojap family protein [Sulfurihydrogenibium azorense Az-Fu1] gi|225643301|gb|ACN98351.1| iojap family protein [Sulfurihydrogenibium azorense Az-Fu1] Length = 119 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E +E K EDI +E S I D M+I+SG H +I DN+I+ LK Sbjct: 2 ETLEILKKIVEKAEEKKGEDIVALEIGK-VSPIADYMIILSGSVPVHTRAICDNIIAGLK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|119513188|ref|ZP_01632236.1| Iojap-related protein [Nodularia spumigena CCY9414] gi|119462175|gb|EAW43164.1| Iojap-related protein [Nodularia spumigena CCY9414] Length = 153 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 QT + D+ TV E + KA+DI + S + D VI++G S V +IA+++ Sbjct: 27 QTKEVSDNLALTVAEAALDRKADDILVLRVAE-VSYLADYFVIMTGYSRVQVRAIAESIE 85 Query: 71 SYL 73 + + Sbjct: 86 AKV 88 >gi|124266534|ref|YP_001020538.1| hypothetical protein Mpe_A1341 [Methylibium petroleiphilum PM1] gi|124259309|gb|ABM94303.1| conserved hypothetical protein [Methylibium petroleiphilum PM1] Length = 189 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+++KA+DI T S + + +++ SG S + ++A ++ ++ Sbjct: 2 DIRKLQRAIVDGLEDVKAQDIQVFN-TEHLSPLFERVIMASGLSNRQTKALAASVRDAVR 60 Query: 75 KK 76 + Sbjct: 61 SQ 62 >gi|46205385|ref|ZP_00048607.2| COG0799: Uncharacterized homolog of plant Iojap protein [Magnetospirillum magnetotacticum MS-1] Length = 118 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 24/63 (38%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + A CL E+KAE+ I+ ++ + D M+I S RS +HV SIAD +I + Sbjct: 3 DTSEPLKALAFGCLDEMKAEETVEIDLA-GKTSLADTMIIASXRSQRHVGSIADKIIQEM 61 Query: 74 KKK 76 K K Sbjct: 62 KAK 64 >gi|324993480|gb|EGC25400.1| Iojap protein family protein [Streptococcus sanguinis SK405] gi|324995210|gb|EGC27122.1| Iojap protein family protein [Streptococcus sanguinis SK678] gi|325690271|gb|EGD32275.1| Iojap protein family protein [Streptococcus sanguinis SK115] gi|325693533|gb|EGD35452.1| Iojap protein family protein [Streptococcus sanguinis SK150] gi|325696997|gb|EGD38884.1| Iojap protein family protein [Streptococcus sanguinis SK160] gi|327461751|gb|EGF08082.1| Iojap protein family protein [Streptococcus sanguinis SK1] gi|327473473|gb|EGF18893.1| Iojap protein family protein [Streptococcus sanguinis SK408] gi|332363377|gb|EGJ41162.1| Iojap protein family protein [Streptococcus sanguinis SK49] gi|332366156|gb|EGJ43912.1| Iojap protein family protein [Streptococcus sanguinis SK1059] Length = 121 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|149198152|ref|ZP_01875199.1| hypothetical protein LNTAR_15862 [Lentisphaera araneosa HTCC2155] gi|149138754|gb|EDM27160.1| hypothetical protein LNTAR_15862 [Lentisphaera araneosa HTCC2155] Length = 134 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + +ELKA DI I+ S + D V+ +G S H+ +IA + LK Sbjct: 5 SSEEKAKLIADLCEELKAVDIKTIDVRE-TSTVTDFYVVCTGNSEPHLKAIATRVHMDLK 63 Query: 75 KKN 77 K+ Sbjct: 64 HKD 66 >gi|223986367|ref|ZP_03636374.1| hypothetical protein HOLDEFILI_03685 [Holdemania filiformis DSM 12042] gi|223961658|gb|EEF66163.1| hypothetical protein HOLDEFILI_03685 [Holdemania filiformis DSM 12042] Length = 112 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V+ + AED+ ++ S D VI S ++ + SI D++I +K Sbjct: 1 MSELLQKVVHAADQRLAEDLVVLDFR-GHSPFTDYFVIASAKNERMADSIVDHVIEEAEK 59 >gi|163846865|ref|YP_001634909.1| iojap-like protein [Chloroflexus aurantiacus J-10-fl] gi|222524686|ref|YP_002569157.1| iojap-like protein [Chloroflexus sp. Y-400-fl] gi|163668154|gb|ABY34520.1| iojap-like protein [Chloroflexus aurantiacus J-10-fl] gi|222448565|gb|ACM52831.1| iojap-like protein [Chloroflexus sp. Y-400-fl] Length = 110 Score = 65.1 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++E +++ +A DI ++ S ++ I D +I + + + + +I D++ + ++ Sbjct: 2 IARRIVELVEDKQAHDIVLLDIRS-QTTIADYFIICTADNDRQMRAIIDHIDEKISTEH 59 >gi|312868750|ref|ZP_07728942.1| iojap-like protein [Lactobacillus oris PB013-T2-3] gi|311095736|gb|EFQ53988.1| iojap-like protein [Lactobacillus oris PB013-T2-3] Length = 118 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AEDI ++ S + D VI++G S + V +IA+ +I Sbjct: 2 DSKQVLEMVVKAADGRRAEDITALKV-DEISPMADYFVIMTGGSDRQVQAIANAVIEKAH 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|301063283|ref|ZP_07203828.1| iojap-like protein [delta proteobacterium NaphS2] gi|300442580|gb|EFK06800.1| iojap-like protein [delta proteobacterium NaphS2] Length = 114 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 5/67 (7%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + C+AT++ E KA D + + + D +I G ST+ V +I+ +L Sbjct: 1 MTPMEKARLCLATIL----ERKAVDPVLLHV-EGLTTVADYFLITGGNSTRQVQAISRHL 55 Query: 70 ISYLKKK 76 LK K Sbjct: 56 QRTLKDK 62 >gi|330999275|ref|ZP_08322992.1| iojap-like protein [Parasutterella excrementihominis YIT 11859] gi|329575133|gb|EGG56684.1| iojap-like protein [Parasutterella excrementihominis YIT 11859] Length = 123 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 9/62 (14%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L+++KA+DI TS ++ + + +++ + S + ++ ++ +K Sbjct: 2 DIRKLQRVIVNALEDVKAQDIKIFN-TSKQTALFERVIVATANSNRQTRALGHHVFMEVK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|308069989|ref|YP_003871594.1| hypothetical protein PPE_03238 [Paenibacillus polymyxa E681] gi|305859268|gb|ADM71056.1| Conserved hypothetical protein [Paenibacillus polymyxa E681] Length = 115 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + T ++ + KA +I ++ SL+ D VI G S V +IA + + Sbjct: 6 EQLMQTAVDAANDKKAMNIVALDLR-GISLVADYFVICHGNSDTQVQAIATEIRKRAHDE 64 >gi|320539089|ref|ZP_08038760.1| iojap-like ribosome-associated protein [Serratia symbiotica str. Tucson] gi|320030727|gb|EFW12735.1| iojap-like ribosome-associated protein [Serratia symbiotica str. Tucson] Length = 105 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ + +LK +DI + +S I D M+I +G ST HV SIAD+L+ Sbjct: 4 KALQDFVIDKIDDLKGQDIVVLNV-QGKSSITDCMIICTGTSTHHVMSIADHLVQQ 58 >gi|167758152|ref|ZP_02430279.1| hypothetical protein CLOSCI_00490 [Clostridium scindens ATCC 35704] gi|167664049|gb|EDS08179.1| hypothetical protein CLOSCI_00490 [Clostridium scindens ATCC 35704] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L++ K ED C I+ + S++ D VI +G S V ++ DN+ Sbjct: 1 MEQAKEMARVAFGALEDKKGEDTCVIDISH-VSVLADYCVISNGNSDSQVRALVDNVEEK 59 Query: 73 LKK 75 + K Sbjct: 60 MHK 62 >gi|160892668|ref|ZP_02073458.1| hypothetical protein CLOL250_00198 [Clostridium sp. L2-50] gi|156865709|gb|EDO59140.1| hypothetical protein CLOL250_00198 [Clostridium sp. L2-50] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + A V + L + KA DI ++ + S + D VI G + V ++ D++ Sbjct: 1 MNTAQEMAAIVYKALDDKKAFDIKILDIKKI-SAVADYFVIADGTNKNQVQAMCDSVEEE 59 Query: 73 LKK 75 + K Sbjct: 60 MHK 62 >gi|85375473|ref|YP_459535.1| hypothetical protein ELI_13230 [Erythrobacter litoralis HTCC2594] gi|84788556|gb|ABC64738.1| hypothetical protein ELI_13230 [Erythrobacter litoralis HTCC2594] Length = 120 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S A V+E L E +A++I I RS I D+++I SGRST+ VASIA L +K+ Sbjct: 8 SLHALVLEQLDEDQAQEIVSIPL-EGRSSIADHLIIASGRSTRQVASIAQKLSEKIKQ 64 >gi|312890507|ref|ZP_07750043.1| iojap-like protein [Mucilaginibacter paludis DSM 18603] gi|311296965|gb|EFQ74098.1| iojap-like protein [Mucilaginibacter paludis DSM 18603] Length = 124 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 29/67 (43%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + ++E K +I ++ ++ S + D VI ST V +IA++ Sbjct: 3 KSKAINESSYISELAVHGIQEKKGNEIIRLDLRNIHSSVADYFVICHADSTTQVKAIANS 62 Query: 69 LISYLKK 75 + + K Sbjct: 63 VEEEIYK 69 >gi|332882427|ref|ZP_08450052.1| iojap-like protein [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332679597|gb|EGJ52569.1| iojap-like protein [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 119 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 29/62 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + E +++ K ++I + T++ IC +I G S V +IA+++ Sbjct: 1 MNETQQLVNAITEGIQDKKGKNIVVADLTNIGDTICQYFIICQGNSPSQVQAIAESIGES 60 Query: 73 LK 74 + Sbjct: 61 AR 62 >gi|326794756|ref|YP_004312576.1| iojap-like protein [Marinomonas mediterranea MMB-1] gi|326545520|gb|ADZ90740.1| iojap-like protein [Marinomonas mediterranea MMB-1] Length = 112 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D ++ +E L+++K + I +E + + D MVI +G S +HV S+ N++ +LK Sbjct: 2 QADEILSHAVEALEDVKGDKITVLEVGE-LTDMMDYMVICTGTSKRHVQSLGQNVVEHLK 60 >gi|262282080|ref|ZP_06059849.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA] gi|262262534|gb|EEY81231.1| conserved hypothetical protein [Streptococcus sp. 2_1_36FAA] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|194477258|ref|YP_002049437.1| putative iojap protein [Paulinella chromatophora] gi|171192265|gb|ACB43227.1| putative iojap protein [Paulinella chromatophora] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ E + KA DI I S + D +VI SG S V +IA ++ L+ Sbjct: 4 NSENMADLAAEACDDRKAVDIRLIRV-EEVSSLADWLVITSGLSHVQVRAIAQSVEERLE 62 Query: 75 KK 76 K+ Sbjct: 63 KE 64 >gi|225019237|ref|ZP_03708429.1| hypothetical protein CLOSTMETH_03190 [Clostridium methylpentosum DSM 5476] gi|224947868|gb|EEG29077.1| hypothetical protein CLOSTMETH_03190 [Clostridium methylpentosum DSM 5476] Length = 125 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +++ L + KAEDI I +++ D VI +G +T V ++ D + K+ Sbjct: 13 QELLKVIVQTLDKKKAEDIQVIRVRD-LTILGDYFVIANGTNTTQVRALVDEVEYETKQ 70 >gi|153811295|ref|ZP_01963963.1| hypothetical protein RUMOBE_01687 [Ruminococcus obeum ATCC 29174] gi|149832422|gb|EDM87506.1| hypothetical protein RUMOBE_01687 [Ruminococcus obeum ATCC 29174] Length = 120 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ + + + KA DI I+ S+I D VI SG + V +I DN+ Sbjct: 3 MNREQEMVSIACKAIDDKKALDIKVIDIRE-VSVIADYFVITSGSNLNQVQAIVDNVEEQ 61 Query: 73 L 73 L Sbjct: 62 L 62 >gi|127513861|ref|YP_001095058.1| iojap-like protein [Shewanella loihica PV-4] gi|126639156|gb|ABO24799.1| iojap-like protein [Shewanella loihica PV-4] Length = 115 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 V++ +++LKA+D+ +E T +S + D MV+ SG S HV +IA+N++ K+ N Sbjct: 11 ELKQFVVDKVEDLKAKDVVVLEVTD-KSNVTDYMVVCSGTSKTHVRAIAENVVLEAKRAN 69 >gi|312882706|ref|ZP_07742443.1| iojap-like protein [Vibrio caribbenthicus ATCC BAA-2122] gi|309369667|gb|EFP97182.1| iojap-like protein [Vibrio caribbenthicus ATCC BAA-2122] Length = 105 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L+ + E + ++KA+DI I+ T +S I D M++ +G S +HV SIA++L K Sbjct: 2 QLEELNTFLREKVDDMKAQDIATIDVT-GKSSITDFMIVCTGTSKRHVTSIAEHLTKESK 60 >gi|306825770|ref|ZP_07459109.1| iojap-like protein [Streptococcus sp. oral taxon 071 str. 73H25AP] gi|304432131|gb|EFM35108.1| iojap-like protein [Streptococcus sp. oral taxon 071 str. 73H25AP] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|29840611|ref|NP_829717.1| iojap-related protein [Chlamydophila caviae GPIC] gi|29834961|gb|AAP05595.1| iojap-related protein [Chlamydophila caviae GPIC] Length = 119 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + V + + K + ++ ++ S + D + G HV ++AD ++ LK+ N Sbjct: 7 NLLKVVAKIIDNKKGNNPVVLDVRAI-SQLTDYFIFAEGNVGVHVKALADTIVEELKQYN 65 >gi|332360507|gb|EGJ38317.1| Iojap protein family protein [Streptococcus sanguinis SK1056] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|323353249|ref|ZP_08087782.1| Iojap protein family protein [Streptococcus sanguinis VMC66] gi|322121195|gb|EFX92958.1| Iojap protein family protein [Streptococcus sanguinis VMC66] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|225011526|ref|ZP_03701964.1| iojap-like protein [Flavobacteria bacterium MS024-2A] gi|225004029|gb|EEG42001.1| iojap-like protein [Flavobacteria bacterium MS024-2A] Length = 123 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 32/67 (47%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + ++ ++ +K +DI ++ + + CD V+ SG S V++I + Sbjct: 1 MAKKIESKPNLLDEIVVGIENVKGQDIQILDLREIENTPCDFFVVCSGNSNTQVSAIVGS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 VQKNVSK 67 >gi|293604470|ref|ZP_06686875.1| iojap family protein [Achromobacter piechaudii ATCC 43553] gi|292817051|gb|EFF76127.1| iojap family protein [Achromobacter piechaudii ATCC 43553] Length = 134 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + V++ L+++KA+DI T + + D +VI S S + ++A ++ Sbjct: 2 DITKLQRAVIDALEDVKAQDIKVYNTTH-LTSLFDRVVIASATSNRQTRALASSVADR 58 >gi|293364883|ref|ZP_06611600.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037] gi|307703135|ref|ZP_07640081.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037] gi|291316333|gb|EFE56769.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037] gi|307623210|gb|EFO02201.1| conserved hypothetical protein [Streptococcus oralis ATCC 35037] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|218132483|ref|ZP_03461287.1| hypothetical protein BACPEC_00342 [Bacteroides pectinophilus ATCC 43243] gi|217992593|gb|EEC58595.1| hypothetical protein BACPEC_00342 [Bacteroides pectinophilus ATCC 43243] Length = 118 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 ++ +E L++ K EDI I+ + S+I D +IVSG + V ++ DN+ Sbjct: 2 AENNSREMARIAIEALRDKKGEDIRVIDISK-VSVIADYFIIVSGNNPNQVQALVDNVDE 60 Query: 72 YLKK 75 L + Sbjct: 61 KLAE 64 >gi|87119264|ref|ZP_01075162.1| iojap domain protein [Marinomonas sp. MED121] gi|86165655|gb|EAQ66922.1| iojap domain protein [Marinomonas sp. MED121] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + T D + +E LK++K + I + S + + D MVI SG S +HV ++ Sbjct: 2 QNFMSDTQITSDQILDLAVEALKDVKGDKITVLNVKSH-TDMMDFMVICSGTSKRHVNAL 60 Query: 66 ADNLISYLKK 75 N+I LKK Sbjct: 61 GQNVIDTLKK 70 >gi|329118261|ref|ZP_08246971.1| Iojap domain protein [Neisseria bacilliformis ATCC BAA-1200] gi|327465682|gb|EGF11957.1| Iojap domain protein [Neisseria bacilliformis ATCC BAA-1200] Length = 129 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q +L+ +A E L+++KA+DI + T ++ + M+I SG ST+ V ++A+N+ Sbjct: 4 QEQQNLERMVAVATEALEDIKAKDISILH-TQDKTTLFSRMIIASGDSTRQVKALANNVA 62 Query: 71 SYLKK 75 LK+ Sbjct: 63 VGLKE 67 >gi|319400928|gb|EFV89147.1| conserved hypothetical protein [Staphylococcus epidermidis FRI909] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + +E + KAEDI + + S + D V+ G + + V SIA ++ Sbjct: 2 NSEELLNIAVEAAENKKAEDIISLNMNEI-SDMTDYFVVCHGNNERQVQSIARSVKEVAH 60 Query: 75 KKN 77 K + Sbjct: 61 KHD 63 >gi|306829005|ref|ZP_07462196.1| iojap-like protein [Streptococcus mitis ATCC 6249] gi|304428810|gb|EFM31899.1| iojap-like protein [Streptococcus mitis ATCC 6249] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|195953523|ref|YP_002121813.1| iojap-like protein [Hydrogenobaculum sp. Y04AAS1] gi|195933135|gb|ACG57835.1| iojap-like protein [Hydrogenobaculum sp. Y04AAS1] Length = 110 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + L++ KAEDI ++ + I D +I + S+ H ++A++L LK ++ Sbjct: 4 LKLIKTLLEDKKAEDISVLDVRKH-TNIADYFIIATANSSVHAKALAEHLEKELKNRD 60 >gi|322386050|ref|ZP_08059689.1| Iojap protein family protein [Streptococcus cristatus ATCC 51100] gi|321269894|gb|EFX52815.1| Iojap protein family protein [Streptococcus cristatus ATCC 51100] gi|327469105|gb|EGF14577.1| Iojap protein family protein [Streptococcus sanguinis SK330] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VIVS +++ + ++A+N+ Sbjct: 4 QELLELVVKAADEKRAEDIVALDL-QGLTTVTDYFVIVSSMNSRQLDAVAENIREKA 59 >gi|239623854|ref|ZP_04666885.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA] gi|239521885|gb|EEQ61751.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA] Length = 116 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + L + K EDI I+ S S++ D +I G + V ++ADN+ L Sbjct: 2 NSKEMVKLAYKALSDKKGEDIKIIDIQS-VSVLADYFIIADGSNPNQVQAMADNVEEILG 60 Query: 75 KK 76 K+ Sbjct: 61 KE 62 >gi|227530480|ref|ZP_03960529.1| iojap family protein [Lactobacillus vaginalis ATCC 49540] gi|227349585|gb|EEJ39876.1| iojap family protein [Lactobacillus vaginalis ATCC 49540] Length = 118 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ +AEDI ++ + S + D VI++G S + V +IA+ +I Sbjct: 2 DSKQLLEMAVKAGDGRRAEDIVALKV-NQISPMADYFVIMTGGSDRQVQAIANAIIEKAH 60 Query: 75 KK 76 ++ Sbjct: 61 EE 62 >gi|56460059|ref|YP_155340.1| hypothetical protein IL0951 [Idiomarina loihiensis L2TR] gi|56179069|gb|AAV81791.1| Uncharacterized conserved protein, Iojap family [Idiomarina loihiensis L2TR] Length = 105 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ + +LK D+ ++ ++ + D M+I SG S HV SIA+++ + K Sbjct: 2 QAEELREFVIDKIDDLKGRDVQILDV-HDKTDVVDYMIICSGSSKTHVRSIAEHVATEAK 60 >gi|300725895|ref|ZP_07059358.1| iojap-like protein [Prevotella bryantii B14] gi|299776832|gb|EFI73379.1| iojap-like protein [Prevotella bryantii B14] Length = 123 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 29/65 (44%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + T++E ++E K I + + + I VI G S V +I +++ + Sbjct: 5 KESTQQLVNTIVEGIQEKKGSGIVIADLSHIDGSIAQYFVICQGNSPSQVEAITESVGEF 64 Query: 73 LKKKN 77 + KN Sbjct: 65 ARNKN 69 >gi|254448641|ref|ZP_05062100.1| iojap family protein [gamma proteobacterium HTCC5015] gi|198261830|gb|EDY86116.1| iojap family protein [gamma proteobacterium HTCC5015] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ V+E L ++KA++I ++ ++ + D +++ G S +HV S+A+++ + KK Sbjct: 4 EALKELVLEALDDVKAKEITQLDV-KGKTSVTDLIIVAIGTSNRHVKSLANSVSTACKKA 62 Query: 77 N 77 + Sbjct: 63 D 63 >gi|331082052|ref|ZP_08331180.1| hypothetical protein HMPREF0992_00104 [Lachnospiraceae bacterium 6_1_63FAA] gi|330405647|gb|EGG85177.1| hypothetical protein HMPREF0992_00104 [Lachnospiraceae bacterium 6_1_63FAA] Length = 131 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T+ + E +++ KA+DI I S + D ++ SG + V ++ADN+ Sbjct: 14 TSMNSKEIARIACEAMEDKKAQDIKIINI-ENVSSLADYFIVASGMNRNQVQAMADNVNE 72 Query: 72 YLKK 75 L K Sbjct: 73 MLGK 76 >gi|322388314|ref|ZP_08061918.1| Iojap superfamily protein [Streptococcus infantis ATCC 700779] gi|321140986|gb|EFX36487.1| Iojap superfamily protein [Streptococcus infantis ATCC 700779] Length = 117 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IA+N+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQE-LTSVTDYFVITSSMNSRQLDAIAENIREKVAQ 61 >gi|260887921|ref|ZP_05899184.1| iojap-like protein [Selenomonas sputigena ATCC 35185] gi|260862321|gb|EEX76821.1| iojap-like protein [Selenomonas sputigena ATCC 35185] Length = 110 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + KA+DI + L + D ++ S + V +IADN+ + +K+ Sbjct: 3 RAIARAASDKKAQDIVIMRMAELTTA-ADYFIVCSANTATQVRAIADNIEDEMLEKH 58 >gi|260437110|ref|ZP_05790926.1| iojap-like protein [Butyrivibrio crossotus DSM 2876] gi|292810422|gb|EFF69627.1| iojap-like protein [Butyrivibrio crossotus DSM 2876] Length = 112 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D + T+ + + K + ++ +++ + I D ++ SG + V +IADN+ L K Sbjct: 1 MDKILNTIYNAIDDKKGGNTRILDISAI-TTISDYFIVTSGNNYNQVRAIADNVEEELLK 59 Query: 76 KN 77 K+ Sbjct: 60 KH 61 >gi|255536556|ref|YP_003096927.1| Iojap family protein [Flavobacteriaceae bacterium 3519-10] gi|255342752|gb|ACU08865.1| Iojap family protein [Flavobacteriaceae bacterium 3519-10] Length = 121 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 30/65 (46%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++E +++ K EDI + + + + + +I +G S V++I+ N+ Sbjct: 1 MNRIIDKQQLTDKIVEAIQDTKGEDIMIFDLSKIENSVAQTFIICTGNSNTQVSAISGNV 60 Query: 70 ISYLK 74 ++ Sbjct: 61 EKKVR 65 >gi|299144202|ref|ZP_07037282.1| iojap-related protein [Peptoniphilus sp. oral taxon 386 str. F0131] gi|298518687|gb|EFI42426.1| iojap-related protein [Peptoniphilus sp. oral taxon 386 str. F0131] Length = 78 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +++ ++ K DI ++ S I D VIVSG S+ V ++AD + + ++ Sbjct: 3 NKKLDIIVKSCEDKKGTDIKVLDI-KGLSSIADYFVIVSGNSSNQVNALADEIEDKMSEE 61 >gi|300780669|ref|ZP_07090524.1| iojap-like protein [Corynebacterium genitalium ATCC 33030] gi|300533655|gb|EFK54715.1| iojap-like protein [Corynebacterium genitalium ATCC 33030] Length = 155 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +D + E DI I+ +++ I D VIVSG + + VA+I D + Sbjct: 1 MTASDTARELAVVAAKAADEKLGRDIAVIDVSNVL-AITDVFVIVSGDNERQVAAIVDEI 59 Query: 70 ISYLKK 75 L K Sbjct: 60 EDALTK 65 >gi|237654473|ref|YP_002890787.1| iojap-like protein [Thauera sp. MZ1T] gi|237625720|gb|ACR02410.1| iojap-like protein [Thauera sp. MZ1T] Length = 115 Score = 64.7 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L+++KA DI I+ TS + + D +V+ S S + ++A N+ +K Sbjct: 2 DTPTLEKIVVAALEDIKARDIEVID-TSKHTPLFDRIVVASAESGRQTRALAQNVHDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|257784489|ref|YP_003179706.1| iojap-like protein [Atopobium parvulum DSM 20469] gi|257472996|gb|ACV51115.1| iojap-like protein [Atopobium parvulum DSM 20469] Length = 158 Score = 64.7 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 T + KAEDI ++ T S +CD VI +G + + +I D + + Sbjct: 7 ELAKTAAIAADQKKAEDILVLDLT-GLSDVCDYFVICTGGNARLADAIVDEVREKV 61 >gi|254516731|ref|ZP_05128790.1| iojap family protein [gamma proteobacterium NOR5-3] gi|219675154|gb|EED31521.1| iojap family protein [gamma proteobacterium NOR5-3] Length = 118 Score = 64.7 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V E L +LK + ++ S + D ++I SG S++HV S+ADN+ K Sbjct: 2 NLVGEALDDLKGVNAVTLDVRE-LSNVMDYLIICSGTSSRHVKSLADNVSRMAK 54 >gi|116070929|ref|ZP_01468198.1| Iojap-related protein [Synechococcus sp. BL107] gi|116066334|gb|EAU72091.1| Iojap-related protein [Synechococcus sp. BL107] Length = 121 Score = 64.7 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + + KA DI I S + D MVI G+S V +IA ++ L Sbjct: 2 DSEQLAELAADACDDRKAVDIRLIRV-DEVSSLADWMVIAGGQSDVQVRAIAQSVEDRL 59 >gi|94266742|ref|ZP_01290411.1| Iojap-related protein [delta proteobacterium MLMS-1] gi|93452591|gb|EAT03165.1| Iojap-related protein [delta proteobacterium MLMS-1] Length = 122 Score = 64.7 bits (157), Expect = 5e-09, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + KA++ ++ D VI+SGRST+HV S+A + L K Sbjct: 17 ELARLAVTAGVDKKAQEPVIMDVR-GICSFADYFVIMSGRSTRHVQSLAQAVDQALSPK 74 >gi|224025879|ref|ZP_03644245.1| hypothetical protein BACCOPRO_02625 [Bacteroides coprophilus DSM 18228] gi|224019115|gb|EEF77113.1| hypothetical protein BACCOPRO_02625 [Bacteroides coprophilus DSM 18228] Length = 150 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 17/76 (22%), Positives = 37/76 (48%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 ++ ++++ D I + E ++E K + I + T + IC+ VI G S Sbjct: 20 LIKKLKQKSRNRMDKEKKLIEKITEGIQEKKGKKIVIADLTGIEDTICNYFVICQGNSPS 79 Query: 61 HVASIADNLISYLKKK 76 V +I D++ +++K+ Sbjct: 80 QVLAIVDSVKEHVRKE 95 >gi|126663502|ref|ZP_01734499.1| hypothetical protein FBBAL38_09139 [Flavobacteria bacterium BAL38] gi|126624450|gb|EAZ95141.1| hypothetical protein FBBAL38_09139 [Flavobacteria bacterium BAL38] Length = 85 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 36/68 (52%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + D +A +++ ++E+K E+I ++ + + +CD VI +G S V +I + Sbjct: 1 MAKKQINNDDLLANIIKGIEEVKGENIDILDLREIDNTVCDYFVICNGNSNTQVNAIVGS 60 Query: 69 LISYLKKK 76 + + K+ Sbjct: 61 IQKIVSKE 68 >gi|116668109|pdb|2ID1|A Chain A, X-Ray Crystal Structure Of Protein Cv0518 From Chromobacterium Violaceum, Northeast Structural Genomics Consortium Target Cvr5. gi|116668110|pdb|2ID1|B Chain B, X-Ray Crystal Structure Of Protein Cv0518 From Chromobacterium Violaceum, Northeast Structural Genomics Consortium Target Cvr5 Length = 130 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E L+++K +DI ++ TS + + ++ +G S + V ++A+++ LK Sbjct: 2 EIQEISKLAIEALEDIKGKDIIELD-TSKLTSLFQRXIVATGDSNRQVKALANSVQVKLK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|27468196|ref|NP_764833.1| hypothetical protein SE1278 [Staphylococcus epidermidis ATCC 12228] gi|251811008|ref|ZP_04825481.1| iojap family protein [Staphylococcus epidermidis BCM-HMP0060] gi|282875980|ref|ZP_06284847.1| iojap-like protein [Staphylococcus epidermidis SK135] gi|293366448|ref|ZP_06613125.1| conserved hypothetical protein [Staphylococcus epidermidis M23864:W2(grey)] gi|27315742|gb|AAO04877.1|AE016748_111 conserved hypothetical protein [Staphylococcus epidermidis ATCC 12228] gi|251805518|gb|EES58175.1| iojap family protein [Staphylococcus epidermidis BCM-HMP0060] gi|281295005|gb|EFA87532.1| iojap-like protein [Staphylococcus epidermidis SK135] gi|291319217|gb|EFE59586.1| conserved hypothetical protein [Staphylococcus epidermidis M23864:W2(grey)] gi|329725322|gb|EGG61805.1| iojap-like protein [Staphylococcus epidermidis VCU144] gi|329735302|gb|EGG71594.1| iojap-like protein [Staphylococcus epidermidis VCU045] gi|329737194|gb|EGG73448.1| iojap-like protein [Staphylococcus epidermidis VCU028] Length = 117 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + +E + KAEDI + + S + D V+ G + + V SIA ++ Sbjct: 2 NSEELLNIAVEAAENKKAEDIISLNMNEI-SDMTDYFVVCHGNNERQVQSIARSVKEVAH 60 Query: 75 KKN 77 K + Sbjct: 61 KHD 63 >gi|17986494|ref|NP_539128.1| iojap superfamily protein [Brucella melitensis bv. 1 str. 16M] gi|265991869|ref|ZP_06104426.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|265999311|ref|ZP_05465760.2| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] gi|17982095|gb|AAL51392.1| iojap protein family [Brucella melitensis bv. 1 str. 16M] gi|263002825|gb|EEZ15228.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] gi|263093189|gb|EEZ17286.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] Length = 156 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++ D+L Sbjct: 34 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVTDHL 92 Query: 70 ISYLKK 75 + L++ Sbjct: 93 VQALRE 98 >gi|116490948|ref|YP_810492.1| Iojap family protein [Oenococcus oeni PSU-1] gi|116091673|gb|ABJ56827.1| Iojap family protein [Oenococcus oeni PSU-1] Length = 120 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ KAE++ ++ S+I D +I S + + V +IA+ +I L Sbjct: 2 ESKELLEKIVQIADGKKAENLIALDIRD-LSIISDYFLIASADTGRQVQAIAEEIIDQLH 60 Query: 75 KK 76 KK Sbjct: 61 KK 62 >gi|218129238|ref|ZP_03458042.1| hypothetical protein BACEGG_00814 [Bacteroides eggerthii DSM 20697] gi|317475213|ref|ZP_07934480.1| hypothetical protein HMPREF1016_01459 [Bacteroides eggerthii 1_2_48FAA] gi|217988616|gb|EEC54936.1| hypothetical protein BACEGG_00814 [Bacteroides eggerthii DSM 20697] gi|316908666|gb|EFV30353.1| hypothetical protein HMPREF1016_01459 [Bacteroides eggerthii 1_2_48FAA] Length = 119 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K + I + T + IC+ VI G S V++I D++ + Sbjct: 1 MNEAKKLIQQITEGIQDKKGKKIVIADLTQISDTICNYFVICQGNSPSQVSAIVDSIRDF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|303256638|ref|ZP_07342652.1| iojap-like protein [Burkholderiales bacterium 1_1_47] gi|302860129|gb|EFL83206.1| iojap-like protein [Burkholderiales bacterium 1_1_47] Length = 123 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 9/62 (14%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L+++KA+DI TS ++ + + +++ + S + ++ ++ +K Sbjct: 2 DIRKLQRVIVNALEDVKAQDIKIFN-TSKQTALFERVIVATANSNRQTRALGHHVFMEVK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|261365292|ref|ZP_05978175.1| iojap-like protein [Neisseria mucosa ATCC 25996] gi|288566390|gb|EFC87950.1| iojap-like protein [Neisseria mucosa ATCC 25996] Length = 117 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + T +E L+++KA+DI ++ T ++ + M+I SG ST+ V ++A+N+ LK+ Sbjct: 1 MVETAVEALEDIKAKDISVLQ-TQEKTSLFARMIIASGDSTRQVKALANNVAVSLKE 56 >gi|261856326|ref|YP_003263609.1| iojap-like protein [Halothiobacillus neapolitanus c2] gi|261836795|gb|ACX96562.1| iojap-like protein [Halothiobacillus neapolitanus c2] Length = 173 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 N+ + + V+ L++LK DI ++ D MV SG S +H+ Sbjct: 23 NSTANSPADYPEAQTVADWVVAALEDLKGIDIRVLDVR-GLCNFADFMVFSSGTSDRHLK 81 Query: 64 SIADNLISYLK 74 S A++++ LK Sbjct: 82 SQANSVVEQLK 92 >gi|290890422|ref|ZP_06553497.1| hypothetical protein AWRIB429_0887 [Oenococcus oeni AWRIB429] gi|290479818|gb|EFD88467.1| hypothetical protein AWRIB429_0887 [Oenococcus oeni AWRIB429] Length = 120 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ KAE++ ++ S+I D +I S + + V +IA+ +I L Sbjct: 2 ESKELLEKIVQIADGKKAENLIALDIRD-LSIISDYFLIASADTGRQVQAIAEEIIDQLH 60 Query: 75 KK 76 KK Sbjct: 61 KK 62 >gi|260565670|ref|ZP_05836153.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] gi|260151043|gb|EEW86138.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] Length = 157 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++ D+L Sbjct: 35 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVTDHL 93 Query: 70 ISYLKK 75 + L++ Sbjct: 94 VQALRE 99 >gi|187734855|ref|YP_001876967.1| iojap-like protein [Akkermansia muciniphila ATCC BAA-835] gi|187424907|gb|ACD04186.1| iojap-like protein [Akkermansia muciniphila ATCC BAA-835] Length = 116 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 A+ + KAE++ + S + D MV+ +G S H+ ++ L Sbjct: 3 ANDAMELARMCARAADDAKAENVRVYDLR-GMSSLTDFMVVCTGLSVPHLRAVIRELEEA 61 Query: 73 LKKK 76 +++K Sbjct: 62 VREK 65 >gi|320102291|ref|YP_004177882.1| iojap-like protein [Isosphaera pallida ATCC 43644] gi|319749573|gb|ADV61333.1| iojap-like protein [Isosphaera pallida ATCC 43644] Length = 247 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 10/70 (14%), Positives = 25/70 (35%), Gaps = 1/70 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 + + + +A+D+ ++ + + D VI S S + +I Sbjct: 38 RSMPTRLERALDHARLCARLAADNRAKDVVLLDLRGG-TPLVDFFVIASATSQRQSRAIV 96 Query: 67 DNLISYLKKK 76 + +KK+ Sbjct: 97 SEIEREMKKR 106 >gi|259503605|ref|ZP_05746507.1| conserved hypothetical protein [Lactobacillus antri DSM 16041] gi|259168429|gb|EEW52924.1| conserved hypothetical protein [Lactobacillus antri DSM 16041] Length = 118 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AEDI ++ S + D VI++G S + V +IA+ +I Sbjct: 2 DSKQVLEMVVKAADGRRAEDITALKV-DEISPMADYFVIMTGGSDRQVQAIANAIIEKAH 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|289168467|ref|YP_003446736.1| hypothetical protein smi_1634 [Streptococcus mitis B6] gi|288908034|emb|CBJ22874.1| conserved hypothetical protein [Streptococcus mitis B6] Length = 100 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAQ 61 >gi|254411960|ref|ZP_05025735.1| iojap family protein [Microcoleus chthonoplastes PCC 7420] gi|196180926|gb|EDX75915.1| iojap family protein [Microcoleus chthonoplastes PCC 7420] Length = 145 Score = 64.3 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 E Q + T+ + + K E+I + S I D VIV+G S V +I Sbjct: 23 ENQDQKARPD---LALTIAQAADDRKGENIVILRVAD-VSYIADYFVIVTGFSRVQVRAI 78 Query: 66 ADNLISYL 73 + ++ + Sbjct: 79 SQSIEDQV 86 >gi|227431104|ref|ZP_03913162.1| Iojap family protein [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] gi|227353144|gb|EEJ43312.1| Iojap family protein [Leuconostoc mesenteroides subsp. cremoris ATCC 19254] Length = 124 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 TA ++ + T + + KA +I ++ SL+ D VI ST+ V +IA Sbjct: 1 MTTTALNVQDTLNTAVGAVDNKKANNIVALDMRK-VSLMADYFVIADAASTRQVQAIATE 59 Query: 69 LISYLKK 75 + +++ Sbjct: 60 VKDKIQE 66 >gi|58584505|ref|YP_198078.1| hypothetical protein Wbm0247 [Wolbachia endosymbiont strain TRS of Brugia malayi] gi|58418821|gb|AAW70836.1| Uncharacterized homolog of plant Iojap protein [Wolbachia endosymbiont strain TRS of Brugia malayi] Length = 108 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +T+M + + K DI + + +++I M+I SG S++HV ++A++++ LK Sbjct: 7 DTELIKSTIMSIIDQNKGRDIVTFDVQN-KTIIAKYMIIASGDSSRHVKALAEHVMKSLK 65 Query: 75 K 75 + Sbjct: 66 Q 66 >gi|90407774|ref|ZP_01215952.1| iojap domain protein [Psychromonas sp. CNPT3] gi|90311134|gb|EAS39241.1| iojap domain protein [Psychromonas sp. CNPT3] Length = 108 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V+E L+++KA+DI I+ S S + D M+I +G S +HV SIA+ K+K Sbjct: 4 QQLKEFVLEQLEDMKAKDIIVIDV-SGTSDVTDTMIICTGNSKRHVRSIAEQTALAAKRK 62 >gi|85709761|ref|ZP_01040826.1| hypothetical protein NAP1_12788 [Erythrobacter sp. NAP1] gi|85688471|gb|EAQ28475.1| hypothetical protein NAP1_12788 [Erythrobacter sp. NAP1] Length = 137 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ + D VM L + +A++I I +S + D+MVI SGRST+ VAS+A Sbjct: 17 SMPADINHDDLHDLVMRQLDDDQAQEIVSIPL-EGKSSVADHMVIASGRSTRQVASMAQK 75 Query: 69 LISYLKK 75 L +K+ Sbjct: 76 LAEKVKQ 82 >gi|212693625|ref|ZP_03301753.1| hypothetical protein BACDOR_03144 [Bacteroides dorei DSM 17855] gi|237708785|ref|ZP_04539266.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA] gi|237724223|ref|ZP_04554704.1| conserved hypothetical protein [Bacteroides sp. D4] gi|265755949|ref|ZP_06090416.1| iojap protein 155 [Bacteroides sp. 3_1_33FAA] gi|212663878|gb|EEB24452.1| hypothetical protein BACDOR_03144 [Bacteroides dorei DSM 17855] gi|229437411|gb|EEO47488.1| conserved hypothetical protein [Bacteroides dorei 5_1_36/D4] gi|229457211|gb|EEO62932.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA] gi|263234027|gb|EEZ19628.1| iojap protein 155 [Bacteroides sp. 3_1_33FAA] Length = 119 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 33/64 (51%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ + + E ++E K ++I + T++ IC VI G S V +I D++ Y Sbjct: 1 MNEAETLVKKITEGIQEKKGKNIVIADLTAIDDTICSYFVICQGNSPSQVIAIVDSVKEY 60 Query: 73 LKKK 76 + K+ Sbjct: 61 VHKE 64 >gi|89100809|ref|ZP_01173661.1| iojap protein family protein [Bacillus sp. NRRL B-14911] gi|89084455|gb|EAR63604.1| iojap protein family protein [Bacillus sp. NRRL B-14911] Length = 118 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++ + +AEDI + SLI D +I G S K V +IA + ++ Sbjct: 4 RALLDMAVKAADDKRAEDIVVLNM-KGISLISDYFLICHGNSDKQVQAIAREMKEKSEE 61 >gi|115379975|ref|ZP_01467029.1| iojap domain protein [Stigmatella aurantiaca DW4/3-1] gi|310819128|ref|YP_003951486.1| iojap-like family protein [Stigmatella aurantiaca DW4/3-1] gi|115363028|gb|EAU62209.1| iojap domain protein [Stigmatella aurantiaca DW4/3-1] gi|309392200|gb|ADO69659.1| Iojap-like family protein [Stigmatella aurantiaca DW4/3-1] Length = 174 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 30/49 (61%), Gaps = 1/49 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + KA D+ ++ ++ D +V+ SG S + V+++A+N+ LK+++ Sbjct: 76 DKKATDVLVLDVR-GKTSYADYIVLASGESDRQVSAMAENVHLKLKEED 123 >gi|292670988|ref|ZP_06604414.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541] gi|292647609|gb|EFF65581.1| conserved hypothetical protein [Selenomonas noxia ATCC 43541] Length = 115 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E KA DI ++ L S D VI S + V +IADN+ +++ Sbjct: 8 RAICSAADEKKARDIVQMDMIGLMST-NDYFVICSANTATQVRAIADNIEEKMEE 61 >gi|237785932|ref|YP_002906637.1| hypothetical protein ckrop_1353 [Corynebacterium kroppenstedtii DSM 44385] gi|237758844|gb|ACR18094.1| hypothetical protein ckrop_1353 [Corynebacterium kroppenstedtii DSM 44385] Length = 155 Score = 64.3 bits (156), Expect = 6e-09, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ S + A DI ++ S + +I D V+ SG + +HV SIAD + Sbjct: 1 MAASEESVSMAQIAARAASDKIASDIVVLDV-SGQLVITDCFVVCSGDNERHVMSIADEI 59 Query: 70 ISYLKK 75 L + Sbjct: 60 EDKLAE 65 >gi|300690888|ref|YP_003751883.1| hypothetical protein RPSI07_1229 [Ralstonia solanacearum PSI07] gi|299077948|emb|CBJ50588.1| conserved protein of unknown function, DUF143 [Ralstonia solanacearum PSI07] Length = 190 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ L+++KA+DI T + + D VI SG S + ++A ++ +K Sbjct: 2 IVDALEDVKAQDIKVFNTTH-LTELFDRTVIASGTSNRQTKALAASVRDAVKD 53 >gi|288803734|ref|ZP_06409163.1| conserved hypothetical protein [Prevotella melaninogenica D18] gi|302345772|ref|YP_003814125.1| iojap-like protein [Prevotella melaninogenica ATCC 25845] gi|288333823|gb|EFC72269.1| conserved hypothetical protein [Prevotella melaninogenica D18] gi|302149585|gb|ADK95847.1| iojap-like protein [Prevotella melaninogenica ATCC 25845] Length = 119 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + + + + +++ K I + + + IC VI G ST+ V +IA ++ Y Sbjct: 1 MDKTKNLVELITKGIQDKKGHGIVIADLSEIDGTICRYFVICQGNSTQQVEAIAGSVSDY 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|313675933|ref|YP_004053929.1| iojap-like protein [Marivirga tractuosa DSM 4126] gi|312942631|gb|ADR21821.1| iojap-like protein [Marivirga tractuosa DSM 4126] Length = 136 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 37/62 (59%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ V++ ++E KA+DI ++ T++++ + D VI S S SI++++ ++ Sbjct: 21 NSEALSNIVVKGMQERKAQDITILDLTAVKNAVADYFVICSATSDTQADSISESIEKFVH 80 Query: 75 KK 76 K+ Sbjct: 81 KE 82 >gi|302391368|ref|YP_003827188.1| iojap-like protein [Acetohalobium arabaticum DSM 5501] gi|302203445|gb|ADL12123.1| iojap-like protein [Acetohalobium arabaticum DSM 5501] Length = 115 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + E + KA DI + S+I D VI SG++ V +IA + Sbjct: 1 MMGTEELAELIAETADDKKALDITILNL-QGISIIADYFVICSGKTDIQVQAIARGIEDK 59 Query: 73 LKKK 76 L Sbjct: 60 LSDN 63 >gi|23502694|ref|NP_698821.1| iojap-like protein [Brucella suis 1330] gi|82700619|ref|YP_415193.1| Iojap-like protein [Brucella melitensis biovar Abortus 2308] gi|256370245|ref|YP_003107756.1| iojap-related protein [Brucella microti CCM 4915] gi|23348706|gb|AAN30736.1| iojap-related protein [Brucella suis 1330] gi|82616720|emb|CAJ11805.1| Iojap-related protein [Brucella melitensis biovar Abortus 2308] gi|256000408|gb|ACU48807.1| iojap-related protein [Brucella microti CCM 4915] Length = 117 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L+ L++ Sbjct: 1 MSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHLVQALRE 59 >gi|254719828|ref|ZP_05181639.1| iojap-related protein [Brucella sp. 83/13] gi|306839526|ref|ZP_07472334.1| iojap-related protein [Brucella sp. NF 2653] gi|306405471|gb|EFM61742.1| iojap-related protein [Brucella sp. NF 2653] Length = 123 Score = 64.0 bits (155), Expect = 6e-09, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L+ L++ Sbjct: 12 DAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHLVQALRE 65 >gi|206896327|ref|YP_002246900.1| iojap protein family [Coprothermobacter proteolyticus DSM 5265] gi|206738944|gb|ACI18022.1| iojap protein family [Coprothermobacter proteolyticus DSM 5265] Length = 127 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + L E KAE+I ++ +L + I D +I + S H S+AD+L L KKN Sbjct: 2 EAIQRLLDEKKAENIKIVDIRALDT-IADYFIICTANSLTHSQSLADSLEELLDKKN 57 >gi|242242869|ref|ZP_04797314.1| iojap family protein [Staphylococcus epidermidis W23144] gi|242233682|gb|EES35994.1| iojap family protein [Staphylococcus epidermidis W23144] Length = 117 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + +E + KAEDI + + S + D V+ G + + V SIA ++ Sbjct: 2 NSEELLNIAVEAAENKKAEDIISLNMNEI-SDMTDYFVVCHGNNERQVQSIAKSVKEVAH 60 Query: 75 KKN 77 K + Sbjct: 61 KHD 63 >gi|326335236|ref|ZP_08201431.1| Iojap family protein [Capnocytophaga sp. oral taxon 338 str. F0234] gi|325692507|gb|EGD34451.1| Iojap family protein [Capnocytophaga sp. oral taxon 338 str. F0234] Length = 119 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 36/68 (52%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ + +++V+E ++++K +DI ++ + + +C+ VI SG S V +I+ Sbjct: 1 MSDKKNNTEEILSSVLEGIQKVKGQDITILDLRGIENAVCNYFVICSGGSNTQVVAISGA 60 Query: 69 LISYLKKK 76 + +K Sbjct: 61 VQRQTPQK 68 >gi|213161480|ref|ZP_03347190.1| hypothetical protein Salmoneentericaenterica_16257 [Salmonella enterica subsp. enterica serovar Typhi str. E00-7866] Length = 63 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQ 57 >gi|146300356|ref|YP_001194947.1| iojap-like protein [Flavobacterium johnsoniae UW101] gi|146154774|gb|ABQ05628.1| iojap-like protein [Flavobacterium johnsoniae UW101] Length = 123 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 35/67 (52%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + D +A +++ ++E+K DI ++ + + +CD VI +G S V +I ++ Sbjct: 1 MAKKTINNDVLLANIIKGIEEVKGNDIDILDLRDIDTAVCDYFVICNGSSNTQVNAIVNS 60 Query: 69 LISYLKK 75 + + K Sbjct: 61 IQKTVSK 67 >gi|330443861|ref|YP_004376847.1| hypothetical protein G5S_0117 [Chlamydophila pecorum E58] gi|328806971|gb|AEB41144.1| conserved hypothetical protein [Chlamydophila pecorum E58] Length = 119 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + T+ + + + K + ++ ++ S + V G HV ++AD +I LKK+N Sbjct: 7 NLLKTIAKIIDQKKGNNPVVLDVSN-LSAFTNYFVFAEGNVCVHVKALADEIIVELKKQN 65 >gi|15605502|ref|NP_220288.1| iojap superfamily protein [Chlamydia trachomatis D/UW-3/CX] gi|76789511|ref|YP_328597.1| iojap superfamily protein [Chlamydia trachomatis A/HAR-13] gi|166154111|ref|YP_001654229.1| hypothetical protein CTL0138 [Chlamydia trachomatis 434/Bu] gi|166154986|ref|YP_001653241.1| hypothetical protein CTLon_0138 [Chlamydia trachomatis L2b/UCH-1/proctitis] gi|237803199|ref|YP_002888393.1| hypothetical protein JALI_7741 [Chlamydia trachomatis B/Jali20/OT] gi|237805120|ref|YP_002889274.1| hypothetical protein CTB_7741 [Chlamydia trachomatis B/TZ1A828/OT] gi|255311603|ref|ZP_05354173.1| hypothetical protein Ctra62_04075 [Chlamydia trachomatis 6276] gi|255317904|ref|ZP_05359150.1| hypothetical protein Ctra6_04070 [Chlamydia trachomatis 6276s] gi|255349166|ref|ZP_05381173.1| hypothetical protein Ctra70_04145 [Chlamydia trachomatis 70] gi|255503703|ref|ZP_05382093.1| hypothetical protein Ctra7_04140 [Chlamydia trachomatis 70s] gi|255507383|ref|ZP_05383022.1| hypothetical protein CtraD_04125 [Chlamydia trachomatis D(s)2923] gi|301335349|ref|ZP_07223593.1| hypothetical protein CtraL_00895 [Chlamydia trachomatis L2tet1] gi|3329232|gb|AAC68364.1| iojap superfamily ortholog [Chlamydia trachomatis D/UW-3/CX] gi|76168041|gb|AAX51049.1| iojap protein family [Chlamydia trachomatis A/HAR-13] gi|165930099|emb|CAP03582.1| conserved hypothetical protein [Chlamydia trachomatis 434/Bu] gi|165930974|emb|CAP06536.1| conserved hypothetical protein [Chlamydia trachomatis L2b/UCH-1/proctitis] gi|231273420|emb|CAX10335.1| conserved hypothetical protein [Chlamydia trachomatis B/TZ1A828/OT] gi|231274433|emb|CAX11228.1| conserved hypothetical protein [Chlamydia trachomatis B/Jali20/OT] gi|289525813|emb|CBJ15294.1| conserved hypothetical protein [Chlamydia trachomatis Sweden2] gi|296435391|gb|ADH17569.1| hypothetical protein E150_04100 [Chlamydia trachomatis E/150] gi|296436318|gb|ADH18492.1| hypothetical protein G9768_04075 [Chlamydia trachomatis G/9768] gi|296437247|gb|ADH19417.1| hypothetical protein G11222_04095 [Chlamydia trachomatis G/11222] gi|296438177|gb|ADH20338.1| hypothetical protein G11074_04070 [Chlamydia trachomatis G/11074] gi|296439108|gb|ADH21261.1| hypothetical protein E11023_04065 [Chlamydia trachomatis E/11023] gi|297140678|gb|ADH97436.1| hypothetical protein CTG9301_04085 [Chlamydia trachomatis G/9301] gi|297748899|gb|ADI51445.1| iojap protein family [Chlamydia trachomatis D-EC] gi|297749779|gb|ADI52457.1| iojap protein family [Chlamydia trachomatis D-LC] Length = 119 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +++ + K + ++ ++ S + D V V G H+ +IAD +I LKK Sbjct: 7 NLLKVIVKAIDNKKGRNPVVLDVQNI-SQLTDYFVFVEGNVGVHIKAIADTIIEELKK 63 >gi|310643101|ref|YP_003947859.1| iojap-like protein [Paenibacillus polymyxa SC2] gi|309248051|gb|ADO57618.1| Iojap-like protein [Paenibacillus polymyxa SC2] Length = 115 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + T +E + KA +I ++ SL+ D VI G S V +I + + Sbjct: 6 EKLMQTAVEAANDKKAMNIVALDLR-GVSLVADYFVICHGNSDTQVQAIVTEIRKRAHDE 64 >gi|265984846|ref|ZP_06097581.1| conserved hypothetical protein [Brucella sp. 83/13] gi|264663438|gb|EEZ33699.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 140 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L+ L++ Sbjct: 29 DAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVADHLVQALRE 82 >gi|260588594|ref|ZP_05854507.1| iojap-like protein [Blautia hansenii DSM 20583] gi|260541069|gb|EEX21638.1| iojap-like protein [Blautia hansenii DSM 20583] Length = 116 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + E +++ KA+DI I S + D ++ SG + V ++ADN+ L Sbjct: 2 NSKEIARIACEAMEDKKAQDIKIINI-ENVSSLADYFIVASGMNRNQVQAMADNVNEMLG 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|331266917|ref|YP_004326547.1| hypothetical protein SOR_1555 [Streptococcus oralis Uo5] gi|326683589|emb|CBZ01207.1| conserved hypothetical protein [Streptococcus oralis Uo5] Length = 117 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IA+N+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIAENIREKVAE 61 >gi|295109992|emb|CBL23945.1| iojap-related protein [Ruminococcus obeum A2-162] Length = 118 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + + + KA DI I+ S+I D +I SG + V +I DN+ + Sbjct: 1 MNKEQEMVRIACKAIDDKKAIDIKVIDI-HEVSVIADYFIITSGSNLNQVQAIVDNVEEH 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|62185424|ref|YP_220209.1| hypothetical protein CAB819 [Chlamydophila abortus S26/3] gi|62148491|emb|CAH64261.1| conserved hypothetical protein [Chlamydophila abortus S26/3] Length = 119 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + + + K + ++ ++ S + D + G HV ++AD ++ LK+ N Sbjct: 7 DLLKVIAKVIDNKKGNNPVILDVRAI-SQLTDYFIFAEGHVGVHVKALADTIVQELKEHN 65 >gi|182413579|ref|YP_001818645.1| iojap-like protein [Opitutus terrae PB90-1] gi|177840793|gb|ACB75045.1| iojap-like protein [Opitutus terrae PB90-1] Length = 148 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + L E KAED+ ++ + +S I D +V+ +G S H+ ++ L + Sbjct: 6 PSPLELVKLCCRALDEKKAEDVRVLDVSE-QSSITDYLVVATGTSDPHLRALRVELEKAI 64 >gi|329961930|ref|ZP_08299943.1| iojap-like protein [Bacteroides fluxus YIT 12057] gi|328531153|gb|EGF58003.1| iojap-like protein [Bacteroides fluxus YIT 12057] Length = 119 Score = 64.0 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K + I + T + IC+ VI G S V +I +++ + Sbjct: 1 MNDAKKLIQQITEGIQDKKGKKIVIADLTQIDDTICNYFVICQGNSPSQVTAIVESVKDF 60 Query: 73 LKK 75 +K Sbjct: 61 ARK 63 >gi|307710607|ref|ZP_07647041.1| conserved hypothetical protein [Streptococcus mitis SK564] gi|307618652|gb|EFN97794.1| conserved hypothetical protein [Streptococcus mitis SK564] Length = 117 Score = 64.0 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKV 59 >gi|227890569|ref|ZP_04008374.1| iojap family protein [Lactobacillus salivarius ATCC 11741] gi|301299668|ref|ZP_07205924.1| iojap-like protein [Lactobacillus salivarius ACS-116-V-Col5a] gi|227867507|gb|EEJ74928.1| iojap family protein [Lactobacillus salivarius ATCC 11741] gi|300852736|gb|EFK80364.1| iojap-like protein [Lactobacillus salivarius ACS-116-V-Col5a] Length = 117 Score = 64.0 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AED ++ S++ D VI S + V +IAD + + Sbjct: 2 DSKKLLEIVVKAADSKRAEDTVALDV-QGISILADYFVITQANSERQVKAIADAVKEQVY 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|153814876|ref|ZP_01967544.1| hypothetical protein RUMTOR_01091 [Ruminococcus torques ATCC 27756] gi|145847907|gb|EDK24825.1| hypothetical protein RUMTOR_01091 [Ruminococcus torques ATCC 27756] Length = 117 Score = 64.0 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L E K EDI I+ S + D VI +G S+ V ++ DN+ Sbjct: 1 MTQSKKMVRIAYDALNEKKGEDIKIIDIAE-VSTLGDYFVIANGNSSSQVTALVDNVEEE 59 Query: 73 LKK 75 + K Sbjct: 60 MHK 62 >gi|332704407|ref|ZP_08424495.1| iojap-like protein [Desulfovibrio africanus str. Walvis Bay] gi|332554556|gb|EGJ51600.1| iojap-like protein [Desulfovibrio africanus str. Walvis Bay] Length = 167 Score = 64.0 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 36/70 (51%), Gaps = 2/70 (2%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K+ +T D TV L++ KA DI ++ S I +++V+ + S +H +A Sbjct: 44 KELHRTISTTDK-AKTVATWLRDKKAIDIIALDVR-GISPITESLVVATASSVRHAQGLA 101 Query: 67 DNLISYLKKK 76 ++++ + ++ Sbjct: 102 NHILDKVSEE 111 >gi|85713727|ref|ZP_01044717.1| Iojap-related protein [Nitrobacter sp. Nb-311A] gi|85699631|gb|EAQ37498.1| Iojap-related protein [Nitrobacter sp. Nb-311A] Length = 98 Score = 64.0 bits (155), Expect = 8e-09, Method: Composition-based stats. Identities = 19/46 (41%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +KAE+I I+ +S D MVI +GRS +HV ++A+N+ LK Sbjct: 1 MKAEEIVTIDLR-GKSAFSDYMVIATGRSNRHVGAVAENVAKGLKD 45 >gi|282880909|ref|ZP_06289600.1| iojap-like protein [Prevotella timonensis CRIS 5C-B1] gi|281305132|gb|EFA97201.1| iojap-like protein [Prevotella timonensis CRIS 5C-B1] Length = 119 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 15/68 (22%), Positives = 32/68 (47%), Gaps = 4/68 (5%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN---- 68 + + T+ + ++E K +DI + + + I + VI G S V +I+++ Sbjct: 1 MKSSNQLVKTITKGIQEKKGQDIIIADLSDIDGAIANYFVICQGNSPAQVEAISESVGVT 60 Query: 69 LISYLKKK 76 + LK+K Sbjct: 61 VHKDLKEK 68 >gi|78188071|ref|YP_378409.1| Iojap-related protein [Chlorobium chlorochromatii CaD3] gi|78170270|gb|ABB27366.1| Iojap-related protein [Chlorobium chlorochromatii CaD3] Length = 129 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 13/73 (17%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 + + +Q + + + E E K E + ++ + I D VI + S + Sbjct: 6 ESNEAMVQEIEESELLAQRIAELALEKKCEVVKILDVR-GLTSITDFFVIATADSERKAK 64 Query: 64 SIADNLISYLKKK 76 + AD+++ L+ + Sbjct: 65 ASADHILDELRTE 77 >gi|329957560|ref|ZP_08298035.1| iojap-like protein [Bacteroides clarus YIT 12056] gi|328522437|gb|EGF49546.1| iojap-like protein [Bacteroides clarus YIT 12056] Length = 119 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K + I + T + IC+ VI G S V++I D++ + Sbjct: 1 MNEAKKLIQQITEGIQDKKGKKIVIADLTQIDDTICNYFVICQGNSPSQVSAIVDSVKDF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|307708271|ref|ZP_07644738.1| iojap family protein [Streptococcus mitis NCTC 12261] gi|307615717|gb|EFN94923.1| iojap family protein [Streptococcus mitis NCTC 12261] Length = 117 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQE-LTSVTDYFVITSSMNSRQLDTIADNIREKVAE 61 >gi|284929648|ref|YP_003422170.1| iojap-related protein [cyanobacterium UCYN-A] gi|284810092|gb|ADB95789.1| iojap-related protein [cyanobacterium UCYN-A] Length = 128 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 19/76 (25%), Positives = 34/76 (44%), Gaps = 7/76 (9%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M+ NT+K Q T+ K+ KA +I +E T + + D VI +G S Sbjct: 1 MIENTKKYLNQ------ELAKTIAMAAKDRKASNILILEVTEI-CYLADYFVIATGFSKT 53 Query: 61 HVASIADNLISYLKKK 76 + +IA + + ++ Sbjct: 54 QLKAIAQTIQEKVYQE 69 >gi|269125799|ref|YP_003299169.1| iojap-like protein [Thermomonospora curvata DSM 43183] gi|268310757|gb|ACY97131.1| iojap-like protein [Thermomonospora curvata DSM 43183] Length = 139 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +D + E + A+DI + + +I D ++ S + + V +I D + Sbjct: 1 MTASDRAAELVRIAAEAAGDKLADDIIAYDVSEQL-VITDAFLLCSAPNDRQVRAIVDEI 59 Query: 70 ISYLKKK 76 L+++ Sbjct: 60 EKRLREE 66 >gi|20807402|ref|NP_622573.1| hypothetical protein TTE0921 [Thermoanaerobacter tengcongensis MB4] gi|20515922|gb|AAM24177.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis MB4] Length = 117 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L E KA D+ + + I D +I +G S+ HV ++AD + Sbjct: 1 MIEAKEKVYKICRVLDEKKAFDVKILYIGE-LTTIADYFIIATGTSSTHVQALADEVEKK 59 Query: 73 LKKK 76 L ++ Sbjct: 60 LGEE 63 >gi|317128284|ref|YP_004094566.1| iojap-like protein [Bacillus cellulosilyticus DSM 2522] gi|315473232|gb|ADU29835.1| iojap-like protein [Bacillus cellulosilyticus DSM 2522] Length = 118 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + AEDI + SLI D VI G S K V +IA + + Sbjct: 2 DKKVLLDLAVRAADDKIAEDIVVLNM-EGVSLITDYFVICHGNSEKQVEAIAREIKDRAQ 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|218294603|ref|ZP_03495457.1| iojap-like protein [Thermus aquaticus Y51MC23] gi|218244511|gb|EED11035.1| iojap-like protein [Thermus aquaticus Y51MC23] Length = 113 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + L E KAE + ++ + + D V+ + S H+ ++ +L Sbjct: 1 MVKTKEALDLVGRIKDLLWEKKAEGVVALDLRKVSESL-DYFVLATATSAPHLQALERHL 59 Query: 70 ISYLKKK 76 LK++ Sbjct: 60 EEKLKEE 66 >gi|113460469|ref|YP_718531.1| hypothetical protein HS_0323 [Haemophilus somnus 129PT] gi|112822512|gb|ABI24601.1| conserved hypothetical protein [Haemophilus somnus 129PT] Length = 106 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++ L +LK DI ++ +S I D+M++ +G S++HV S+A LI K+ Sbjct: 2 NLVDFLVSKLDDLKGTDILALDVR-GKSSITDHMILCTGTSSRHVISLAQKLIDESKQ 58 >gi|46446873|ref|YP_008238.1| hypothetical protein pc1239 [Candidatus Protochlamydia amoebophila UWE25] gi|46400514|emb|CAF23963.1| conserved hypothetical protein [Candidatus Protochlamydia amoebophila UWE25] Length = 126 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + + + K +I ++ + D +I G +HV +I+ ++ L K Sbjct: 7 KTLTEVAQAIYDKKGFNILVLDV-KGICTMTDYFIIAEGTVDRHVRAISQTIVDQLAKH 64 >gi|312140326|ref|YP_004007662.1| hypothetical protein REQ_29660 [Rhodococcus equi 103S] gi|325677098|ref|ZP_08156767.1| Iojap family protein [Rhodococcus equi ATCC 33707] gi|311889665|emb|CBH48982.1| conserved hypothetical protein [Rhodococcus equi 103S] gi|325552083|gb|EGD21776.1| Iojap family protein [Rhodococcus equi ATCC 33707] Length = 138 Score = 63.6 bits (154), Expect = 9e-09, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ E A D+ ++ + +I D VI S + + V +I DN+ Sbjct: 1 MSASNDAIEMARIAALAADEKLASDVVVLDVSEQL-VITDCFVIASAANERQVNAIVDNV 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDKLRE 65 >gi|322377774|ref|ZP_08052263.1| iojap-like protein [Streptococcus sp. M334] gi|321281197|gb|EFX58208.1| iojap-like protein [Streptococcus sp. M334] Length = 117 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLDLVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIADNIREKVAQ 61 >gi|320353014|ref|YP_004194353.1| iojap-like protein [Desulfobulbus propionicus DSM 2032] gi|320121516|gb|ADW17062.1| iojap-like protein [Desulfobulbus propionicus DSM 2032] Length = 132 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 A + KAE++ ++ + D VI+SGRST+HV +A+ + Sbjct: 9 AEKEGRELAAVCARVALDTKAEEVVVLDVR-GLASFTDYFVIMSGRSTRHVQGLAEAIEG 67 Query: 72 YLKKK 76 L K Sbjct: 68 ELSTK 72 >gi|240950032|ref|ZP_04754340.1| hypothetical protein AM305_02573 [Actinobacillus minor NM305] gi|257465145|ref|ZP_05629516.1| hypothetical protein AM202_01450 [Actinobacillus minor 202] gi|240295510|gb|EER46253.1| hypothetical protein AM305_02573 [Actinobacillus minor NM305] gi|257450805|gb|EEV24848.1| hypothetical protein AM202_01450 [Actinobacillus minor 202] Length = 104 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + L +LKA++I I+ +S I D M+I +G S +HVA+ AD L + K+ Sbjct: 3 KQLVEFLTTTLDDLKAQNILAIDVR-GKSSITDTMIIATGTSVRHVAATADKLAAEAKQ 60 >gi|226360432|ref|YP_002778210.1| hypothetical protein ROP_10180 [Rhodococcus opacus B4] gi|226238917|dbj|BAH49265.1| hypothetical protein [Rhodococcus opacus B4] Length = 148 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + E A D+ ++ + +I D VI S + + V +I +N+ Sbjct: 1 MSATTEAIEMARIAAVAADEKLASDVVVLDVSEQL-VITDCFVIASAPNERQVNAIVENI 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDRLRE 65 >gi|113953150|ref|YP_730411.1| hypothetical protein sync_1202 [Synechococcus sp. CC9311] gi|113880501|gb|ABI45459.1| conserved hypothetical protein [Synechococcus sp. CC9311] Length = 122 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + K DI I S + D +VI G+S V ++A ++ L+ Sbjct: 2 DSEQLAELAADACDDRKGVDIQLIRV-DEVSSLADWLVIAGGQSDVQVKAMARSVEDRLE 60 Query: 75 KK 76 ++ Sbjct: 61 EE 62 >gi|256847501|ref|ZP_05552947.1| conserved hypothetical protein [Lactobacillus coleohominis 101-4-CHN] gi|256716165|gb|EEU31140.1| conserved hypothetical protein [Lactobacillus coleohominis 101-4-CHN] Length = 118 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + V++ +AEDI ++ S + D VI++G S + V +I + ++ Sbjct: 2 NSKELLEKVVKAADGRRAEDIVALQV-DQISPMADYFVIMTGGSDRQVQAIVNAIVEMA 59 >gi|171463877|ref|YP_001797990.1| iojap-like protein [Polynucleobacter necessarius subsp. necessarius STIR1] gi|171193415|gb|ACB44376.1| iojap-like protein [Polynucleobacter necessarius subsp. necessarius STIR1] Length = 130 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L V++ L+++KA+DI + T S + D ++IV+G S + S+A ++ + Sbjct: 2 DLRKLQRIVIDALEDVKAQDIRVYDTTK-LSELFDRVIIVTGSSNRQTRSLAMSVKEEV 59 >gi|111018306|ref|YP_701278.1| hypothetical protein RHA1_ro01296 [Rhodococcus jostii RHA1] gi|110817836|gb|ABG93120.1| conserved hypothetical protein [Rhodococcus jostii RHA1] Length = 141 Score = 63.6 bits (154), Expect = 1e-08, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + E A D+ ++ + +I D VI S + + V +I +N+ Sbjct: 1 MSATTEAIEMARIAAVAADEKLASDVVVLDVSEQL-VITDCFVIASAPNERQVNAIVENI 59 Query: 70 ISYLKK 75 L+ Sbjct: 60 EDRLRD 65 >gi|329911388|ref|ZP_08275494.1| Iojap-like protein [Oxalobacteraceae bacterium IMCC9480] gi|327545940|gb|EGF31038.1| Iojap-like protein [Oxalobacteraceae bacterium IMCC9480] Length = 226 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + A V++ L+++KA++I + + + D +V+ SG S + ++A ++ +K Sbjct: 2 DIKQLQALVIDALEDVKAQEIKVFDTVH-LTSLFDRIVVASGTSNRQTKALAASVRDKVK 60 Query: 75 KK 76 Sbjct: 61 DN 62 >gi|124003040|ref|ZP_01687891.1| iojap protein family [Microscilla marina ATCC 23134] gi|123991690|gb|EAY31098.1| iojap protein family [Microscilla marina ATCC 23134] Length = 133 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 28/62 (45%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+E + E KA D+ ++ + I D VI SG + V +I++++ + Sbjct: 9 SSKELSKIVVEGMLEKKALDVVVLDLKKINQSIADYFVICSGNTVNQVDAISESIEEVVY 68 Query: 75 KK 76 K Sbjct: 69 KH 70 >gi|88801227|ref|ZP_01116767.1| hypothetical protein MED297_03365 [Reinekea sp. MED297] gi|88776033|gb|EAR07268.1| hypothetical protein MED297_03365 [Reinekea sp. MED297] Length = 121 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ I+ ++E L+ +KA DI I+ ++ + D +VI SG ST+H+A++ +++ +K+K Sbjct: 13 EALISNLIEALENIKATDIQVIDVRD-KTTLMDTLVIASGTSTRHIAAVVNSVAEEMKEK 71 >gi|114331597|ref|YP_747819.1| iojap-like protein [Nitrosomonas eutropha C91] gi|114308611|gb|ABI59854.1| iojap-like protein [Nitrosomonas eutropha C91] Length = 121 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + TV+ L++LKA DI I + + + + MVI S ST+ ++A ++ Sbjct: 1 MKLPNEQLKTVIMALEDLKASDIHVINVSK-LTALFNTMVIASADSTRQTKALAGHVQEK 59 Query: 73 LK 74 +K Sbjct: 60 VK 61 >gi|330719329|ref|ZP_08313929.1| YqeL [Leuconostoc fallax KCTC 3537] Length = 121 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + T ++ KA +I ++ SL+ D VI S + V +I + + + Sbjct: 4 DAQQLLETAVKAADSKKANNIVALDMQK-VSLMADYFVIADAASPRQVQAIVNEIKDKVA 62 Query: 75 K 75 + Sbjct: 63 E 63 >gi|225853283|ref|YP_002733516.1| iojap-related protein [Brucella melitensis ATCC 23457] gi|256045439|ref|ZP_05448331.1| iojap superfamily protein [Brucella melitensis bv. 1 str. Rev.1] gi|256114419|ref|ZP_05455139.1| iojap superfamily protein [Brucella melitensis bv. 3 str. Ether] gi|225641648|gb|ACO01562.1| iojap-related protein [Brucella melitensis ATCC 23457] Length = 123 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + L+ KAE I I+ RS I D M++ SGRS +HV ++ D+L Sbjct: 1 MNETNLVSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVTDHL 59 Query: 70 ISYLKK 75 + L++ Sbjct: 60 VQALRE 65 >gi|323342056|ref|ZP_08082289.1| Iojap family protein [Erysipelothrix rhusiopathiae ATCC 19414] gi|322464481|gb|EFY09674.1| Iojap family protein [Erysipelothrix rhusiopathiae ATCC 19414] Length = 112 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ + +++ + E KA DI ++ + +CD VI S + + +IA+ + +KK Sbjct: 1 MNNLLDVIVKTIDEKKANDIVTVDFKR-ENPLCDYFVIADAPSVRQINAIAEFVEVAIKK 59 Query: 76 K 76 + Sbjct: 60 E 60 >gi|148657354|ref|YP_001277559.1| iojap-like protein [Roseiflexus sp. RS-1] gi|148569464|gb|ABQ91609.1| iojap-like protein [Roseiflexus sp. RS-1] Length = 125 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 9/62 (14%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ +A +I ++ + + D VI +G S + + +I + + L Sbjct: 13 QATEIARRAVTLAEDKQASNIVLLDLRR-LNSVADYFVICTGGSERQLKAITEAIDEGLA 71 Query: 75 KK 76 ++ Sbjct: 72 RE 73 >gi|254360908|ref|ZP_04977054.1| hypothetical protein MHA_0474 [Mannheimia haemolytica PHL213] gi|153092387|gb|EDN73450.1| hypothetical protein MHA_0474 [Mannheimia haemolytica PHL213] Length = 109 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 40/66 (60%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + L +LKA+DI I+ +S I D M++ +G S++HVAS A+ L Sbjct: 1 MRERNVEQNLVEFLTKTLDDLKAQDILAIDV-KGKSSITDTMILATGTSSRHVASTAERL 59 Query: 70 ISYLKK 75 I+ K+ Sbjct: 60 ITEAKQ 65 >gi|256545142|ref|ZP_05472508.1| iojap-related protein [Anaerococcus vaginalis ATCC 51170] gi|256399183|gb|EEU12794.1| iojap-related protein [Anaerococcus vaginalis ATCC 51170] Length = 103 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L++ +A DI I+ +S I D V+ +G S ++ + + LKK+ Sbjct: 4 LDIIVKTLEDKQAYDIKVIDL-ENKSSIADYFVLATGNSINQNKALIEYIEENLKKE 59 >gi|126209065|ref|YP_001054290.1| hypothetical protein APL_1601 [Actinobacillus pleuropneumoniae L20] gi|303250833|ref|ZP_07337027.1| hypothetical protein APP6_1959 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|303253455|ref|ZP_07339597.1| hypothetical protein APP2_2136 [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|126097857|gb|ABN74685.1| hypothetical protein APL_1601 [Actinobacillus pleuropneumoniae serovar 5b str. L20] gi|302647699|gb|EFL77913.1| hypothetical protein APP2_2136 [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|302650346|gb|EFL80508.1| hypothetical protein APP6_1959 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] Length = 104 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 22/59 (37%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M+I +G S +HVAS AD L + K+ Sbjct: 3 QNLVEFLTKTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTADRLSAEAKQ 60 >gi|160934413|ref|ZP_02081800.1| hypothetical protein CLOLEP_03286 [Clostridium leptum DSM 753] gi|156867086|gb|EDO60458.1| hypothetical protein CLOLEP_03286 [Clostridium leptum DSM 753] Length = 117 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + L K DI I + + D VI +G S V ++AD + LK+ Sbjct: 5 ELAKEAAKILDSKKGIDIQAIGVRE-VTTLADYFVIAAGGSGTQVKALADEVEFQLKQ 61 >gi|325105710|ref|YP_004275364.1| iojap-like protein [Pedobacter saltans DSM 12145] gi|324974558|gb|ADY53542.1| iojap-like protein [Pedobacter saltans DSM 12145] Length = 124 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 28/53 (52%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 A ++ ++E K +I ++ ++ S + D +I S+ V +IAD++ + Sbjct: 15 AAIVHGIQEKKGNEIVRLDLRNINSSVADYFIICHADSSTQVRAIADSIEKEV 67 >gi|322513152|ref|ZP_08066284.1| Iojap family protein [Actinobacillus ureae ATCC 25976] gi|322121084|gb|EFX92907.1| Iojap family protein [Actinobacillus ureae ATCC 25976] Length = 104 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L + KA+DI I+ +S I D M+I +G S +HVAS AD L + K+ Sbjct: 3 QNLVEFLTKTLDDSKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTADRLSAEAKQ 60 >gi|225418740|ref|ZP_03761929.1| hypothetical protein CLOSTASPAR_05964 [Clostridium asparagiforme DSM 15981] gi|225041729|gb|EEG51975.1| hypothetical protein CLOSTASPAR_05964 [Clostridium asparagiforme DSM 15981] Length = 117 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D L E K DI I+ S++ D +I G + V ++ADN+ Sbjct: 1 MDQSKEMAKLAYAALSEKKGGDIKIIDI-HEVSVMADYFIIADGSNLNQVQAMADNVEEK 59 Query: 73 LKK 75 + + Sbjct: 60 MAE 62 >gi|262277912|ref|ZP_06055705.1| iojap family protein [alpha proteobacterium HIMB114] gi|262225015|gb|EEY75474.1| iojap family protein [alpha proteobacterium HIMB114] Length = 114 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I V + L + KA+DI I+ +S I D MVI SG S++H+ +I++ LK Sbjct: 3 NRIIDKVHQILDDNKAQDIVIIDLKD-KSSIADYMVIASGTSSRHIQAISEITAQKLK 59 >gi|170718243|ref|YP_001783546.1| iojap-like protein [Haemophilus somnus 2336] gi|168826372|gb|ACA31743.1| iojap-like protein [Haemophilus somnus 2336] Length = 102 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++ L +LK DI ++ +S I D+M++ +G S++HV S+A LI K+ Sbjct: 2 NLVDFLVSKLDDLKGTDILALDVR-GKSSITDHMILCTGTSSRHVISLAQKLIDESKQ 58 >gi|294010242|ref|YP_003543702.1| Iojap-related protein [Sphingobium japonicum UT26S] gi|292673572|dbj|BAI95090.1| Iojap-related protein [Sphingobium japonicum UT26S] Length = 129 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 AD + + V++ L + +A++ I +S I D+MVI SGRS++ VAS+A L Sbjct: 13 NADSVAALHDLVLKSLDDDQAQETISIPL-EGKSSIADHMVIASGRSSRQVASMAQKLAE 71 Query: 72 YLKK 75 +K+ Sbjct: 72 RIKQ 75 >gi|170016755|ref|YP_001727674.1| YqeL [Leuconostoc citreum KM20] gi|169803612|gb|ACA82230.1| YqeL [Leuconostoc citreum KM20] Length = 123 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + TA +++ + T ++ + KA +I ++ + SL+ D VI S + V +I + Sbjct: 1 MTTALDVNTVLETAVKAIDGKKANNIVALDMRN-VSLMADYFVIADAASNRQVQAIVTEV 59 Query: 70 ISYL 73 + Sbjct: 60 KDKV 63 >gi|167764967|ref|ZP_02437088.1| hypothetical protein BACSTE_03360 [Bacteroides stercoris ATCC 43183] gi|167697636|gb|EDS14215.1| hypothetical protein BACSTE_03360 [Bacteroides stercoris ATCC 43183] Length = 119 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K + I + T + IC+ VI G S V++I +++ + Sbjct: 1 MNEAKKLIQQITEGIQDKKGKKIVIADLTRIDDTICNYFVICQGNSPSQVSAIVESVKDF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|213962505|ref|ZP_03390767.1| iojap homolog [Capnocytophaga sputigena Capno] gi|213954831|gb|EEB66151.1| iojap homolog [Capnocytophaga sputigena Capno] Length = 123 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 10/68 (14%), Positives = 34/68 (50%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + I+ ++ ++++K DI ++ + + +CD ++ +G S V++I+ + Sbjct: 1 MNKEISSNQLISNIIAGIEKVKGTDITIMDLREVENTVCDYFILCNGSSNTQVSAISGAI 60 Query: 70 ISYLKKKN 77 + + + Sbjct: 61 QKMVSQAD 68 >gi|317131330|ref|YP_004090644.1| iojap-like protein [Ethanoligenens harbinense YUAN-3] gi|315469309|gb|ADU25913.1| iojap-like protein [Ethanoligenens harbinense YUAN-3] Length = 134 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/75 (26%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 ++ T+ A + +E L KAED+ IE ++ S+I D ++ +G ST Sbjct: 2 IIKTTKTNREAVALTSKELLEKAVEILDNRKAEDLTAIEIGNI-SIIADYFLLATGNSTT 60 Query: 61 HVASIADNLISYLKK 75 V S+A+ L + Sbjct: 61 QVKSLAEELEFQFSQ 75 >gi|57867054|ref|YP_188735.1| iojap-related protein [Staphylococcus epidermidis RP62A] gi|57637712|gb|AAW54500.1| iojap-related protein [Staphylococcus epidermidis RP62A] Length = 117 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + +E + KAEDI + + S + D V+ G + + V SIA ++ Sbjct: 2 NSEELLNIAVEVAENKKAEDIISLNMNEI-SDMTDYFVVCHGNNERQVQSIARSVKEVAH 60 Query: 75 KKN 77 K + Sbjct: 61 KHD 63 >gi|326693249|ref|ZP_08230254.1| YqeL [Leuconostoc argentinum KCTC 3773] Length = 123 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + TA + + + T ++ + + KA +I ++ SL+ D VI S + V +I + Sbjct: 1 MTTALDVKTVLETAIKAVDDKKANNIVALDMQQ-VSLMADYFVIADAASNRQVQAIVTEV 59 Query: 70 ISYLKK 75 +++ Sbjct: 60 KDKIQE 65 >gi|260582052|ref|ZP_05849847.1| iojap family protein [Haemophilus influenzae NT127] gi|260094942|gb|EEW78835.1| iojap family protein [Haemophilus influenzae NT127] Length = 102 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +ME L LK DI H +S I DNM+I +G S++ V+++ADNLI+ KK Sbjct: 3 LVEFLMETLDGLKGTDIVHFHVR-GKSSITDNMIICTGMSSRQVSAMADNLITECKK 58 >gi|257455718|ref|ZP_05620946.1| iojap protein [Enhydrobacter aerosaccus SK60] gi|257446846|gb|EEV21861.1| iojap protein [Enhydrobacter aerosaccus SK60] Length = 133 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 L +C+ V + L +LKA++I ++ + + + +VI G ST+H+ ++AD++ Sbjct: 15 AHQQLTTCLDIVQDALDDLKAKNITVLDVAD-MTEVMERIVIAEGTSTRHLKAVADHVAM 73 Query: 72 YLKK 75 K+ Sbjct: 74 KSKQ 77 >gi|78356799|ref|YP_388248.1| Iojap-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78219204|gb|ABB38553.1| Iojap-related protein [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 131 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/73 (19%), Positives = 31/73 (42%), Gaps = 1/73 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T+K+ + + L + KA D+ + S D M++ + S + + Sbjct: 3 TKKEKKFSLADGHEKAQRLAALLNDKKARDLLVFDLR-GISGFTDFMIVGTAGSVRQGQA 61 Query: 65 IADNLISYLKKKN 77 +AD ++ + K+ N Sbjct: 62 LADYMLDFCKQNN 74 >gi|320449404|ref|YP_004201500.1| iojap protein family [Thermus scotoductus SA-01] gi|320149573|gb|ADW20951.1| iojap protein family [Thermus scotoductus SA-01] Length = 124 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 +A + + L E KAE + ++ ++ + D V+ S ST H+ ++ ++ Sbjct: 15 KQEAVELVARIKDLLWEKKAEKVVALDLRAVSESL-DYFVLASATSTPHLQALERHVQEK 73 Query: 73 LKKK 76 L+++ Sbjct: 74 LEEE 77 >gi|152982104|ref|YP_001352230.1| hypothetical protein mma_0540 [Janthinobacterium sp. Marseille] gi|151282181|gb|ABR90591.1| Uncharacterized conserved protein [Janthinobacterium sp. Marseille] Length = 220 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + A V++ L+++KA+DI + + + D + + SG S + ++A ++ +K Sbjct: 2 DIKKLQALVIDALEDVKAQDIKVFDTVH-LTSLFDRIAVASGTSNRQTKALAASVRDKVK 60 >gi|317500389|ref|ZP_07958613.1| hypothetical protein HMPREF1026_00556 [Lachnospiraceae bacterium 8_1_57FAA] gi|331089604|ref|ZP_08338503.1| iojap protein 155 [Lachnospiraceae bacterium 3_1_46FAA] gi|316898144|gb|EFV20191.1| hypothetical protein HMPREF1026_00556 [Lachnospiraceae bacterium 8_1_57FAA] gi|330404972|gb|EGG84510.1| iojap protein 155 [Lachnospiraceae bacterium 3_1_46FAA] Length = 117 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L E K EDI I+ S + D VI +G S+ V ++ DN+ Sbjct: 1 MTQSKKMARIAYDALNEKKGEDIKIIDIAE-VSTLGDYFVIANGNSSSQVTALVDNVEEE 59 Query: 73 LKK 75 + K Sbjct: 60 MHK 62 >gi|302670795|ref|YP_003830755.1| hypothetical protein bpr_I1436 [Butyrivibrio proteoclasticus B316] gi|302395268|gb|ADL34173.1| hypothetical protein bpr_I1436 [Butyrivibrio proteoclasticus B316] Length = 120 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + ++ L++ K ED+ I+ + + S + D +I G + V ++ADN+ Sbjct: 1 MADLNVSKKMALMAVDALEDRKGEDVRVIDISEI-STLADYFIIAGGTNINQVQAMADNV 59 Query: 70 ISYL 73 L Sbjct: 60 QEVL 63 >gi|121998919|ref|YP_001003706.1| iojap-like protein [Halorhodospira halophila SL1] gi|121590324|gb|ABM62904.1| iojap-like protein [Halorhodospira halophila SL1] Length = 117 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + E L +KA+D I+ R+ + D +V+ +G S +HV ++A NL+ K Sbjct: 3 VEELEQRIRESLDAIKAQDTVAIDVR-GRTPVTDLIVVTTGTSRRHVHAVARNLVDEAK 60 >gi|302389339|ref|YP_003825160.1| iojap-like protein [Thermosediminibacter oceani DSM 16646] gi|302199967|gb|ADL07537.1| iojap-like protein [Thermosediminibacter oceani DSM 16646] Length = 125 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + L + KAEDI ++ +S+ S+I D V+ +GRS+ HV ++AD + L +K Sbjct: 13 AKILSDKKAEDIVVLDISSI-SVIADYFVVATGRSSIHVKALADEVEEKLSEK 64 >gi|291279762|ref|YP_003496597.1| hypothetical protein DEFDS_1380 [Deferribacter desulfuricans SSM1] gi|290754464|dbj|BAI80841.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1] Length = 110 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + L + K EDI + + S I D MVI + S H+ ++A+ L+ +K + Sbjct: 2 ENLKLIYNVLDDKKGEDIVIYDIKN-VSSIADFMVICTCTSEVHLEAVANELLFVMKHE 59 >gi|282890522|ref|ZP_06299045.1| hypothetical protein pah_c022o108 [Parachlamydia acanthamoebae str. Hall's coccus] gi|281499519|gb|EFB41815.1| hypothetical protein pah_c022o108 [Parachlamydia acanthamoebae str. Hall's coccus] Length = 123 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + + + + + + K +I ++ S + D VI G +HV SIA ++ + Sbjct: 3 DSNEKILNVIAQAIFDKKGSNILALDVRD-VSTLTDYFVIAEGTVDRHVTSIASTILDAV 61 Query: 74 K 74 K Sbjct: 62 K 62 >gi|258544719|ref|ZP_05704953.1| iojap family protein [Cardiobacterium hominis ATCC 15826] gi|258520038|gb|EEV88897.1| iojap family protein [Cardiobacterium hominis ATCC 15826] Length = 111 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + V+ L++LKA +I IE ++ I D M++ SG S +H+ ++A + K Sbjct: 2 NANELKTLVLASLEDLKAVNIQTIELA-GKTDIADYMIVASGTSDRHLHALAGKIHDDSK 60 >gi|237747749|ref|ZP_04578229.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] gi|229379111|gb|EEO29202.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13] Length = 160 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 35/61 (57%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ A V++ L+++KA DI + TS + + + +VI SG S + ++A ++ +K Sbjct: 2 EIEKLQALVIDALEDVKAADIALFD-TSNLTSLFERIVIASGNSNRQTKALAASVRDKVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|298241861|ref|ZP_06965668.1| iojap-like protein [Ktedonobacter racemifer DSM 44963] gi|297554915|gb|EFH88779.1| iojap-like protein [Ktedonobacter racemifer DSM 44963] Length = 135 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + KA DI ++ ++ D VI SG + + + +IA + L Sbjct: 23 DPAQLAKAAVDIASDKKASDILLLDIRE-VTVFADYFVICSGSNPRLIQTIASTIDEELG 81 Query: 75 KK 76 K+ Sbjct: 82 KQ 83 >gi|288959177|ref|YP_003449518.1| hypothetical protein AZL_023360 [Azospirillum sp. B510] gi|288911485|dbj|BAI72974.1| hypothetical protein AZL_023360 [Azospirillum sp. B510] Length = 148 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A + L +A+D+ I+ ++ D M++ SGR+T+H+A++A L LK Sbjct: 31 EPQDLKALIQASLDADQADDVTVIDLA-GKTTFADYMIVASGRNTRHIAAMAMKLAEKLK 89 Query: 75 K 75 + Sbjct: 90 Q 90 >gi|157376615|ref|YP_001475215.1| iojap-like protein [Shewanella sediminis HAW-EB3] gi|157318989|gb|ABV38087.1| iojap-like protein [Shewanella sediminis HAW-EB3] Length = 109 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ +++LKA+DI +E ++ +S I D MV+ SG S HV +IA+N++ K Sbjct: 2 DSAELKQFVIDKIEDLKAKDIVTLEVSN-QSNITDYMVVCSGTSKTHVKAIAENVVVESK 60 Query: 75 K 75 + Sbjct: 61 R 61 >gi|304436694|ref|ZP_07396663.1| iojap-like protein [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304370390|gb|EFM24046.1| iojap-like protein [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 114 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E KA DI ++ L S D +I S + V +IADN+ +++ Sbjct: 8 RVIQAAADEKKARDIVQMDMVGLMST-NDYFIICSANTATQVRAIADNIEEKMEE 61 >gi|162146762|ref|YP_001601223.1| hypothetical protein GDI_0942 [Gluconacetobacter diazotrophicus PAl 5] gi|161785339|emb|CAP54885.1| conserved hypothetical protein [Gluconacetobacter diazotrophicus PAl 5] Length = 148 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 L+ +A + E + + K EDI ++ T R+ D MV+ +G + + ++++A ++ L + Sbjct: 34 LEKYLAIITESIADDKGEDIVVLDLT-GRAAFADRMVVATGLADRQISAMATHIERKLGE 92 >gi|307704304|ref|ZP_07641222.1| conserved hypothetical protein [Streptococcus mitis SK597] gi|307622140|gb|EFO01159.1| conserved hypothetical protein [Streptococcus mitis SK597] Length = 117 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI + + + D VI S +++ + +IADN+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALGVQE-LTSVTDYFVITSSMNSRQLDAIADNIREKVAE 61 >gi|219848821|ref|YP_002463254.1| iojap-like protein [Chloroflexus aggregans DSM 9485] gi|219543080|gb|ACL24818.1| iojap-like protein [Chloroflexus aggregans DSM 9485] Length = 116 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 9/59 (15%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++E +++ +A DI ++ ++ I D +I + + + + +I D++ + ++ Sbjct: 8 IARRIVELVEDKQAHDIVLLDIRP-QTTIADYFIICTADNDRQMRAIIDHIDEKISTEH 65 >gi|189468121|ref|ZP_03016906.1| hypothetical protein BACINT_04516 [Bacteroides intestinalis DSM 17393] gi|189436385|gb|EDV05370.1| hypothetical protein BACINT_04516 [Bacteroides intestinalis DSM 17393] Length = 119 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K ++I + + + IC+ +VI G S V +I +++ + Sbjct: 1 MNETKKLIQQITEGIQDKKGKNIVIADLSKIGDTICNYLVICQGNSPSQVTAIVESVREF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|299135881|ref|ZP_07029065.1| iojap-like protein [Acidobacterium sp. MP5ACTX8] gi|298602005|gb|EFI58159.1| iojap-like protein [Acidobacterium sp. MP5ACTX8] Length = 210 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 30/62 (48%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ +A ++ KAEDI + S + D +I +G + + +I+D + LK Sbjct: 5 EVNQMLAAAAAACEDKKAEDIRILALDPSESGLTDYFLICNGTNDRQNVAISDEIEIRLK 64 Query: 75 KK 76 ++ Sbjct: 65 RE 66 >gi|332993378|gb|AEF03433.1| iojap domain-containing protein [Alteromonas sp. SN2] Length = 105 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V + + ++K DI ++ +S I D M+I SG S +HV +IA+N+I K Sbjct: 2 ESQQLKQFVKDKVDDMKGRDIIELDVR-GKSTITDTMIICSGNSKRHVVAIAENVIVEAK 60 >gi|307294890|ref|ZP_07574732.1| iojap-like protein [Sphingobium chlorophenolicum L-1] gi|306879364|gb|EFN10582.1| iojap-like protein [Sphingobium chlorophenolicum L-1] Length = 128 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 AD + + V++ L + +A++ I +S I D+MVI SGRS++ VAS+A L Sbjct: 12 NADSVAALHDLVLKSLDDDQAQETISIPL-EGKSSIADHMVIASGRSSRQVASMAQKLAE 70 Query: 72 YLKK 75 +K+ Sbjct: 71 RIKQ 74 >gi|254490520|ref|ZP_05103706.1| iojap family protein [Methylophaga thiooxidans DMS010] gi|224464264|gb|EEF80527.1| iojap family protein [Methylophaga thiooxydans DMS010] Length = 118 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ L+++KAEDI ++ T + + D M+I +G+S++ V ++A+ ++ K Sbjct: 2 QAEKLKLLVIDALEDIKAEDIQILDVTE-MTDVTDIMIIATGKSSRQVKALANEVVMQAK 60 >gi|189501689|ref|YP_001957406.1| hypothetical protein Aasi_0233 [Candidatus Amoebophilus asiaticus 5a2] gi|189497130|gb|ACE05677.1| hypothetical protein Aasi_0233 [Candidatus Amoebophilus asiaticus 5a2] Length = 122 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 32/59 (54%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++E +++ KA+DI + + S + ++ +G+++ + +IA+ ++ +K Sbjct: 13 DLVTAIVEGMQDKKAQDISVLNLKKIGSAVASYFILCTGQASTQIEAIAEGIMEAAYEK 71 >gi|146337573|ref|YP_001202621.1| plant iojap-like protein [Bradyrhizobium sp. ORS278] gi|146190379|emb|CAL74375.1| conserved hypothetical protein; plant iojap-related protein [Bradyrhizobium sp. ORS278] Length = 98 Score = 62.8 bits (152), Expect = 1e-08, Method: Composition-based stats. Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +KAE+ I+ +S D MVI +GRS +HV SIA+N+ LK+ Sbjct: 1 MKAEETVTIDL-HGKSAYSDYMVITTGRSNRHVGSIAENVAKGLKE 45 >gi|225567999|ref|ZP_03777024.1| hypothetical protein CLOHYLEM_04072 [Clostridium hylemonae DSM 15053] gi|225163173|gb|EEG75792.1| hypothetical protein CLOHYLEM_04072 [Clostridium hylemonae DSM 15053] Length = 117 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 +H + L + K E+I I+ S S++ D +I G S + ++ +N+ Sbjct: 1 MEHAMEMARIAYDALSDKKGENIQIIDI-SGVSVLADYFIITDGTSDSQIKALVENVDEK 59 Query: 73 LKK 75 + K Sbjct: 60 MTK 62 >gi|158320774|ref|YP_001513281.1| iojap-like protein [Alkaliphilus oremlandii OhILAs] gi|158140973|gb|ABW19285.1| iojap-like protein [Alkaliphilus oremlandii OhILAs] Length = 121 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 L + V+ C+ + +I ++ + ICD VI S S++ V +I D L Sbjct: 2 KKDLLRIVQKVVHCIDDKSGTNIVALDLG-GVTSICDYFVIASASSSRQVKAIVDELEDR 60 Query: 73 L 73 L Sbjct: 61 L 61 >gi|124023087|ref|YP_001017394.1| hypothetical protein P9303_13821 [Prochlorococcus marinus str. MIT 9303] gi|123963373|gb|ABM78129.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9303] Length = 122 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + E + KA DI I S + D MVI G S V +IA ++ L Sbjct: 2 DSEQLAEIAAEACDDRKATDIQLIRI-DEVSSLADWMVIAGGLSEVQVRAIAKSVEDRL 59 >gi|119899897|ref|YP_935110.1| hypothetical protein azo3608 [Azoarcus sp. BH72] gi|119672310|emb|CAL96224.1| conserved hypothetical protein [Azoarcus sp. BH72] Length = 121 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 TV+ L+++KA DI I+ T R+ + D +++ S S + +++ N+ +K+ Sbjct: 6 LQETVVAALEDIKARDIEVIDTTK-RTALFDRIIVASADSGRQTRALSRNVQDKVKE 61 >gi|222151489|ref|YP_002560645.1| hypothetical protein MCCL_1242 [Macrococcus caseolyticus JCSC5402] gi|222120614|dbj|BAH17949.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402] Length = 120 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + +AEDI I + + D VI G S + V +IA + Sbjct: 3 LMNSKALLELAFNACDNKRAEDIIGINVAD-VTGVTDYFVICEGNSDRQVQAIAREVKDE 61 Query: 73 LKKK 76 +K Sbjct: 62 AQKN 65 >gi|15672210|ref|NP_266384.1| hypothetical protein L28204 [Lactococcus lactis subsp. lactis Il1403] gi|12723085|gb|AAK04326.1|AE006260_9 hypothetical protein L28204 [Lactococcus lactis subsp. lactis Il1403] gi|326405807|gb|ADZ62878.1| conserved hypothetical protein [Lactococcus lactis subsp. lactis CV56] Length = 119 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + V++ + KA DI ++ + + + D VI+ +++ + +IADN+ Sbjct: 2 DSKKLLEVVVKAADDKKALDIVALDMSE-VTFVADYFVIMEAMNSRQLDAIADNI 55 >gi|325846636|ref|ZP_08169551.1| iojap-like protein [Anaerococcus hydrogenalis ACS-025-V-Sch4] gi|325481394|gb|EGC84435.1| iojap-like protein [Anaerococcus hydrogenalis ACS-025-V-Sch4] Length = 103 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L++ +A D+ I+ +S + D V+ +G S ++ + + LKK+ Sbjct: 4 LDIIVKTLEDKQAYDVKVIDL-ENKSSVADYFVLATGNSINQNKALLEYIEENLKKE 59 >gi|332187422|ref|ZP_08389160.1| hypothetical protein SUS17_2577 [Sphingomonas sp. S17] gi|332012583|gb|EGI54650.1| hypothetical protein SUS17_2577 [Sphingomonas sp. S17] Length = 119 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ ++ L + +A + I +S I D MVI SGRST+ VAS+A L +K Sbjct: 1 MEALHRLILASLDDDQAVETISIPLA-GKSSIADFMVIASGRSTRQVASMAMKLAEKIKA 59 Query: 76 K 76 + Sbjct: 60 E 60 >gi|209694550|ref|YP_002262478.1| hypothetical protein VSAL_I0987 [Aliivibrio salmonicida LFI1238] gi|208008501|emb|CAQ78672.1| conserved hypothetical protein [Aliivibrio salmonicida LFI1238] Length = 105 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + ++KAE+I ++ +S I D M++ +G S +HV+SIA N+ ++ Sbjct: 4 KELHDFLFNHVDDMKAENITTVDVRD-KSSITDFMIVCTGTSKRHVSSIASNVSDKARE 61 >gi|210623772|ref|ZP_03294032.1| hypothetical protein CLOHIR_01983 [Clostridium hiranonis DSM 13275] gi|210153354|gb|EEA84360.1| hypothetical protein CLOHIR_01983 [Clostridium hiranonis DSM 13275] Length = 119 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ + + +++ DI + + + + D +I + S++ V +IAD + Sbjct: 1 MAADLTVEQMVKVINHAIEDKLGRDILILNIGKI-TSLADYFIITTASSSRQVKAIADKV 59 Query: 70 ISYLKKK 76 + K Sbjct: 60 EEDMTKN 66 >gi|87125676|ref|ZP_01081520.1| hypothetical protein RS9917_13583 [Synechococcus sp. RS9917] gi|86166652|gb|EAQ67915.1| hypothetical protein RS9917_13583 [Synechococcus sp. RS9917] Length = 132 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + KA DI I S + D +VI G+S V +IA ++ L+ Sbjct: 12 ESVQLAELAADACDDRKATDIELIRV-DAVSSLADWLVIAGGQSDVQVRAIARSVQDRLE 70 Query: 75 KK 76 + Sbjct: 71 AE 72 >gi|213581073|ref|ZP_03362899.1| hypothetical protein SentesTyph_07651 [Salmonella enterica subsp. enterica serovar Typhi str. E98-0664] Length = 62 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + V++ + +LK +DI ++ +S I D M+I +G S++HV SIAD+++ Sbjct: 4 KALQDFVIDKIDDLKGQDIIALDV-QGKSSITDCMIICTGTSSRHVMSIADHVVQ 57 >gi|282859186|ref|ZP_06268308.1| iojap-like protein [Prevotella bivia JCVIHMP010] gi|282588005|gb|EFB93188.1| iojap-like protein [Prevotella bivia JCVIHMP010] Length = 119 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + + +++ K I + + + IC N VI G S V +IA+++ Y Sbjct: 1 MEETKKLVELITKGIQDKKGHGIVIADLSEIDGAICRNFVICQGNSPAQVEAIAESIGDY 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|256832865|ref|YP_003161592.1| iojap-like protein [Jonesia denitrificans DSM 20603] gi|256686396|gb|ACV09289.1| iojap-like protein [Jonesia denitrificans DSM 20603] Length = 141 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + DH T + KA +I ++ + ++ D VI SG S + V++I D + Sbjct: 1 MAATDHAIDLAITAARAASDKKASEIIALDVSDHL-VLTDAFVIASGNSERQVSAIVDAV 59 Query: 70 ISYLKK 75 L + Sbjct: 60 ERALHE 65 >gi|304310097|ref|YP_003809695.1| Iojap-related protein [gamma proteobacterium HdN1] gi|301795830|emb|CBL44029.1| Iojap-related protein [gamma proteobacterium HdN1] Length = 146 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L ++KA+D+ ++ + + D M++ SG ST+HV + AD + + Sbjct: 13 SAEDIKNAALTALDDMKAKDVVCLDIKP-LTSMADYMIVASGTSTRHVKASADKVEEAAR 71 >gi|297621595|ref|YP_003709732.1| Iojap family protein [Waddlia chondrophila WSU 86-1044] gi|297376896|gb|ADI38726.1| Iojap family protein [Waddlia chondrophila WSU 86-1044] Length = 121 Score = 62.8 bits (152), Expect = 2e-08, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + + + + K +I I+ S + D +I G +HV+++A ++ + Sbjct: 3 KDEIKMLQAIAQAIYDKKGVNIIAIDVKK-SSSLTDYFLIAEGSVERHVSALASSVKETV 61 Query: 74 KK 75 K+ Sbjct: 62 KE 63 >gi|325270325|ref|ZP_08136930.1| Iojap family protein [Prevotella multiformis DSM 16608] gi|324987269|gb|EGC19247.1| Iojap family protein [Prevotella multiformis DSM 16608] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 33/63 (52%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + IA + + +++ K I + +++ IC VI G S + V +IA+++ Y Sbjct: 1 MEETKNLIALITKGIQDKKGHGIVIADLSAIDGTICRCFVICQGNSPQQVEAIAESVSDY 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|39933243|ref|NP_945519.1| Iojap-like protein [Rhodopseudomonas palustris CGA009] gi|39652868|emb|CAE25610.1| Iojap-related protein [Rhodopseudomonas palustris CGA009] Length = 98 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +KAE+ I+ +S + D +V+ +GR+ +HV +IA+N++ LK+ Sbjct: 1 MKAEETVTIDLR-GKSAMFDYVVVTTGRANRHVGAIAENVVKALKQ 45 >gi|294142175|ref|YP_003558153.1| iojap domain-containing protein [Shewanella violacea DSS12] gi|293328644|dbj|BAJ03375.1| iojap domain protein [Shewanella violacea DSS12] Length = 109 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ +++LKA+DI + +S + D MV+ SG S HV +IA+N++ K Sbjct: 2 ESAELKQFVIDKIEDLKAKDIVTLAVAE-QSNMTDYMVVCSGTSKTHVKAIAENVVLECK 60 Query: 75 K 75 + Sbjct: 61 R 61 >gi|295100368|emb|CBK97913.1| iojap-related protein [Faecalibacterium prausnitzii L2-6] Length = 126 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + L + KA+D+ ++ +++ D VI SG ST V S+AD + Sbjct: 1 MDKNIDSKNLAIEIAKILDKKKAQDVRVLKV-DSLTVLTDYFVIASGTSTTQVGSLADEV 59 Query: 70 ISYLKK 75 L + Sbjct: 60 EYELSQ 65 >gi|296333279|ref|ZP_06875732.1| YqeL [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305675217|ref|YP_003866889.1| hypothetical protein BSUW23_12710 [Bacillus subtilis subsp. spizizenii str. W23] gi|296149477|gb|EFG90373.1| YqeL [Bacillus subtilis subsp. spizizenii ATCC 6633] gi|305413461|gb|ADM38580.1| conserved hypothetical protein [Bacillus subtilis subsp. spizizenii str. W23] Length = 118 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S + + +AEDI ++ SL+ D +I G S K V +IA + ++ Sbjct: 4 KSILKIAAAACDDKRAEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQAEEN 62 Query: 77 N 77 + Sbjct: 63 D 63 >gi|269926858|ref|YP_003323481.1| iojap-like protein [Thermobaculum terrenum ATCC BAA-798] gi|269790518|gb|ACZ42659.1| iojap-like protein [Thermobaculum terrenum ATCC BAA-798] Length = 122 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A T ++ +++ E KA DI ++ S+I D VI SG S + + +++ Sbjct: 4 ADSTQIQPETLARELVDVASERKASDIVLLDLR-GVSIIADFFVICSGSSERQINALSQA 62 Query: 69 LISYLKK 75 L+ + Sbjct: 63 LVERADE 69 >gi|323142857|ref|ZP_08077569.1| iojap-like protein [Succinatimonas hippei YIT 12066] gi|322417399|gb|EFY08021.1| iojap-like protein [Succinatimonas hippei YIT 12066] Length = 123 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 23/63 (36%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + L+ KA DI I+ S I D M+I +G S +HV +IAD L+ YL Sbjct: 10 DTTAKLQEAAIRSLESSKALDIIAIDVKEH-SSITDTMLICTGTSNRHVCAIADRLVDYL 68 Query: 74 KKK 76 K Sbjct: 69 AKH 71 >gi|125623116|ref|YP_001031599.1| hypothetical protein llmg_0239 [Lactococcus lactis subsp. cremoris MG1363] gi|124491924|emb|CAL96845.1| conserved hypothetical protein [Lactococcus lactis subsp. cremoris MG1363] gi|300069863|gb|ADJ59263.1| iojap-like protein [Lactococcus lactis subsp. cremoris NZ9000] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + V++ + KA DI ++ + + + D VI+ +++ + +IADN+ Sbjct: 2 DSKKLLEVVVKAADDKKALDIVALDMSD-VTFVADYFVIMEAMNSRQLDAIADNI 55 >gi|22298765|ref|NP_682012.1| hypothetical protein tlr1222 [Thermosynechococcus elongatus BP-1] gi|22294946|dbj|BAC08774.1| tlr1222 [Thermosynechococcus elongatus BP-1] Length = 139 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 17/75 (22%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + ++ A T L T + K DIC ++ S S + D VI++G S Sbjct: 10 IQQMQRVAAITDPSL-KLAWTAAYAADDRKGVDICLLDV-SGVSYLSDYFVIITGLSKTQ 67 Query: 62 VASIADNLISYLKKK 76 V +I + + Sbjct: 68 VRAIYQGIEEAALEH 82 >gi|224538107|ref|ZP_03678646.1| hypothetical protein BACCELL_02997 [Bacteroides cellulosilyticus DSM 14838] gi|224520285|gb|EEF89390.1| hypothetical protein BACCELL_02997 [Bacteroides cellulosilyticus DSM 14838] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K ++I + + + IC+ +VI G S V +I +++ + Sbjct: 1 MNESKKLIQQITEGIQDKKGKNIVIADLSKIGDTICNYLVICQGNSPSQVTAIVESVKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|77920170|ref|YP_357985.1| Iojap-like protein [Pelobacter carbinolicus DSM 2380] gi|77546253|gb|ABA89815.1| Iojap-related protein [Pelobacter carbinolicus DSM 2380] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + KA D+ ++ T +S + D ++IVSG S + V +IA+++ +K Sbjct: 2 QAKQQALLCASYALDKKAFDVRLLDVT-GKSSLTDFLLIVSGGSDRQVGAIAESIELGMK 60 Query: 75 KKN 77 K++ Sbjct: 61 KEH 63 >gi|29349416|ref|NP_812919.1| hypothetical protein BT_4008 [Bacteroides thetaiotaomicron VPI-5482] gi|253570233|ref|ZP_04847642.1| conserved hypothetical protein [Bacteroides sp. 1_1_6] gi|29341325|gb|AAO79113.1| conserved hypothetical protein [Bacteroides thetaiotaomicron VPI-5482] gi|251840614|gb|EES68696.1| conserved hypothetical protein [Bacteroides sp. 1_1_6] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K ++I + TS+ IC VI G S V +I D++ + Sbjct: 1 MNDTKILIEKIKEGIQEKKGKNIIIADLTSIEDTICKYFVICQGNSPSQVNAIVDSVKEF 60 Query: 73 LKK 75 +K Sbjct: 61 ARK 63 >gi|281490716|ref|YP_003352696.1| hypothetical protein LLKF_0222 [Lactococcus lactis subsp. lactis KF147] gi|281374485|gb|ADA64006.1| Hypothetical protein LLKF_0222 [Lactococcus lactis subsp. lactis KF147] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + V++ + KA DI ++ + + + D VI+ +++ + +IADN+ Sbjct: 2 DSKKLLEVVVKAADDKKALDIVALDMSK-VTFVADYFVIMEAMNSRQLDAIADNI 55 >gi|296127409|ref|YP_003634661.1| iojap-like protein [Brachyspira murdochii DSM 12563] gi|296019225|gb|ADG72462.1| iojap-like protein [Brachyspira murdochii DSM 12563] Length = 148 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 9/63 (14%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + L + K E+I ++ + + D ++ + S+ + + +D + L Sbjct: 35 EKAKELTLKAAKALDDKKLENITILDL-DGVTTLSDYFLLATASSSPQMKAGSDAVYKEL 93 Query: 74 KKK 76 K++ Sbjct: 94 KEE 96 >gi|167625144|ref|YP_001675438.1| iojap-like protein [Shewanella halifaxensis HAW-EB4] gi|167355166|gb|ABZ77779.1| iojap-like protein [Shewanella halifaxensis HAW-EB4] Length = 109 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ +++LKA+DI ++ + +S I D MV+ +G S HV +IA+NL+ K Sbjct: 2 ESAELKQFVIDKVEDLKAKDIVVMDISE-KSNIADFMVVCTGNSKTHVKAIAENLVVEAK 60 Query: 75 K 75 + Sbjct: 61 R 61 >gi|261495130|ref|ZP_05991594.1| hypothetical protein COI_0914 [Mannheimia haemolytica serotype A2 str. OVINE] gi|261309200|gb|EEY10439.1| hypothetical protein COI_0914 [Mannheimia haemolytica serotype A2 str. OVINE] Length = 104 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M++ +G S++HVAS A+ LI+ K+ Sbjct: 3 QNLVEFLTKTLDDLKAQDILAIDV-KGKSSITDTMILATGTSSRHVASTAERLITEAKQ 60 >gi|71082931|ref|YP_265650.1| iojap-related protein [Candidatus Pelagibacter ubique HTCC1062] gi|91762645|ref|ZP_01264610.1| iojap-related protein [Candidatus Pelagibacter ubique HTCC1002] gi|71062044|gb|AAZ21047.1| iojap-related protein [Candidatus Pelagibacter ubique HTCC1062] gi|91718447|gb|EAS85097.1| iojap-related protein [Candidatus Pelagibacter ubique HTCC1002] Length = 116 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +++ L KA DI I+ + +S + D M+I SG S++H+ ++++ ++ Sbjct: 1 MEKNIDLKDLILKTLDSNKALDIISIDLKN-KSSMADYMIIASGTSSRHIQALSEMVLEK 59 Query: 73 LK 74 LK Sbjct: 60 LK 61 >gi|88855086|ref|ZP_01129751.1| hypothetical protein A20C1_04371 [marine actinobacterium PHSC20C1] gi|88815614|gb|EAR25471.1| hypothetical protein A20C1_04371 [marine actinobacterium PHSC20C1] Length = 129 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + ++ V +A D+ ++ T + D + +GR+ ++V SIA + Sbjct: 1 MTASPRANELLSIVAHAADAKQATDMVALDVT-GPTPYTDIFFLATGRNERNVQSIASEI 59 Query: 70 ISYL 73 + Sbjct: 60 EEKM 63 >gi|332307124|ref|YP_004434975.1| iojap-like protein [Glaciecola agarilytica 4H-3-7+YE-5] gi|332174453|gb|AEE23707.1| iojap-like protein [Glaciecola agarilytica 4H-3-7+YE-5] Length = 105 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A V+E +++LK DI ++ + +S + + M+I SG S +HV SIA+N++ K Sbjct: 2 DHQQLKAFVVEKIEDLKGRDIIDLDVSE-KSSVTETMLICSGNSKRHVVSIAENVVVEAK 60 Query: 75 K 75 + Sbjct: 61 Q 61 >gi|255659772|ref|ZP_05405181.1| iojap-like protein [Mitsuokella multacida DSM 20544] gi|260847842|gb|EEX67849.1| iojap-like protein [Mitsuokella multacida DSM 20544] Length = 114 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + KA DI ++ L D VI S + V +IADN+ L K Sbjct: 4 QEMCKAICKAASDKKARDIVMMDMQGLMISP-DYFVICSANTATQVRAIADNIEEELAK 61 >gi|225572148|ref|ZP_03781012.1| hypothetical protein RUMHYD_00442 [Blautia hydrogenotrophica DSM 10507] gi|225040320|gb|EEG50566.1| hypothetical protein RUMHYD_00442 [Blautia hydrogenotrophica DSM 10507] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 T + L E KA D+ I+ S I D VI SG + V ++ DN+ L K Sbjct: 5 KEMARTACKALDEKKALDLKIIDIAE-VSTIADYFVIASGSNQNQVQAMVDNVEEKLAK 62 >gi|333029843|ref|ZP_08457904.1| iojap-like protein [Bacteroides coprosuis DSM 18011] gi|332740440|gb|EGJ70922.1| iojap-like protein [Bacteroides coprosuis DSM 18011] Length = 121 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 33/62 (53%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + ++E +++ K + + + TS+ I + +I G S V+SIA+N+ +K Sbjct: 5 NTEFLLNQIVESIQDKKGKKVVVADLTSIEDTITNYFIICEGYSPNQVSSIANNVKEEVK 64 Query: 75 KK 76 + Sbjct: 65 EN 66 >gi|261493864|ref|ZP_05990376.1| hypothetical protein COK_2266 [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261310466|gb|EEY11657.1| hypothetical protein COK_2266 [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 104 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M++ +G S++HVAS A+ LI+ K+ Sbjct: 3 QNLVEFLTKTLDDLKAQDILAIDV-KGKSSITDTMILATGTSSRHVASTAERLITEAKQ 60 >gi|90416215|ref|ZP_01224147.1| hypothetical protein GB2207_11073 [marine gamma proteobacterium HTCC2207] gi|90331940|gb|EAS47154.1| hypothetical protein GB2207_11073 [marine gamma proteobacterium HTCC2207] Length = 125 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S V+ L+E+KA++I ++ + + D+M++ SG S + V S+A N+ KK Sbjct: 2 SQSLKDVVIAALEEVKAQNIIALDVRD-LTGVMDHMIVASGNSNRQVKSLASNVAVEGKK 60 >gi|239832928|ref|ZP_04681257.1| iojap-related protein [Ochrobactrum intermedium LMG 3301] gi|239825195|gb|EEQ96763.1| iojap-related protein [Ochrobactrum intermedium LMG 3301] Length = 157 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ + + L+ KAE I I+ RS I D M++ SGRS +HV ++AD+L Sbjct: 35 MDESNLVSQTFDAALASLENSKAESIIPIDIR-GRSTIGDFMIVASGRSHRHVTAVADHL 93 Query: 70 ISYLKK 75 + L++ Sbjct: 94 LQALRE 99 >gi|158520109|ref|YP_001527979.1| iojap-like protein [Desulfococcus oleovorans Hxd3] gi|158508935|gb|ABW65902.1| iojap-like protein [Desulfococcus oleovorans Hxd3] Length = 114 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I + + +KAE++ ++ + + I D ++ GRS + V++I+D+++ LK Sbjct: 4 SSKTEIEPYLTAINGMKAENVVALDVSR-LTSIADVFILCEGRSNRQVSAISDHIVKALK 62 Query: 75 KK 76 + Sbjct: 63 DQ 64 >gi|15903631|ref|NP_359181.1| iojap-related protein [Streptococcus pneumoniae R6] gi|116515553|ref|YP_817007.1| iojap-related protein [Streptococcus pneumoniae D39] gi|148984187|ref|ZP_01817482.1| iojap-related protein [Streptococcus pneumoniae SP3-BS71] gi|148989406|ref|ZP_01820774.1| iojap-related protein [Streptococcus pneumoniae SP6-BS73] gi|148994929|ref|ZP_01823931.1| iojap-related protein [Streptococcus pneumoniae SP9-BS68] gi|148997800|ref|ZP_01825364.1| iojap-related protein [Streptococcus pneumoniae SP11-BS70] gi|149002050|ref|ZP_01827004.1| iojap-related protein [Streptococcus pneumoniae SP14-BS69] gi|149006588|ref|ZP_01830287.1| iojap-related protein [Streptococcus pneumoniae SP18-BS74] gi|149011386|ref|ZP_01832633.1| iojap-related protein [Streptococcus pneumoniae SP19-BS75] gi|149020827|ref|ZP_01835356.1| iojap-related protein [Streptococcus pneumoniae SP23-BS72] gi|168483283|ref|ZP_02708235.1| putative iojap homolog [Streptococcus pneumoniae CDC1873-00] gi|168486395|ref|ZP_02710903.1| putative iojap homolog [Streptococcus pneumoniae CDC1087-00] gi|168488536|ref|ZP_02712735.1| putative iojap homolog [Streptococcus pneumoniae SP195] gi|168491373|ref|ZP_02715516.1| putative iojap homolog [Streptococcus pneumoniae CDC0288-04] gi|168493653|ref|ZP_02717796.1| putative iojap homolog [Streptococcus pneumoniae CDC3059-06] gi|168575064|ref|ZP_02721027.1| putative iojap homolog [Streptococcus pneumoniae MLV-016] gi|169832521|ref|YP_001695119.1| putative iojap-like protein [Streptococcus pneumoniae Hungary19A-6] gi|182684688|ref|YP_001836435.1| iojap-related protein [Streptococcus pneumoniae CGSP14] gi|194397957|ref|YP_002038354.1| hypothetical protein SPG_1649 [Streptococcus pneumoniae G54] gi|221232479|ref|YP_002511632.1| hypothetical protein SPN23F_17510 [Streptococcus pneumoniae ATCC 700669] gi|225855175|ref|YP_002736687.1| putative iojap homolog [Streptococcus pneumoniae JJA] gi|225859496|ref|YP_002741006.1| putative iojap homolog [Streptococcus pneumoniae 70585] gi|225861566|ref|YP_002743075.1| putative iojap homolog [Streptococcus pneumoniae Taiwan19F-14] gi|237649156|ref|ZP_04523408.1| hypothetical protein SpneC1_00120 [Streptococcus pneumoniae CCRI 1974] gi|237820728|ref|ZP_04596573.1| hypothetical protein SpneC19_00080 [Streptococcus pneumoniae CCRI 1974M2] gi|298230648|ref|ZP_06964329.1| hypothetical protein SpneCMD_08246 [Streptococcus pneumoniae str. Canada MDR_19F] gi|298254892|ref|ZP_06978478.1| hypothetical protein SpneCM_04677 [Streptococcus pneumoniae str. Canada MDR_19A] gi|298503489|ref|YP_003725429.1| iojap superfamily protein [Streptococcus pneumoniae TCH8431/19A] gi|303254356|ref|ZP_07340464.1| hypothetical protein CGSSpBS455_02709 [Streptococcus pneumoniae BS455] gi|303258681|ref|ZP_07344661.1| iojap-related protein [Streptococcus pneumoniae SP-BS293] gi|303261844|ref|ZP_07347790.1| iojap-related protein [Streptococcus pneumoniae SP14-BS292] gi|303263707|ref|ZP_07349629.1| iojap-related protein [Streptococcus pneumoniae BS397] gi|303266647|ref|ZP_07352531.1| iojap-related protein [Streptococcus pneumoniae BS457] gi|303268537|ref|ZP_07354330.1| iojap-related protein [Streptococcus pneumoniae BS458] gi|307068370|ref|YP_003877336.1| plant Iojap-like protein [Streptococcus pneumoniae AP200] gi|307127958|ref|YP_003879989.1| putative iojap protein [Streptococcus pneumoniae 670-6B] gi|15459256|gb|AAL00392.1| Conserved hypothetical protein [Streptococcus pneumoniae R6] gi|116076129|gb|ABJ53849.1| iojap-related protein [Streptococcus pneumoniae D39] gi|147756299|gb|EDK63341.1| iojap-related protein [Streptococcus pneumoniae SP11-BS70] gi|147759859|gb|EDK66849.1| iojap-related protein [Streptococcus pneumoniae SP14-BS69] gi|147761886|gb|EDK68849.1| iojap-related protein [Streptococcus pneumoniae SP18-BS74] gi|147764376|gb|EDK71307.1| iojap-related protein [Streptococcus pneumoniae SP19-BS75] gi|147923476|gb|EDK74589.1| iojap-related protein [Streptococcus pneumoniae SP3-BS71] gi|147925156|gb|EDK76236.1| iojap-related protein [Streptococcus pneumoniae SP6-BS73] gi|147926931|gb|EDK77977.1| iojap-related protein [Streptococcus pneumoniae SP9-BS68] gi|147930468|gb|EDK81451.1| iojap-related protein [Streptococcus pneumoniae SP23-BS72] gi|168995023|gb|ACA35635.1| putative iojap homolog [Streptococcus pneumoniae Hungary19A-6] gi|172043213|gb|EDT51259.1| putative iojap homolog [Streptococcus pneumoniae CDC1873-00] gi|182630022|gb|ACB90970.1| iojap-related protein [Streptococcus pneumoniae CGSP14] gi|183570551|gb|EDT91079.1| putative iojap homolog [Streptococcus pneumoniae CDC1087-00] gi|183572839|gb|EDT93367.1| putative iojap homolog [Streptococcus pneumoniae SP195] gi|183574168|gb|EDT94696.1| putative iojap homolog [Streptococcus pneumoniae CDC0288-04] gi|183576446|gb|EDT96974.1| putative iojap homolog [Streptococcus pneumoniae CDC3059-06] gi|183578785|gb|EDT99313.1| putative iojap homolog [Streptococcus pneumoniae MLV-016] gi|194357624|gb|ACF56072.1| conserved hypothetical protein [Streptococcus pneumoniae G54] gi|220674940|emb|CAR69517.1| conserved hypothetical protein [Streptococcus pneumoniae ATCC 700669] gi|225721940|gb|ACO17794.1| putative iojap homolog [Streptococcus pneumoniae 70585] gi|225723708|gb|ACO19561.1| putative iojap homolog [Streptococcus pneumoniae JJA] gi|225727380|gb|ACO23231.1| putative iojap homolog [Streptococcus pneumoniae Taiwan19F-14] gi|298239084|gb|ADI70215.1| iojap superfamily protein [Streptococcus pneumoniae TCH8431/19A] gi|301794717|emb|CBW37168.1| conserved hypothetical protein [Streptococcus pneumoniae INV104] gi|301800547|emb|CBW33187.1| conserved hypothetical protein [Streptococcus pneumoniae OXC141] gi|301802444|emb|CBW35200.1| conserved hypothetical protein [Streptococcus pneumoniae INV200] gi|302598707|gb|EFL65745.1| hypothetical protein CGSSpBS455_02709 [Streptococcus pneumoniae BS455] gi|302636927|gb|EFL67416.1| iojap-related protein [Streptococcus pneumoniae SP14-BS292] gi|302640182|gb|EFL70637.1| iojap-related protein [Streptococcus pneumoniae SP-BS293] gi|302641932|gb|EFL72286.1| iojap-related protein [Streptococcus pneumoniae BS458] gi|302643809|gb|EFL74072.1| iojap-related protein [Streptococcus pneumoniae BS457] gi|302646745|gb|EFL76970.1| iojap-related protein [Streptococcus pneumoniae BS397] gi|306409907|gb|ADM85334.1| plant Iojap-like protein [Streptococcus pneumoniae AP200] gi|306485020|gb|ADM91889.1| putative iojap protein [Streptococcus pneumoniae 670-6B] gi|327389928|gb|EGE88273.1| hypothetical protein SPAR5_1619 [Streptococcus pneumoniae GA04375] gi|332072576|gb|EGI83059.1| hypothetical protein SPAR50_1747 [Streptococcus pneumoniae GA17570] gi|332072917|gb|EGI83398.1| hypothetical protein SPAR148_1678 [Streptococcus pneumoniae GA17545] gi|332074084|gb|EGI84562.1| hypothetical protein SPAR68_1757 [Streptococcus pneumoniae GA41301] gi|332199770|gb|EGJ13845.1| hypothetical protein SPAR69_1681 [Streptococcus pneumoniae GA41317] gi|332200306|gb|EGJ14379.1| hypothetical protein SPAR93_1783 [Streptococcus pneumoniae GA47368] gi|332201167|gb|EGJ15238.1| hypothetical protein SPAR120_1673 [Streptococcus pneumoniae GA47901] Length = 117 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IA N+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIAANIREKVAQ 61 >gi|157962964|ref|YP_001502998.1| iojap-like protein [Shewanella pealeana ATCC 700345] gi|157847964|gb|ABV88463.1| iojap-like protein [Shewanella pealeana ATCC 700345] Length = 109 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ +++LKA+DI ++ + +S I D MV+ +G S HV +IA+NL+ K Sbjct: 2 ESAELKQFVIDKVEDLKAKDIVVMDVSE-KSNIADFMVVCTGNSKTHVKAIAENLVVESK 60 Query: 75 K 75 + Sbjct: 61 R 61 >gi|134093812|ref|YP_001098887.1| hypothetical protein HEAR0554 [Herminiimonas arsenicoxydans] gi|133737715|emb|CAL60760.1| Conserved hypothetical protein [Herminiimonas arsenicoxydans] Length = 218 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + A V++ L+++KA+DI + + + D + + SG S + ++A ++ +K Sbjct: 2 DIKKLQALVIDALEDVKAQDIKVFDTVH-LTSLFDRIAVASGTSNRQTKALAASVRDKVK 60 >gi|282848915|ref|ZP_06258305.1| iojap-like protein [Veillonella parvula ATCC 17745] gi|282581420|gb|EFB86813.1| iojap-like protein [Veillonella parvula ATCC 17745] Length = 120 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + + K DI ++ S++ D +IVS ++K SIAD + Sbjct: 1 MKKKEDIKQIVLELAQAAFDKKGRDIEILDL-EGISMLGDYFLIVSANNSKQSQSIADEM 59 Query: 70 ISYLKK 75 + Sbjct: 60 EDKAAE 65 >gi|325982224|ref|YP_004294626.1| iojap-like protein [Nitrosomonas sp. AL212] gi|325531743|gb|ADZ26464.1| iojap-like protein [Nitrosomonas sp. AL212] Length = 108 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 36/60 (60%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + I +++ L+E+KA DI I T + + + ++++I S ST+ S+A+N+ +K Sbjct: 2 NSEKLITVIIDALEEIKAHDIDVINVTKI-TSMFEHIIIASADSTRQTKSLANNVQEKVK 60 >gi|255690422|ref|ZP_05414097.1| iojap-like protein [Bacteroides finegoldii DSM 17565] gi|260624041|gb|EEX46912.1| iojap-like protein [Bacteroides finegoldii DSM 17565] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 29/63 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K ++I + T + IC VI G S V++I D++ Sbjct: 1 MNDTKVLIEKIKEGIQEKKGKNIVIADLTKIEDTICKYFVICQGNSPSQVSAIVDSIKES 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|160891208|ref|ZP_02072211.1| hypothetical protein BACUNI_03656 [Bacteroides uniformis ATCC 8492] gi|270294491|ref|ZP_06200693.1| iojap protein 155 [Bacteroides sp. D20] gi|317481094|ref|ZP_07940173.1| hypothetical protein HMPREF1007_03292 [Bacteroides sp. 4_1_36] gi|156859429|gb|EDO52860.1| hypothetical protein BACUNI_03656 [Bacteroides uniformis ATCC 8492] gi|270275958|gb|EFA21818.1| iojap protein 155 [Bacteroides sp. D20] gi|316902807|gb|EFV24682.1| hypothetical protein HMPREF1007_03292 [Bacteroides sp. 4_1_36] Length = 119 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K + I + T + IC+ VI G S V +I +++ + Sbjct: 1 MNETKKLIQQITEGIQDKKGKKIVIADLTKIDDTICNYFVICQGNSPSQVTAIVESIRDF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|332977420|gb|EGK14197.1| Iojap family protein [Psychrobacter sp. 1501(2011)] Length = 134 Score = 62.4 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M + ++ + + L C+ E L +LKA +I + + + + D MVI G S + Sbjct: 1 MTIDANQRTPMSDERLQFCLEMAQEALDDLKARNISVLHVSE-LTDVMDYMVIAEGTSKR 59 Query: 61 HVASIADNLISYLKK 75 HV+++AD + + KK Sbjct: 60 HVSALADQVGAIAKK 74 >gi|15924582|ref|NP_372116.1| iojap family protein [Staphylococcus aureus subsp. aureus Mu50] gi|15927172|ref|NP_374705.1| hypothetical protein SA1420 [Staphylococcus aureus subsp. aureus N315] gi|49483839|ref|YP_041063.1| hypothetical protein SAR1669 [Staphylococcus aureus subsp. aureus MRSA252] gi|82751194|ref|YP_416935.1| hypothetical protein SAB1464c [Staphylococcus aureus RF122] gi|148268075|ref|YP_001247018.1| hypothetical protein SaurJH9_1649 [Staphylococcus aureus subsp. aureus JH9] gi|150394144|ref|YP_001316819.1| hypothetical protein SaurJH1_1684 [Staphylococcus aureus subsp. aureus JH1] gi|156979910|ref|YP_001442169.1| hypothetical protein SAHV_1579 [Staphylococcus aureus subsp. aureus Mu3] gi|253315371|ref|ZP_04838584.1| hypothetical protein SauraC_04312 [Staphylococcus aureus subsp. aureus str. CF-Marseille] gi|253732245|ref|ZP_04866410.1| iojap family protein [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|255006377|ref|ZP_05144978.2| hypothetical protein SauraM_07910 [Staphylococcus aureus subsp. aureus Mu50-omega] gi|257425716|ref|ZP_05602140.1| iojap family protein [Staphylococcus aureus subsp. aureus 55/2053] gi|257428377|ref|ZP_05604775.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 65-1322] gi|257431014|ref|ZP_05607394.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 68-397] gi|257433702|ref|ZP_05610060.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus E1410] gi|257436616|ref|ZP_05612660.1| iojap protein 155 [Staphylococcus aureus subsp. aureus M876] gi|257793668|ref|ZP_05642647.1| iojap protein [Staphylococcus aureus A9781] gi|258411033|ref|ZP_05681313.1| conserved hypothetical protein [Staphylococcus aureus A9763] gi|258420164|ref|ZP_05683119.1| iojap protein 155 [Staphylococcus aureus A9719] gi|258424019|ref|ZP_05686901.1| iojap protein 155 [Staphylococcus aureus A9635] gi|258437423|ref|ZP_05689407.1| conserved hypothetical protein [Staphylococcus aureus A9299] gi|258443629|ref|ZP_05691968.1| conserved hypothetical protein [Staphylococcus aureus A8115] gi|258446837|ref|ZP_05694991.1| iojap family protein [Staphylococcus aureus A6300] gi|258448751|ref|ZP_05696863.1| iojap family protein [Staphylococcus aureus A6224] gi|258453568|ref|ZP_05701546.1| iojap family protein [Staphylococcus aureus A5937] gi|269203219|ref|YP_003282488.1| hypothetical protein SAAV_1583 [Staphylococcus aureus subsp. aureus ED98] gi|282893093|ref|ZP_06301327.1| conserved hypothetical protein [Staphylococcus aureus A8117] gi|282904173|ref|ZP_06312061.1| iojap-like protein [Staphylococcus aureus subsp. aureus C160] gi|282906000|ref|ZP_06313855.1| iojap protein 155 [Staphylococcus aureus subsp. aureus Btn1260] gi|282908911|ref|ZP_06316729.1| iojap family protein [Staphylococcus aureus subsp. aureus WW2703/97] gi|282911229|ref|ZP_06319031.1| iojap family protein [Staphylococcus aureus subsp. aureus WBG10049] gi|282914398|ref|ZP_06322184.1| iojap-related protein [Staphylococcus aureus subsp. aureus M899] gi|282916862|ref|ZP_06324620.1| iojap protein 155 [Staphylococcus aureus subsp. aureus D139] gi|282919367|ref|ZP_06327102.1| iojap protein [Staphylococcus aureus subsp. aureus C427] gi|282924692|ref|ZP_06332360.1| iojap protein [Staphylococcus aureus subsp. aureus C101] gi|282928225|ref|ZP_06335830.1| conserved hypothetical protein [Staphylococcus aureus A10102] gi|283770667|ref|ZP_06343559.1| iojap family protein [Staphylococcus aureus subsp. aureus H19] gi|283958355|ref|ZP_06375806.1| iojap-like protein [Staphylococcus aureus subsp. aureus A017934/97] gi|293503472|ref|ZP_06667319.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 58-424] gi|293510489|ref|ZP_06669195.1| iojap protein 155 [Staphylococcus aureus subsp. aureus M809] gi|293531029|ref|ZP_06671711.1| iojap-related protein [Staphylococcus aureus subsp. aureus M1015] gi|295406715|ref|ZP_06816520.1| iojap protein [Staphylococcus aureus A8819] gi|295428169|ref|ZP_06820801.1| iojap protein [Staphylococcus aureus subsp. aureus EMRSA16] gi|296276604|ref|ZP_06859111.1| iojap homolog [Staphylococcus aureus subsp. aureus MR1] gi|297245703|ref|ZP_06929568.1| iojap protein [Staphylococcus aureus A8796] gi|297590865|ref|ZP_06949503.1| iojap-like protein [Staphylococcus aureus subsp. aureus MN8] gi|13701390|dbj|BAB42684.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus N315] gi|14247363|dbj|BAB57754.1| similar to homolog of plant Iojap proteins [Staphylococcus aureus subsp. aureus Mu50] gi|49241968|emb|CAG40663.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MRSA252] gi|82656725|emb|CAI81153.1| conserved hypothetical protein [Staphylococcus aureus RF122] gi|147741144|gb|ABQ49442.1| iojap-like protein [Staphylococcus aureus subsp. aureus JH9] gi|149946596|gb|ABR52532.1| iojap-like protein [Staphylococcus aureus subsp. aureus JH1] gi|156722045|dbj|BAF78462.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus Mu3] gi|253724034|gb|EES92763.1| iojap family protein [Staphylococcus aureus subsp. aureus USA300_TCH959] gi|257271410|gb|EEV03556.1| iojap family protein [Staphylococcus aureus subsp. aureus 55/2053] gi|257275218|gb|EEV06705.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 65-1322] gi|257278444|gb|EEV09080.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 68-397] gi|257281795|gb|EEV11932.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus E1410] gi|257283967|gb|EEV14090.1| iojap protein 155 [Staphylococcus aureus subsp. aureus M876] gi|257787640|gb|EEV25980.1| iojap protein [Staphylococcus aureus A9781] gi|257840183|gb|EEV64647.1| conserved hypothetical protein [Staphylococcus aureus A9763] gi|257843875|gb|EEV68269.1| iojap protein 155 [Staphylococcus aureus A9719] gi|257845640|gb|EEV69672.1| iojap protein 155 [Staphylococcus aureus A9635] gi|257848628|gb|EEV72616.1| conserved hypothetical protein [Staphylococcus aureus A9299] gi|257851035|gb|EEV74978.1| conserved hypothetical protein [Staphylococcus aureus A8115] gi|257854412|gb|EEV77361.1| iojap family protein [Staphylococcus aureus A6300] gi|257858029|gb|EEV80918.1| iojap family protein [Staphylococcus aureus A6224] gi|257864299|gb|EEV87049.1| iojap family protein [Staphylococcus aureus A5937] gi|262075509|gb|ACY11482.1| hypothetical protein SAAV_1583 [Staphylococcus aureus subsp. aureus ED98] gi|282313527|gb|EFB43922.1| iojap protein [Staphylococcus aureus subsp. aureus C101] gi|282317177|gb|EFB47551.1| iojap protein [Staphylococcus aureus subsp. aureus C427] gi|282319349|gb|EFB49701.1| iojap protein 155 [Staphylococcus aureus subsp. aureus D139] gi|282321579|gb|EFB51904.1| iojap-related protein [Staphylococcus aureus subsp. aureus M899] gi|282324924|gb|EFB55234.1| iojap family protein [Staphylococcus aureus subsp. aureus WBG10049] gi|282327175|gb|EFB57470.1| iojap family protein [Staphylococcus aureus subsp. aureus WW2703/97] gi|282331292|gb|EFB60806.1| iojap protein 155 [Staphylococcus aureus subsp. aureus Btn1260] gi|282590032|gb|EFB95114.1| conserved hypothetical protein [Staphylococcus aureus A10102] gi|282595791|gb|EFC00755.1| iojap-like protein [Staphylococcus aureus subsp. aureus C160] gi|282764411|gb|EFC04537.1| conserved hypothetical protein [Staphylococcus aureus A8117] gi|283460814|gb|EFC07904.1| iojap family protein [Staphylococcus aureus subsp. aureus H19] gi|283470870|emb|CAQ50081.1| putative iojap homolog [Staphylococcus aureus subsp. aureus ST398] gi|283790504|gb|EFC29321.1| iojap-like protein [Staphylococcus aureus subsp. aureus A017934/97] gi|285817274|gb|ADC37761.1| Iojap-related protein [Staphylococcus aureus 04-02981] gi|290920297|gb|EFD97363.1| iojap-related protein [Staphylococcus aureus subsp. aureus M1015] gi|291095138|gb|EFE25403.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus 58-424] gi|291466853|gb|EFF09373.1| iojap protein 155 [Staphylococcus aureus subsp. aureus M809] gi|294968462|gb|EFG44486.1| iojap protein [Staphylococcus aureus A8819] gi|295128527|gb|EFG58161.1| iojap protein [Staphylococcus aureus subsp. aureus EMRSA16] gi|297177354|gb|EFH36606.1| iojap protein [Staphylococcus aureus A8796] gi|297575751|gb|EFH94467.1| iojap-like protein [Staphylococcus aureus subsp. aureus MN8] gi|298694873|gb|ADI98095.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus ED133] gi|302333268|gb|ADL23461.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus JKD6159] gi|312437940|gb|ADQ77011.1| iojap-like protein [Staphylococcus aureus subsp. aureus TCH60] gi|312829979|emb|CBX34821.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus ECT-R 2] gi|315129870|gb|EFT85860.1| hypothetical protein CGSSa03_02253 [Staphylococcus aureus subsp. aureus CGS03] gi|315195494|gb|EFU25881.1| hypothetical protein CGSSa00_07485 [Staphylococcus aureus subsp. aureus CGS00] gi|323438557|gb|EGA96304.1| hypothetical protein SAO11_2600 [Staphylococcus aureus O11] gi|323442796|gb|EGB00421.1| hypothetical protein SAO46_1233 [Staphylococcus aureus O46] gi|329727163|gb|EGG63619.1| iojap-like protein [Staphylococcus aureus subsp. aureus 21172] gi|329733152|gb|EGG69489.1| iojap-like protein [Staphylococcus aureus subsp. aureus 21193] Length = 117 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +A ++ + K ED +E S + D V+ G + + V +IA + Sbjct: 2 NSQELLAIAVDAIDNKKGEDTISLEM-KGISDMTDYFVVTHGNNERQVQAIARAVKEVAN 60 Query: 75 KKN 77 ++N Sbjct: 61 EQN 63 >gi|300870035|ref|YP_003784906.1| hypothetical protein BP951000_0402 [Brachyspira pilosicoli 95/1000] gi|300687734|gb|ADK30405.1| conserved hypothetical protein [Brachyspira pilosicoli 95/1000] Length = 132 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 12/71 (16%), Positives = 30/71 (42%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + + + + S + L + K EDI ++ + + D +I + S + + Sbjct: 11 KTKKMIDREMAKSLTLKAAKALDDKKLEDIVILDL-DGVTTLSDFFIIATASSAPQMKAG 69 Query: 66 ADNLISYLKKK 76 +D + LK++ Sbjct: 70 SDAVYKELKEE 80 >gi|311069165|ref|YP_003974088.1| YqeL protein [Bacillus atrophaeus 1942] gi|310869682|gb|ADP33157.1| YqeL [Bacillus atrophaeus 1942] Length = 118 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S + + +AEDI ++ SL+ D +I G S K V +IA + ++ Sbjct: 5 SILKIAATACDDKRAEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQAEEN 62 >gi|109897883|ref|YP_661138.1| iojap-like protein [Pseudoalteromonas atlantica T6c] gi|109700164|gb|ABG40084.1| iojap-like protein [Pseudoalteromonas atlantica T6c] Length = 105 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 A V+E +++LK DI ++ + +S + + M+I SG S +HV SIA+N++ K Sbjct: 2 DHQQLKAFVVEKIEDLKGRDIIDLDVSE-KSSVTETMLICSGNSKRHVVSIAENVVVEAK 60 Query: 75 K 75 + Sbjct: 61 Q 61 >gi|319942482|ref|ZP_08016793.1| iojap domain-containing protein [Sutterella wadsworthensis 3_1_45B] gi|319803955|gb|EFW00871.1| iojap domain-containing protein [Sutterella wadsworthensis 3_1_45B] Length = 134 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L++ T++ L+++KA DI T + + +VI SG S + ++A + +K Sbjct: 2 ELETLTQTIINALEDVKARDIKVFN-TEELTDQFECVVIASGTSGRQTRALAYAVSHAVK 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|218781962|ref|YP_002433280.1| iojap-like protein [Desulfatibacillum alkenivorans AK-01] gi|218763346|gb|ACL05812.1| iojap-like protein [Desulfatibacillum alkenivorans AK-01] Length = 126 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 L +A + L + KA + ++ S + D MVI SG S + A++A+++ ++ Sbjct: 3 KDLPQELAPFFDALGQRKARGLVGLDVR-GISSVADFMVICSGLSNRQAAAMAEHVERHM 61 Query: 74 KKK 76 KK+ Sbjct: 62 KKR 64 >gi|90961480|ref|YP_535396.1| Iojap-related protein [Lactobacillus salivarius UCC118] gi|90820674|gb|ABD99313.1| Iojap-related protein [Lactobacillus salivarius UCC118] Length = 117 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AED ++ + S++ D VI S + V +IAD + + Sbjct: 2 DSKKLLEIVVKAADSKRAEDTVALDVQEI-SILADYFVITQANSERQVKAIADAVKEQVY 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|329767811|ref|ZP_08259327.1| hypothetical protein HMPREF0428_01024 [Gemella haemolysans M341] gi|328838912|gb|EGF88506.1| hypothetical protein HMPREF0428_01024 [Gemella haemolysans M341] Length = 112 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ + V++ + DI + T ++ D VI S + V +IA + + Sbjct: 2 EVENLLKIVVDACDDKHGYDIVAYDLTQ-AGVLYDYSVICHAPSNRQVEAIAQEVREQVL 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|326798479|ref|YP_004316298.1| iojap-like protein [Sphingobacterium sp. 21] gi|326549243|gb|ADZ77628.1| iojap-like protein [Sphingobacterium sp. 21] Length = 124 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 28/65 (43%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + ++ ++E K +I ++ ++ S + D VI ST V +IA ++ Sbjct: 5 KKVKESTHLSEIIIHGIQEKKGNEIVRLDLQNVHSSVSDYFVICHAESTTQVRAIAKSVE 64 Query: 71 SYLKK 75 + K Sbjct: 65 EEVYK 69 >gi|116511058|ref|YP_808274.1| hypothetical protein LACR_0234 [Lactococcus lactis subsp. cremoris SK11] gi|116106712|gb|ABJ71852.1| Iojap-like protein [Lactococcus lactis subsp. cremoris SK11] Length = 119 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + V++ + KA DI ++ + + + D VI+ +++ + +IADN+ Sbjct: 2 DSKKLLEVVVKAADDKKALDIVALDMSD-VTFVADYFVIMEAMNSRQLDAIADNI 55 >gi|94984239|ref|YP_603603.1| Iojap-related protein [Deinococcus geothermalis DSM 11300] gi|94554520|gb|ABF44434.1| Iojap-related protein [Deinococcus geothermalis DSM 11300] Length = 128 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 +HL + +++ +E +AED+ ++ T + S + + VI + + + ++ +N+ Sbjct: 5 SQNEHLQQQLRAIVDAARERRAEDVVVLDLTDVSSTL-EYFVICTATAGLQLNAVQENIR 63 Query: 71 SYLKK 75 ++ Sbjct: 64 EKAQE 68 >gi|326539560|gb|ADZ87775.1| iojap-related protein [Brucella melitensis M5-90] Length = 117 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + L+ KAE I I+ RS I D M++ SGRS +HV ++ D+L+ L++ Sbjct: 1 MSATFDAALASLENSKAESIIPIDIR-GRSTIGDYMIVASGRSHRHVTAVTDHLVQALRE 59 >gi|148652155|ref|YP_001279248.1| iojap-like protein [Psychrobacter sp. PRwf-1] gi|148571239|gb|ABQ93298.1| iojap-like protein [Psychrobacter sp. PRwf-1] Length = 134 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 1/75 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M + ++ + + L C+ V E L +LKA++I + + + D MVI S + Sbjct: 1 MTLDATQRTPMSDERLQFCLNMVQETLDDLKAKNITVLHVAD-LTDVTDYMVIADATSKR 59 Query: 61 HVASIADNLISYLKK 75 HV+++AD + + KK Sbjct: 60 HVSALADEVGATAKK 74 >gi|198276294|ref|ZP_03208825.1| hypothetical protein BACPLE_02488 [Bacteroides plebeius DSM 17135] gi|198270736|gb|EDY95006.1| hypothetical protein BACPLE_02488 [Bacteroides plebeius DSM 17135] Length = 119 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 31/64 (48%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + I ++E ++E K + I + + IC +I G S V +I D++ + Sbjct: 1 MNETTTLIEKIIEGIQEKKGKQIVVADLNEIEDTICKYFIICQGNSPSQVLAIVDSIKEH 60 Query: 73 LKKK 76 ++K+ Sbjct: 61 VRKE 64 >gi|154500952|ref|ZP_02038990.1| hypothetical protein BACCAP_04638 [Bacteroides capillosus ATCC 29799] gi|150269976|gb|EDM97495.1| hypothetical protein BACCAP_04638 [Bacteroides capillosus ATCC 29799] Length = 120 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + L K DI +E T + + D VI + ST V +++D +K+ Sbjct: 4 KETAIVLAKALDSKKGIDIKVLE-TGHLTTLADYFVICTATSTTQVRALSDECEKTMKE 61 >gi|16079616|ref|NP_390440.1| hypothetical protein BSU25620 [Bacillus subtilis subsp. subtilis str. 168] gi|221310487|ref|ZP_03592334.1| hypothetical protein Bsubs1_14011 [Bacillus subtilis subsp. subtilis str. 168] gi|221314811|ref|ZP_03596616.1| hypothetical protein BsubsN3_13922 [Bacillus subtilis subsp. subtilis str. NCIB 3610] gi|221319733|ref|ZP_03601027.1| hypothetical protein BsubsJ_13848 [Bacillus subtilis subsp. subtilis str. JH642] gi|221324011|ref|ZP_03605305.1| hypothetical protein BsubsS_13977 [Bacillus subtilis subsp. subtilis str. SMY] gi|1730985|sp|P54457|YQEL_BACSU RecName: Full=Uncharacterized protein yqeL gi|1303793|dbj|BAA12449.1| YqeL [Bacillus subtilis] gi|2635008|emb|CAB14504.1| conserved hypothetical protein [Bacillus subtilis subsp. subtilis str. 168] Length = 118 Score = 62.0 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S + + +AEDI ++ SL+ D +I G S K V +IA + + Sbjct: 4 KSILKIAAAACDDKRAEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQADEN 62 >gi|85859103|ref|YP_461305.1| iojap superfamily protein [Syntrophus aciditrophicus SB] gi|85722194|gb|ABC77137.1| iojap protein family [Syntrophus aciditrophicus SB] Length = 118 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + E KA + + + S D +I G S + V +IA + +KK Sbjct: 2 CVNAILEKKAGRLVILNVKEI-SSFADYFIICDGASDRQVQAIAAAVQERMKK 53 >gi|225857356|ref|YP_002738867.1| putative iojap homolog [Streptococcus pneumoniae P1031] gi|225724655|gb|ACO20507.1| putative iojap homolog [Streptococcus pneumoniae P1031] Length = 117 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D VI S +++ + +IA N+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYFVITSSMNSRQLDAIAANIREKVAQ 61 >gi|270290429|ref|ZP_06196654.1| iojap protein 155 [Pediococcus acidilactici 7_4] gi|270281210|gb|EFA27043.1| iojap protein 155 [Pediococcus acidilactici 7_4] Length = 118 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AE I ++ S + D VI S S + VA+IAD +I K Sbjct: 2 DNKQSLELVVKAADSKRAEGIIALDV-HEISTLADYFVITSADSNRQVAAIADAIIEKAK 60 Query: 75 KKN 77 + + Sbjct: 61 END 63 >gi|319651630|ref|ZP_08005757.1| iojap protein family protein [Bacillus sp. 2_A_57_CT2] gi|317396697|gb|EFV77408.1| iojap protein family protein [Bacillus sp. 2_A_57_CT2] Length = 118 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ + T ++ + +AEDI + SLI D VI G S K V +IA + ++ Sbjct: 4 NTLLMTAVKAADDKRAEDITVLNM-KGISLISDYFVICHGNSDKQVQAIAREMKEKSEEH 62 >gi|289434766|ref|YP_003464638.1| Iojap-related protein [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|315303234|ref|ZP_07873882.1| Iojap-related protein [Listeria ivanovii FSL F6-596] gi|289171010|emb|CBH27552.1| Iojap-related protein [Listeria seeligeri serovar 1/2b str. SLCC3954] gi|313628391|gb|EFR96876.1| Iojap-related protein [Listeria ivanovii FSL F6-596] Length = 118 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +AEDI ++ S D VI G S K V +IA + + Sbjct: 11 AKAADDKRAEDILALDM-KGLSSFADYFVICHGNSDKQVQAIAREIKEKALEN 62 >gi|316931865|ref|YP_004106847.1| iojap-like protein [Rhodopseudomonas palustris DX-1] gi|315599579|gb|ADU42114.1| iojap-like protein [Rhodopseudomonas palustris DX-1] Length = 98 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 31/46 (67%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +KAE+ I+ +S + D +V+ SGR+ +HV +IA+N++ LK+ Sbjct: 1 MKAEETVTIDLR-GKSAMFDYVVVSSGRANRHVGAIAENVVKALKQ 45 >gi|297562296|ref|YP_003681270.1| iojap-like protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] gi|296846744|gb|ADH68764.1| iojap-like protein [Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111] Length = 132 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + E + A++I + + +I + V+ S + + V +I D + Sbjct: 1 MTATDRALELVRVAAEAASDKLAQEIIAYDVSEQL-VITEAFVLCSAPNDRQVRAIVDEV 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EDQLR 64 >gi|71064774|ref|YP_263501.1| hypothetical protein Psyc_0194 [Psychrobacter arcticus 273-4] gi|71037759|gb|AAZ18067.1| conserved hypothetical protein [Psychrobacter arcticus 273-4] Length = 137 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T + L C+ V L ++KA++I ++ + + + + +VI G S +HV ++AD++ + Sbjct: 6 TDERLQECLTLVENALDDMKAKNITIMDVAA-LTDVMERIVIADGTSKRHVRAMADSVGA 64 Query: 72 YLKK 75 K+ Sbjct: 65 EAKQ 68 >gi|328957112|ref|YP_004374498.1| hypothetical protein CAR_c07880 [Carnobacterium sp. 17-4] gi|328673436|gb|AEB29482.1| hypothetical protein CAR_c07880 [Carnobacterium sp. 17-4] Length = 118 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ + +AEDI ++ + + S++ D +++ G S K V +I++ +I + Sbjct: 4 ESIELVELIVKAADDKRAEDIIAMDVSKI-SILADYFIVMHGNSEKQVKAISEEIIDKAE 62 Query: 75 K 75 + Sbjct: 63 E 63 >gi|212636656|ref|YP_002313181.1| iojap-like protein [Shewanella piezotolerans WP3] gi|212558140|gb|ACJ30594.1| Iojap-like protein [Shewanella piezotolerans WP3] Length = 109 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ +++LKA+DI ++ + +S I D MV+ +G S HV +IA+NL+ K Sbjct: 2 ESAELKQFVIDKVEDLKAKDIVVMDVSE-KSNIADFMVVCTGNSKTHVKAIAENLVVESK 60 Query: 75 K 75 + Sbjct: 61 R 61 >gi|163761377|ref|ZP_02168451.1| iojap-like protein [Hoeflea phototrophica DFL-43] gi|162281372|gb|EDQ31669.1| iojap-like protein [Hoeflea phototrophica DFL-43] Length = 112 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 25/56 (44%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V E L + KAED I+ +S + D+MV+ SGRS +HVA++ D LIS LK Sbjct: 4 LKLVRESLADSKAEDAVFIDIA-GKSALADHMVVASGRSNRHVAAVCDRLISELKD 58 >gi|160938937|ref|ZP_02086288.1| hypothetical protein CLOBOL_03831 [Clostridium bolteae ATCC BAA-613] gi|158437900|gb|EDP15660.1| hypothetical protein CLOBOL_03831 [Clostridium bolteae ATCC BAA-613] Length = 111 Score = 62.0 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + L + K EDI I+ S S++ D +I G + V ++ADN+ L+K Sbjct: 1 MVKLAYQALSDKKGEDIKIIDIQS-VSVLADYFIIADGSNPNQVQAMADNVEEILEK 56 >gi|57234802|ref|YP_181138.1| iojap-like protein [Dehalococcoides ethenogenes 195] gi|57225250|gb|AAW40307.1| iojap-like protein [Dehalococcoides ethenogenes 195] Length = 114 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ E +AEDI ++ L S CD V++SG S + +++IAD + K Sbjct: 2 ESIDIARQMVSIASEKQAEDIVLLDVRELVSY-CDYFVLMSGASGRQLSAIADTVEKTFK 60 >gi|113478022|ref|YP_724083.1| iojap-like protein [Trichodesmium erythraeum IMS101] gi|110169070|gb|ABG53610.1| iojap-like protein [Trichodesmium erythraeum IMS101] Length = 139 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 AD +T++ + K ++I I + S + D VI++G S V +I+ + Sbjct: 21 ADKTLELTSTIVNAALDRKGDNIVVIRVSE-VSYLADYFVIITGYSNVQVRAISQAIAEK 79 Query: 73 L 73 + Sbjct: 80 V 80 >gi|329893658|ref|ZP_08269792.1| Lojap-related protein [gamma proteobacterium IMCC3088] gi|328923585|gb|EGG30897.1| Lojap-related protein [gamma proteobacterium IMCC3088] Length = 115 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L +LKA ++ ++ ++ + + + +V+ SG S +HV S+ADN+I Sbjct: 1 MMDSLAVKELAQAALDDLKAVNVEVLDVSA-LTDVMEYLVVASGTSNRHVKSLADNVIVA 59 Query: 73 LKK 75 KK Sbjct: 60 AKK 62 >gi|319901126|ref|YP_004160854.1| iojap-like protein [Bacteroides helcogenes P 36-108] gi|319416157|gb|ADV43268.1| iojap-like protein [Bacteroides helcogenes P 36-108] Length = 119 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E +++ K + I + T + IC+ VI G S V +I +++ + Sbjct: 1 MNEAKKLIQQITEGIQDKKGKKIVIADLTKIDDTICNYFVICQGNSPSQVTAIVESVKDF 60 Query: 73 LKK 75 +K Sbjct: 61 SRK 63 >gi|308174351|ref|YP_003921056.1| hypothetical protein BAMF_2460 [Bacillus amyloliquefaciens DSM 7] gi|307607215|emb|CBI43586.1| conserved hypothetical protein [Bacillus amyloliquefaciens DSM 7] Length = 118 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + +AEDI ++ SL+ D +I G S K V +IA + ++ Sbjct: 7 LKIAAKACDDKRAEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQAEEN 62 >gi|167767396|ref|ZP_02439449.1| hypothetical protein CLOSS21_01915 [Clostridium sp. SS2/1] gi|317496727|ref|ZP_07955057.1| hypothetical protein HMPREF0996_00036 [Lachnospiraceae bacterium 5_1_63FAA] gi|167711371|gb|EDS21950.1| hypothetical protein CLOSS21_01915 [Clostridium sp. SS2/1] gi|291559288|emb|CBL38088.1| iojap-related protein [butyrate-producing bacterium SSC/2] gi|316895739|gb|EFV17891.1| hypothetical protein HMPREF0996_00036 [Lachnospiraceae bacterium 5_1_63FAA] Length = 117 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + + + L + AEDI I+ S+ S++ D +I G + V ++ DN+ Sbjct: 1 MDQSLNMVKIAYDALDDKLAEDIKIIDIRSI-SVLADYFIIADGNNKNQVQAMVDNVQEE 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|154686822|ref|YP_001421983.1| YqeL [Bacillus amyloliquefaciens FZB42] gi|154352673|gb|ABS74752.1| YqeL [Bacillus amyloliquefaciens FZB42] Length = 118 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 26/57 (45%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + +AEDI ++ SLI D +I G S K V +IA + ++ Sbjct: 7 LKIAAKACDDKRAEDILALDM-EGISLIADYFLICHGNSDKQVQAIAREIKDQAEEN 62 >gi|148555459|ref|YP_001263041.1| iojap-like protein [Sphingomonas wittichii RW1] gi|148500649|gb|ABQ68903.1| iojap-like protein [Sphingomonas wittichii RW1] Length = 135 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 + A + AD D V++ L + +A + I +S I D+MVI SGRST+ VAS Sbjct: 10 RDASAARDADPSDKLHQLVLKSLDDDQAIETVSIPLA-GKSSIADHMVIASGRSTRQVAS 68 Query: 65 IADNLISYLKKK 76 +A L +K + Sbjct: 69 MATKLADRIKSE 80 >gi|159026059|emb|CAO86300.1| unnamed protein product [Microcystis aeruginosa PCC 7806] gi|159026564|emb|CAO86496.1| unnamed protein product [Microcystis aeruginosa PCC 7806] Length = 134 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + T++ ++ KA DI ++ + + D +I++G ST V +I D + + + Sbjct: 16 KTEQFLETIVTAAEDKKAGDIAILKVADI-CYLTDYFLIITGYSTTQVRAIEDAIEAAM 73 >gi|21672981|ref|NP_661046.1| iojap-related protein [Chlorobium tepidum TLS] gi|21646042|gb|AAM71388.1| iojap-related protein [Chlorobium tepidum TLS] Length = 163 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V E E K ED+ ++ + + D VI++ S + ++ D ++ +K+ Sbjct: 39 SELLARRVAELSLEKKGEDVKILDVR-GLTSVTDFFVIITADSERKAKAVTDYIVDEIKE 97 Query: 76 K 76 + Sbjct: 98 E 98 >gi|315641156|ref|ZP_07896234.1| Iojap family protein [Enterococcus italicus DSM 15952] gi|315483080|gb|EFU73598.1| Iojap family protein [Enterococcus italicus DSM 15952] Length = 119 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++ +AEDI ++ SL+ D +I SG + + + +IAD +I Sbjct: 1 MITSEKMVELAVKAADSKRAEDILVLDVKE-VSLLADYFMICSGTNERQIQAIADTIIDK 59 >gi|313893714|ref|ZP_07827281.1| iojap-like protein [Veillonella sp. oral taxon 158 str. F0412] gi|313441728|gb|EFR60153.1| iojap-like protein [Veillonella sp. oral taxon 158 str. F0412] Length = 120 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + E K DI ++ S++ D +I S + K SIAD + Sbjct: 1 MKNKEDIKQFVLALAQAAFEKKGRDIEILDL-EGISMLGDYFLIASANNIKQSQSIADEM 59 Query: 70 ISYLKK 75 + Sbjct: 60 EDKAAE 65 >gi|238019407|ref|ZP_04599833.1| hypothetical protein VEIDISOL_01276 [Veillonella dispar ATCC 17748] gi|237864106|gb|EEP65396.1| hypothetical protein VEIDISOL_01276 [Veillonella dispar ATCC 17748] Length = 120 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + + K DI ++ S++ D +I S + K SIAD + Sbjct: 1 MKNKEEIKEIVLQLAQAAFDKKGRDIEILDL-EGVSMLGDYFLIASANNIKQSQSIADEM 59 Query: 70 ISYLKK 75 + Sbjct: 60 EDKAAE 65 >gi|139439738|ref|ZP_01773129.1| Hypothetical protein COLAER_02160 [Collinsella aerofaciens ATCC 25986] gi|133774888|gb|EBA38708.1| Hypothetical protein COLAER_02160 [Collinsella aerofaciens ATCC 25986] Length = 151 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/47 (27%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + K ED+ ++ T S +CD V+ +G + + V SI D + + + Sbjct: 51 DKKGEDVQVLDLTE-LSDVCDYFVLATGTNNRQVDSIVDEIEEKVAE 96 >gi|52081112|ref|YP_079903.1| Iojap-like protein [Bacillus licheniformis ATCC 14580] gi|52786490|ref|YP_092319.1| YqeL [Bacillus licheniformis ATCC 14580] gi|319644931|ref|ZP_07999164.1| YqeL protein [Bacillus sp. BT1B_CT2] gi|52004323|gb|AAU24265.1| Iojap-related protein [Bacillus licheniformis ATCC 14580] gi|52348992|gb|AAU41626.1| YqeL [Bacillus licheniformis ATCC 14580] gi|317392740|gb|EFV73534.1| YqeL protein [Bacillus sp. BT1B_CT2] Length = 118 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + E + +AEDI + SL+ D +I G S K V +IA + + Sbjct: 2 DQASILKIAAEACDDKRAEDIIALNM-QGISLVADYFLICHGNSDKQVQAIAREIKDQAE 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|16800589|ref|NP_470857.1| hypothetical protein lin1521 [Listeria innocua Clip11262] gi|16803526|ref|NP_465011.1| hypothetical protein lmo1486 [Listeria monocytogenes EGD-e] gi|47095439|ref|ZP_00233049.1| iojap-related protein [Listeria monocytogenes str. 1/2a F6854] gi|116872915|ref|YP_849696.1| iojap-related protein [Listeria welshimeri serovar 6b str. SLCC5334] gi|217964368|ref|YP_002350046.1| iojap-related protein [Listeria monocytogenes HCC23] gi|224500495|ref|ZP_03668844.1| iojap-related protein [Listeria monocytogenes Finland 1988] gi|224501574|ref|ZP_03669881.1| iojap-related protein [Listeria monocytogenes FSL R2-561] gi|254827774|ref|ZP_05232461.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165] gi|254829755|ref|ZP_05234410.1| iojap-related protein [Listeria monocytogenes 10403S] gi|254898348|ref|ZP_05258272.1| iojap-related protein [Listeria monocytogenes J0161] gi|254912160|ref|ZP_05262172.1| conserved hypothetical protein [Listeria monocytogenes J2818] gi|254936488|ref|ZP_05268185.1| conserved hypothetical protein [Listeria monocytogenes F6900] gi|255029730|ref|ZP_05301681.1| iojap-related protein [Listeria monocytogenes LO28] gi|284801873|ref|YP_003413738.1| hypothetical protein LM5578_1628 [Listeria monocytogenes 08-5578] gi|284995015|ref|YP_003416783.1| hypothetical protein LM5923_1580 [Listeria monocytogenes 08-5923] gi|290893846|ref|ZP_06556824.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071] gi|16410915|emb|CAC99564.1| lmo1486 [Listeria monocytogenes EGD-e] gi|16413994|emb|CAC96752.1| lin1521 [Listeria innocua Clip11262] gi|47016260|gb|EAL07183.1| iojap-related protein [Listeria monocytogenes str. 1/2a F6854] gi|116741793|emb|CAK20917.1| iojap-related protein [Listeria welshimeri serovar 6b str. SLCC5334] gi|217333638|gb|ACK39432.1| iojap-related protein [Listeria monocytogenes HCC23] gi|258600154|gb|EEW13479.1| conserved hypothetical protein [Listeria monocytogenes FSL N3-165] gi|258609081|gb|EEW21689.1| conserved hypothetical protein [Listeria monocytogenes F6900] gi|284057435|gb|ADB68376.1| hypothetical protein LM5578_1628 [Listeria monocytogenes 08-5578] gi|284060482|gb|ADB71421.1| hypothetical protein LM5923_1580 [Listeria monocytogenes 08-5923] gi|290556563|gb|EFD90099.1| conserved hypothetical protein [Listeria monocytogenes FSL J2-071] gi|293590132|gb|EFF98466.1| conserved hypothetical protein [Listeria monocytogenes J2818] gi|307571067|emb|CAR84246.1| plant iojap-related protein [Listeria monocytogenes L99] gi|313618863|gb|EFR90737.1| Iojap-related protein [Listeria innocua FSL S4-378] gi|313623716|gb|EFR93863.1| Iojap-related protein [Listeria innocua FSL J1-023] Length = 118 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +AEDI ++ S D VI G S K V +IA + + Sbjct: 11 AKAADDKRAEDILALDM-KGLSSFADYFVICHGNSDKQVQAIAREIKEKALEN 62 >gi|288555659|ref|YP_003427594.1| hypothetical protein BpOF4_13255 [Bacillus pseudofirmus OF4] gi|288546819|gb|ADC50702.1| hypothetical protein BpOF4_13255 [Bacillus pseudofirmus OF4] Length = 117 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + + +AE+I + SLI D VI G S K V +IA L +++ Sbjct: 4 SRLLTLAINAIDDKRAENIVGLNM-KGISLIADYFVICHGNSEKQVQAIAHELKKVAQEE 62 >gi|170728035|ref|YP_001762061.1| iojap-like protein [Shewanella woodyi ATCC 51908] gi|169813382|gb|ACA87966.1| iojap-like protein [Shewanella woodyi ATCC 51908] Length = 109 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 22/63 (34%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V + +++LKA+DI ++ + RS + D MV+ SG S HV +IA+NL+ K Sbjct: 2 ESAELKLFVTDKVEDLKAKDIVVLDISE-RSNLADFMVVCSGTSKTHVKAIAENLVVEAK 60 Query: 75 KKN 77 + N Sbjct: 61 RAN 63 >gi|21283272|ref|NP_646360.1| hypothetical protein MW1543 [Staphylococcus aureus subsp. aureus MW2] gi|49486426|ref|YP_043647.1| hypothetical protein SAS1529 [Staphylococcus aureus subsp. aureus MSSA476] gi|57651984|ref|YP_186488.1| hypothetical protein SACOL1648 [Staphylococcus aureus subsp. aureus COL] gi|87159939|ref|YP_494246.1| hypothetical protein SAUSA300_1551 [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|88195401|ref|YP_500205.1| hypothetical protein SAOUHSC_01695 [Staphylococcus aureus subsp. aureus NCTC 8325] gi|151221706|ref|YP_001332528.1| hypothetical protein NWMN_1494 [Staphylococcus aureus subsp. aureus str. Newman] gi|161509820|ref|YP_001575479.1| hypothetical protein USA300HOU_1593 [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|221141137|ref|ZP_03565630.1| hypothetical protein SauraJ_05793 [Staphylococcus aureus subsp. aureus str. JKD6009] gi|253733157|ref|ZP_04867322.1| iojap family protein [Staphylococcus aureus subsp. aureus TCH130] gi|258450580|ref|ZP_05698642.1| iojap protein 155 [Staphylococcus aureus A5948] gi|262048591|ref|ZP_06021474.1| hypothetical protein SAD30_0987 [Staphylococcus aureus D30] gi|262051250|ref|ZP_06023474.1| hypothetical protein SA930_1681 [Staphylococcus aureus 930918-3] gi|282920140|ref|ZP_06327865.1| conserved hypothetical protein [Staphylococcus aureus A9765] gi|284024650|ref|ZP_06379048.1| hypothetical protein Saura13_08665 [Staphylococcus aureus subsp. aureus 132] gi|294848622|ref|ZP_06789368.1| iojap protein [Staphylococcus aureus A9754] gi|297207689|ref|ZP_06924124.1| iojap-like protein [Staphylococcus aureus subsp. aureus ATCC 51811] gi|300911770|ref|ZP_07129213.1| iojap-like protein [Staphylococcus aureus subsp. aureus TCH70] gi|304380818|ref|ZP_07363478.1| iojap-like protein [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|21204712|dbj|BAB95408.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MW2] gi|49244869|emb|CAG43330.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus MSSA476] gi|57286170|gb|AAW38264.1| iojap-related protein [Staphylococcus aureus subsp. aureus COL] gi|87125913|gb|ABD20427.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] gi|87202959|gb|ABD30769.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus NCTC 8325] gi|150374506|dbj|BAF67766.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. Newman] gi|160368629|gb|ABX29600.1| hypothetical protein USA300HOU_1593 [Staphylococcus aureus subsp. aureus USA300_TCH1516] gi|253728913|gb|EES97642.1| iojap family protein [Staphylococcus aureus subsp. aureus TCH130] gi|257861738|gb|EEV84537.1| iojap protein 155 [Staphylococcus aureus A5948] gi|259160887|gb|EEW45907.1| hypothetical protein SA930_1681 [Staphylococcus aureus 930918-3] gi|259163238|gb|EEW47797.1| hypothetical protein SAD30_0987 [Staphylococcus aureus D30] gi|269941080|emb|CBI49465.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus TW20] gi|282594488|gb|EFB99473.1| conserved hypothetical protein [Staphylococcus aureus A9765] gi|294824648|gb|EFG41071.1| iojap protein [Staphylococcus aureus A9754] gi|296887706|gb|EFH26604.1| iojap-like protein [Staphylococcus aureus subsp. aureus ATCC 51811] gi|300886016|gb|EFK81218.1| iojap-like protein [Staphylococcus aureus subsp. aureus TCH70] gi|302751421|gb|ADL65598.1| conserved hypothetical protein [Staphylococcus aureus subsp. aureus str. JKD6008] gi|304340545|gb|EFM06479.1| iojap-like protein [Staphylococcus aureus subsp. aureus ATCC BAA-39] gi|315198711|gb|EFU29039.1| hypothetical protein CGSSa01_09324 [Staphylococcus aureus subsp. aureus CGS01] gi|320140522|gb|EFW32376.1| ribosome-associated protein, iojap family [Staphylococcus aureus subsp. aureus MRSA131] gi|320144060|gb|EFW35829.1| ribosome-associated protein, iojap family [Staphylococcus aureus subsp. aureus MRSA177] gi|329314267|gb|AEB88680.1| Iojap-related protein [Staphylococcus aureus subsp. aureus T0131] gi|329728449|gb|EGG64886.1| iojap-like protein [Staphylococcus aureus subsp. aureus 21189] Length = 117 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 27/63 (42%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +A ++ + K ED +E S + D V+ G + + V +IA + Sbjct: 2 NSQELLAIAVDAIDNKKGEDTISLEM-KGISDMTDYFVVTHGNNERQVQAIARAVKEVAN 60 Query: 75 KKN 77 ++N Sbjct: 61 EQN 63 >gi|304384690|ref|ZP_07367036.1| iojap-like protein [Pediococcus acidilactici DSM 20284] gi|304328884|gb|EFL96104.1| iojap-like protein [Pediococcus acidilactici DSM 20284] Length = 120 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ +AE I ++ S + D VI S S + VA+IAD +I K Sbjct: 4 DNKQSLELVVKAADSKRAEGIIALDV-HEISTLADYFVITSADSNRQVAAIADAIIEKAK 62 Query: 75 KKN 77 + + Sbjct: 63 END 65 >gi|239617910|ref|YP_002941232.1| Iojap-related protein [Kosmotoga olearia TBF 19.5.1] gi|239506741|gb|ACR80228.1| Iojap-related protein [Kosmotoga olearia TBF 19.5.1] Length = 116 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D I +++ L + +A DI ++ + S + VI + S H+ ++ D ++ +L+K Sbjct: 1 MDGNIREIVKILYDKEAADIVLLDVSE-VSNLTSYFVIATANSDPHMEALRDGILDFLEK 59 Query: 76 KN 77 N Sbjct: 60 HN 61 >gi|165977037|ref|YP_001652630.1| plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|165877138|gb|ABY70186.1| plant Iojap-like protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] Length = 104 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + L +LKA+DI I+ +S I D M+I +G S +HVAS D L + K+ Sbjct: 3 QNLVEFLTKTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTVDRLSAEAKQ 60 >gi|311895998|dbj|BAJ28406.1| hypothetical protein KSE_25930 [Kitasatospora setae KM-6054] Length = 145 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D +I S + + V +IA+ + Sbjct: 1 MTVTDRSQELITVAAQAAADKLAHDIIAFDVSEVLS-ITDAFLIASAANDRQVRAIAEEI 59 Query: 70 ISYLKKK 76 L++K Sbjct: 60 EDQLREK 66 >gi|300814176|ref|ZP_07094459.1| iojap-like protein [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300511833|gb|EFK39050.1| iojap-like protein [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 122 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + + KE K DI ++ S I D VIVSG S + V+++AD + + Sbjct: 2 KVEDKLRIIKDSCKEKKGIDIKVLDI-KGLSSIADYFVIVSGNSVRQVSALADEIEEKMD 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|260584198|ref|ZP_05851946.1| iojap protein [Granulicatella elegans ATCC 700633] gi|260158824|gb|EEW93892.1| iojap protein [Granulicatella elegans ATCC 700633] Length = 120 Score = 61.6 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T + + V++ + A++I +E + + D VI G++ K V +I D + Sbjct: 2 TENRSKQLLDVVLKAADDKLAQEIVALEVGH-LTPVADYFVITHGKNEKQVQAIVDAIEE 60 Query: 72 YLKKK 76 + K+ Sbjct: 61 EVHKE 65 >gi|33152988|ref|NP_874341.1| hypothetical protein HD2023 [Haemophilus ducreyi 35000HP] gi|33149213|gb|AAP96730.1| conserved hypothetical protein [Haemophilus ducreyi 35000HP] Length = 104 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I + L +LKA+DI I+ +S I D M+I +G S +HVAS A+ LI+ KK Sbjct: 6 IEFLTTTLDDLKAQDILAIDVR-GKSSITDTMIIATGTSVRHVASTAERLITEAKK 60 >gi|304316604|ref|YP_003851749.1| iojap-like protein protein [Thermoanaerobacterium thermosaccharolyticum DSM 571] gi|302778106|gb|ADL68665.1| iojap-like protein protein [Thermoanaerobacterium thermosaccharolyticum DSM 571] Length = 120 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +++ L + KA ++ + + + D VI SG ST HV S+ D ++ L Sbjct: 3 KDSAELTLKILKILDDKKALELKALFVGE-LTTVADYFVIASGTSTTHVKSLCDEVLERL 61 Query: 74 KKK 76 ++ Sbjct: 62 AEE 64 >gi|56963407|ref|YP_175138.1| hypothetical protein ABC1642 [Bacillus clausii KSM-K16] gi|56909650|dbj|BAD64177.1| conserved hypothetical protein [Bacillus clausii KSM-K16] Length = 117 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 1/56 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 ++ + + L + KA I ++ S I D +I G S K V +IA L Sbjct: 1 MNEHLKMAVAALDDKKAMQITALDMR-GISPIADYFIICHGNSEKQVQAIAHELKK 55 >gi|25028811|ref|NP_738865.1| hypothetical protein CE2255 [Corynebacterium efficiens YS-314] gi|259507874|ref|ZP_05750774.1| iojap-related protein [Corynebacterium efficiens YS-314] gi|23494097|dbj|BAC19065.1| conserved hypothetical protein [Corynebacterium efficiens YS-314] gi|259164508|gb|EEW49062.1| iojap-related protein [Corynebacterium efficiens YS-314] Length = 157 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E KAEDI ++ + L I D V+ S + + VA+I + + Sbjct: 1 MSATNESIRLATIAAQAADEKKAEDIAVLDVSDLL-AITDVFVLASADTERQVAAIVEEI 59 Query: 70 ISYL 73 + + Sbjct: 60 EAEM 63 >gi|163790551|ref|ZP_02184980.1| iojap-related protein [Carnobacterium sp. AT7] gi|159874154|gb|EDP68229.1| iojap-related protein [Carnobacterium sp. AT7] Length = 118 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + V++ + +AEDI ++ + + S++ D +++ G S K V SIA+ +I Sbjct: 3 NKSIELVELVVKAADDKRAEDIIAMDVSKI-SILADYFIVMHGNSEKQVKSIAEEIIDKA 61 Query: 74 KK 75 ++ Sbjct: 62 EE 63 >gi|15613891|ref|NP_242194.1| hypothetical protein BH1328 [Bacillus halodurans C-125] gi|10173944|dbj|BAB05047.1| BH1328 [Bacillus halodurans C-125] Length = 117 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + + KAE + + SLI D +I G S K V +IA L +++ Sbjct: 4 QELLQLAVNAVDDKKAEQVVALNM-KGISLIADFFLICHGNSEKQVQAIAHELKKVAQEQ 62 >gi|315633658|ref|ZP_07888948.1| Iojap family protein [Aggregatibacter segnis ATCC 33393] gi|315477700|gb|EFU68442.1| Iojap family protein [Aggregatibacter segnis ATCC 33393] Length = 102 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L +LKA DI + +S I D M++ +G S++HV+S+A LI+ K Sbjct: 3 LVDFVVNKLDDLKATDILPLNV-KGKSSITDTMILCTGTSSRHVSSLAQKLITECK 57 >gi|56751351|ref|YP_172052.1| hypothetical protein syc1342_c [Synechococcus elongatus PCC 6301] gi|81298975|ref|YP_399183.1| Iojap-related protein [Synechococcus elongatus PCC 7942] gi|56686310|dbj|BAD79532.1| hypothetical protein [Synechococcus elongatus PCC 6301] gi|81167856|gb|ABB56196.1| Iojap-related protein [Synechococcus elongatus PCC 7942] Length = 139 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + KA DI + + + + D +I SG S V +IA ++ L + Sbjct: 28 DDRKAGDIAILRVSE-VAYLADYFLICSGFSITQVRAIARSIEEKLSE 74 >gi|293391079|ref|ZP_06635413.1| iojap-related protein [Aggregatibacter actinomycetemcomitans D7S-1] gi|290951613|gb|EFE01732.1| iojap-related protein [Aggregatibacter actinomycetemcomitans D7S-1] Length = 102 Score = 61.6 bits (149), Expect = 4e-08, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + V+ L +LKA DI + +S + D M++ +G S++HV+S+A LI+ K Sbjct: 2 SLVDFVVNKLDDLKATDILSLNV-KGKSSVTDTMILCTGTSSRHVSSLAQKLITECK 57 >gi|93005045|ref|YP_579482.1| Iojap-related protein [Psychrobacter cryohalolentis K5] gi|92392723|gb|ABE73998.1| Iojap-related protein [Psychrobacter cryohalolentis K5] Length = 137 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T + L C+ V L ++KA++I ++ + + + + ++I G S +HV ++AD++ + Sbjct: 6 TDERLQECLTLVQTALDDMKAKNITVMDVAA-LTDVMERIIIADGTSKRHVRAMADSVGA 64 Query: 72 YLK 74 K Sbjct: 65 EAK 67 >gi|293400785|ref|ZP_06644930.1| iojap-like protein [Erysipelotrichaceae bacterium 5_2_54FAA] gi|291305811|gb|EFE47055.1| iojap-like protein [Erysipelotrichaceae bacterium 5_2_54FAA] Length = 112 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I V + + E K E E + D +VI S +S + V +IADN+ +K+ Sbjct: 1 MKELIKVVQKAIDEKKGEHPVIFEY-HTLNPFIDYVVICSAQSLRQVYAIADNVADRVKE 59 Query: 76 K 76 Sbjct: 60 H 60 >gi|166363297|ref|YP_001655570.1| iojap-related protein [Microcystis aeruginosa NIES-843] gi|166085670|dbj|BAG00378.1| iojap-related protein [Microcystis aeruginosa NIES-843] Length = 134 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++ + + T++ ++ KA DI ++ + + D +I++G ST V +I D Sbjct: 10 SVAENLKTEKFLETIVTAAEDKKAGDIAILKVADI-CYLTDYFLIITGYSTTQVRAIEDA 68 Query: 69 LISYL 73 + + + Sbjct: 69 IEAAM 73 >gi|147669017|ref|YP_001213835.1| iojap-like protein [Dehalococcoides sp. BAV1] gi|146269965|gb|ABQ16957.1| iojap-like protein [Dehalococcoides sp. BAV1] Length = 114 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ E +AEDI ++ L S CD V++SG S++ +++IAD + LK Sbjct: 2 ESIDIARQMVSMASEKQAEDIVLLDVRELVSY-CDYFVLMSGASSRQLSAIADVVEKTLK 60 >gi|39998299|ref|NP_954250.1| iojap-related protein [Geobacter sulfurreducens PCA] gi|39985245|gb|AAR36600.1| iojap-related protein [Geobacter sulfurreducens PCA] Length = 131 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 5/71 (7%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T+K L + C + + KA D+ +E + S I D +V+ +GRS K + Sbjct: 2 TDKLTLTPLERALQCARFAL----DKKALDVKVLEIGRI-SSIADYLVLATGRSDKQAQA 56 Query: 65 IADNLISYLKK 75 IAD++ LKK Sbjct: 57 IADSVKKGLKK 67 >gi|153807422|ref|ZP_01960090.1| hypothetical protein BACCAC_01701 [Bacteroides caccae ATCC 43185] gi|149129784|gb|EDM20996.1| hypothetical protein BACCAC_01701 [Bacteroides caccae ATCC 43185] Length = 119 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K ++I + T++ IC VI G S V +I D++ + Sbjct: 1 MNDTKVLIEKIKEGIQEKKGKNIIIADLTNIEDTICKYFVICQGNSPSQVGAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|58039608|ref|YP_191572.1| hypothetical protein GOX1149 [Gluconobacter oxydans 621H] gi|58002022|gb|AAW60916.1| Hypothetical protein GOX1149 [Gluconobacter oxydans 621H] Length = 167 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K+ D L S + + L E K EDI ++ R+ D MVI +G + + ++++A Sbjct: 37 KREAVQPDLLTSMLTVITTSLDEDKGEDIVVLDLV-GRANFADRMVIATGLADRQISAMA 95 Query: 67 DNLISYLKK 75 ++ L + Sbjct: 96 HHIEKKLNE 104 >gi|282882862|ref|ZP_06291467.1| YqeL [Peptoniphilus lacrimalis 315-B] gi|281297273|gb|EFA89764.1| YqeL [Peptoniphilus lacrimalis 315-B] Length = 122 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + + KE K DI ++ S I D VIVSG S + V+++AD + + Sbjct: 2 KVEDKLRIIKDSCKEKKGIDIKVLDI-KGLSSIADYFVIVSGNSVRQVSALADEIEEKMD 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|255007600|ref|ZP_05279726.1| hypothetical protein Bfra3_00577 [Bacteroides fragilis 3_1_12] gi|313145293|ref|ZP_07807486.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] gi|313134060|gb|EFR51420.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12] Length = 119 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K ++I + T++ IC VI G S V +I D++ + Sbjct: 1 MNETKVLIEKITEGIQEKKGKNIVIADLTNIDDTICQYFVICQGNSPSQVVAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|253577870|ref|ZP_04855142.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251850188|gb|EES78146.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 119 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + L E K +DI I+ S+I D VI S + V ++ DN+ Sbjct: 1 MNRELEMAKLACRALDEKKGKDIKVIDI-HEVSVIADYFVIASASNQNQVQAMVDNVDET 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|172041042|ref|YP_001800756.1| hypothetical protein cur_1362 [Corynebacterium urealyticum DSM 7109] gi|171852346|emb|CAQ05322.1| hypothetical protein cu1362 [Corynebacterium urealyticum DSM 7109] Length = 169 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 + E+ L + + + E K EDI I+ ++ I D VIV+G + +HV Sbjct: 6 TSLERFRLTAQPESIALASLAAQAADEKKGEDILVIDVSNRL-AIIDCFVIVTGDNERHV 64 Query: 63 ASIADNLISYLKKK 76 SI D + +L + Sbjct: 65 QSIVDEVEDHLAEN 78 >gi|256828605|ref|YP_003157333.1| iojap-like protein [Desulfomicrobium baculatum DSM 4028] gi|256577781|gb|ACU88917.1| iojap-like protein [Desulfomicrobium baculatum DSM 4028] Length = 120 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ I ++ L + K +I ++ S + + M+ V+ RS KH S+AD ++ L + Sbjct: 1 MEEKIEQIVTWLSDKKGTNIKALDVR-GFSPLTETMIFVTARSAKHAQSLADEVMQKLAE 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|298507235|gb|ADI85958.1| protein of unknown function DUF143 [Geobacter sulfurreducens KN400] Length = 131 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 5/71 (7%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T+K L + C + + KA D+ +E + S I D +V+ +GRS K + Sbjct: 2 TDKLTLTPLERALQCARFAL----DKKALDVKVLEIGRI-SSIADYLVLATGRSDKQAQA 56 Query: 65 IADNLISYLKK 75 IAD++ LKK Sbjct: 57 IADSVKKGLKK 67 >gi|46907714|ref|YP_014103.1| iojap-related protein [Listeria monocytogenes serotype 4b str. F2365] gi|226224087|ref|YP_002758194.1| hypothetical protein Lm4b_01496 [Listeria monocytogenes Clip81459] gi|254824455|ref|ZP_05229456.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194] gi|254852110|ref|ZP_05241458.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503] gi|254931421|ref|ZP_05264780.1| conserved hypothetical protein [Listeria monocytogenes HPB2262] gi|254992213|ref|ZP_05274403.1| hypothetical protein LmonocytoFSL_03364 [Listeria monocytogenes FSL J2-064] gi|255520856|ref|ZP_05388093.1| hypothetical protein LmonocFSL_06456 [Listeria monocytogenes FSL J1-175] gi|300764849|ref|ZP_07074839.1| hypothetical protein LMHG_12884 [Listeria monocytogenes FSL N1-017] gi|46880983|gb|AAT04280.1| iojap-related protein [Listeria monocytogenes serotype 4b str. F2365] gi|225876549|emb|CAS05258.1| Hypothetical protein of unknown function [Listeria monocytogenes serotype 4b str. CLIP 80459] gi|258605412|gb|EEW18020.1| conserved hypothetical protein [Listeria monocytogenes FSL R2-503] gi|293582971|gb|EFF95003.1| conserved hypothetical protein [Listeria monocytogenes HPB2262] gi|293593692|gb|EFG01453.1| conserved hypothetical protein [Listeria monocytogenes FSL J1-194] gi|300514525|gb|EFK41582.1| hypothetical protein LMHG_12884 [Listeria monocytogenes FSL N1-017] gi|328465527|gb|EGF36756.1| hypothetical protein LM1816_06320 [Listeria monocytogenes 1816] gi|328474854|gb|EGF45654.1| hypothetical protein LM220_11627 [Listeria monocytogenes 220] gi|332311928|gb|EGJ25023.1| YqeL-like protein [Listeria monocytogenes str. Scott A] Length = 118 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +AEDI ++ S D VI G S K V +IA + + Sbjct: 11 AKAADDKRAEDILALDM-KGLSSFADYFVICHGNSDKQVQAIAREIKEKALEN 62 >gi|256820482|ref|YP_003141761.1| iojap-like protein [Capnocytophaga ochracea DSM 7271] gi|315223578|ref|ZP_07865433.1| iojap-like protein [Capnocytophaga ochracea F0287] gi|256582065|gb|ACU93200.1| iojap-like protein [Capnocytophaga ochracea DSM 7271] gi|314946494|gb|EFS98488.1| iojap-like protein [Capnocytophaga ochracea F0287] Length = 123 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 10/66 (15%), Positives = 33/66 (50%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + I+ ++ ++++K DI ++ + + +CD ++ +G S V++I+ + Sbjct: 1 MNKEISSNQLISNIIAGIEKVKGTDITIMDLREVENTVCDYFILCNGSSNTQVSAISGAI 60 Query: 70 ISYLKK 75 + + Sbjct: 61 QKVVSQ 66 >gi|56417054|ref|YP_154128.1| hypothetical protein AM980 [Anaplasma marginale str. St. Maries] gi|222475420|ref|YP_002563837.1| hypothetical protein AMF_748 [Anaplasma marginale str. Florida] gi|56388286|gb|AAV86873.1| hypothetical protein AM980 [Anaplasma marginale str. St. Maries] gi|222419558|gb|ACM49581.1| Conserved hypothetical protein [Anaplasma marginale str. Florida] Length = 122 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 +V+ L E A DI ++ R + ++M+I SG S+ HV S+ +++ Sbjct: 12 ELKDSVVAVLDEHSASDIVVLDVA-GRCQLTEHMIIASGNSSTHVKSLVEHI 62 >gi|225025983|ref|ZP_03715175.1| hypothetical protein EUBHAL_00220 [Eubacterium hallii DSM 3353] gi|224956769|gb|EEG37978.1| hypothetical protein EUBHAL_00220 [Eubacterium hallii DSM 3353] Length = 117 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +E L++ KAEDI I+ + S++ D +I G + V ++AD+ Sbjct: 1 MNESKKMALLAVEALEDKKAEDITIIDISE-VSVLADYFIIADGSNRNQVQAMADSAEEA 59 Query: 73 LKK 75 L K Sbjct: 60 LGK 62 >gi|116072930|ref|ZP_01470192.1| Iojap-related protein [Synechococcus sp. RS9916] gi|116068235|gb|EAU73987.1| Iojap-related protein [Synechococcus sp. RS9916] Length = 130 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 23/61 (37%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + KA I I S + D MVI G + V +IA ++ L+ Sbjct: 10 DSQKLAELAADACDDRKATGIELIRV-DEVSSLADWMVIAGGHTDVQVRAIARSVEDRLE 68 Query: 75 K 75 + Sbjct: 69 E 69 >gi|114561884|ref|YP_749397.1| iojap-like protein [Shewanella frigidimarina NCIMB 400] gi|114333177|gb|ABI70559.1| iojap-like protein [Shewanella frigidimarina NCIMB 400] Length = 109 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ + +LKA++I I+ + RS I D M+I +G S HV SI +++I K Sbjct: 5 ELKDFVIDKVDDLKAKNITVIDVSK-RSTITDTMIICTGTSKTHVRSIGEHVIVSAK 60 >gi|87306634|ref|ZP_01088781.1| hypothetical protein DSM3645_09882 [Blastopirellula marina DSM 3645] gi|87290813|gb|EAQ82700.1| hypothetical protein DSM3645_09882 [Blastopirellula marina DSM 3645] Length = 153 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 ++ QT + ++ +A++I ++ L S D VIV+G S + + +I Sbjct: 9 KRPDAQTTASSLELAHAAAQVSEDNRAKNIVVLDMRKLTSAF-DYFVIVTGASRRQLHAI 67 Query: 66 ADNLISYLKKK 76 +D + + +K+ Sbjct: 68 SDEIDNKFEKE 78 >gi|321312047|ref|YP_004204334.1| hypothetical protein BSn5_03375 [Bacillus subtilis BSn5] gi|291485012|dbj|BAI86087.1| hypothetical protein BSNT_03814 [Bacillus subtilis subsp. natto BEST195] gi|320018321|gb|ADV93307.1| hypothetical protein BSn5_03375 [Bacillus subtilis BSn5] Length = 118 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S + + +AEDI ++ SL+ D +I G S K V +IA + + Sbjct: 4 KSILKIAAAACDDKRAEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQADEN 62 >gi|73748235|ref|YP_307474.1| iojap related protein [Dehalococcoides sp. CBDB1] gi|289432286|ref|YP_003462159.1| iojap-like protein [Dehalococcoides sp. GT] gi|73659951|emb|CAI82558.1| iojap related protein [Dehalococcoides sp. CBDB1] gi|288946006|gb|ADC73703.1| iojap-like protein [Dehalococcoides sp. GT] Length = 114 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ E +AEDI ++ L S CD V++SG S + +++IAD + LK Sbjct: 2 ESIDIARQMVSMASEKQAEDIVLLDVRELVSY-CDYFVLMSGASGRQLSAIADVVEKTLK 60 >gi|294054950|ref|YP_003548608.1| iojap-like protein [Coraliomargarita akajimensis DSM 45221] gi|293614283|gb|ADE54438.1| iojap-like protein [Coraliomargarita akajimensis DSM 45221] Length = 122 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M + K+ +T D I + L + KAE+I ++ ++ +S I D +VI +G S Sbjct: 1 MSSAEPKKTNKTLDE----IRCAITALDDKKAENIQVLDVSA-QSSITDYLVIATGTSDP 55 Query: 61 HVASIADNLISYLKK 75 H+ ++ L LK Sbjct: 56 HLKALKAALDQALKD 70 >gi|157964959|ref|YP_001499783.1| Iojap-related protein [Rickettsia massiliae MTU5] gi|157844735|gb|ABV85236.1| Iojap-related protein [Rickettsia massiliae MTU5] Length = 117 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 23/66 (34%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ Sbjct: 7 LIIMKKETEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVRAIAEY 65 Query: 69 LISYLK 74 + LK Sbjct: 66 VALELK 71 >gi|53712068|ref|YP_098060.1| hypothetical protein BF0775 [Bacteroides fragilis YCH46] gi|60680262|ref|YP_210406.1| hypothetical protein BF0703 [Bacteroides fragilis NCTC 9343] gi|253563893|ref|ZP_04841350.1| conserved hypothetical protein [Bacteroides sp. 3_2_5] gi|265765403|ref|ZP_06093678.1| conserved hypothetical protein [Bacteroides sp. 2_1_16] gi|52214933|dbj|BAD47526.1| conserved hypothetical protein [Bacteroides fragilis YCH46] gi|60491696|emb|CAH06448.1| conserved hypothetical protein [Bacteroides fragilis NCTC 9343] gi|251947669|gb|EES87951.1| conserved hypothetical protein [Bacteroides sp. 3_2_5] gi|263254787|gb|EEZ26221.1| conserved hypothetical protein [Bacteroides sp. 2_1_16] gi|301161789|emb|CBW21329.1| conserved hypothetical protein [Bacteroides fragilis 638R] Length = 119 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K ++I + T++ IC VI G S V +I D++ + Sbjct: 1 MNETKVLIEKITEGIQEKKGKNIVIADLTNIDDTICKYFVICQGNSPSQVIAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|193211770|ref|YP_001997723.1| iojap-like protein [Chlorobaculum parvum NCIB 8327] gi|193085247|gb|ACF10523.1| iojap-like protein [Chlorobaculum parvum NCIB 8327] Length = 145 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V E E K E++ ++ + + D VI++ S + +IA+ ++ L++ Sbjct: 22 SELLARRVAELSLEKKGEEVKILDVR-GLTSVTDFFVIITADSERKSKAIAEFIVDELRE 80 Query: 76 KN 77 ++ Sbjct: 81 ED 82 >gi|325298615|ref|YP_004258532.1| iojap-like protein [Bacteroides salanitronis DSM 18170] gi|324318168|gb|ADY36059.1| iojap-like protein [Bacteroides salanitronis DSM 18170] Length = 119 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + + E ++E K ++I + T + IC +I G S + +I D++ Y Sbjct: 1 MNETKTLVEKITEGIQEKKGKNIIIADLTGIEDTICKFFIICQGNSPSQILAITDSVRDY 60 Query: 73 LKK 75 +KK Sbjct: 61 VKK 63 >gi|158336765|ref|YP_001517939.1| Iojap like protein [Acaryochloris marina MBIC11017] gi|158307006|gb|ABW28623.1| Iojap like protein [Acaryochloris marina MBIC11017] Length = 140 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 18/68 (26%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Query: 10 LQTADHLDSCIATVM-ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 L A L +A + E + K DI ++ S I D VIV+G S V +I ++ Sbjct: 15 LSPAQDLAQTLALCLAEAADDRKGGDILVLQVAD-VSFIADYFVIVTGFSRTQVRAITES 73 Query: 69 LISYLKKK 76 + + Sbjct: 74 MEKAAEDH 81 >gi|255003408|ref|ZP_05278372.1| hypothetical protein AmarPR_04080 [Anaplasma marginale str. Puerto Rico] gi|255004528|ref|ZP_05279329.1| hypothetical protein AmarV_04390 [Anaplasma marginale str. Virginia] Length = 116 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 V+ L E A DI ++ R + ++M+I SG S+ HV S+ +++ Sbjct: 1 MPGYTELKDAVVAVLDEHSASDIVVLDVA-GRCQLTEHMIIASGNSSTHVKSLVEHI 56 >gi|209526416|ref|ZP_03274944.1| iojap-like protein [Arthrospira maxima CS-328] gi|209493189|gb|EDZ93516.1| iojap-like protein [Arthrospira maxima CS-328] Length = 146 Score = 61.3 bits (148), Expect = 5e-08, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + KA++I ++ T S + D +IV+G S V +I +I ++++N Sbjct: 44 DDRKADNITLLKVTE-VSYLADYFLIVTGFSNTQVRAIHQAIIQKVEEEN 92 >gi|87303375|ref|ZP_01086163.1| hypothetical protein WH5701_10120 [Synechococcus sp. WH 5701] gi|87282023|gb|EAQ73985.1| hypothetical protein WH5701_10120 [Synechococcus sp. WH 5701] Length = 135 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 20/73 (27%), Positives = 30/73 (41%), Gaps = 1/73 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M + AL ++ + E + KA +IC I S + D VI SG S Sbjct: 1 MAESAPSPALVSSTDSRALALLAAEACDDRKAVEICLIRV-EEVSSLADWFVICSGLSDV 59 Query: 61 HVASIADNLISYL 73 V +IA ++ L Sbjct: 60 QVRAIARSVEDRL 72 >gi|310658670|ref|YP_003936391.1| hypothetical protein CLOST_1366 [Clostridium sticklandii DSM 519] gi|308825448|emb|CBH21486.1| conserved protein of unknown function [Clostridium sticklandii] Length = 115 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ I V + + + + EDI ++ ++ S + D +I S + + V SI DN+ L+ Sbjct: 2 NIEESIKLVYKAIDDKQGEDIKILKIGNI-SSLADYFIITSASNERQVKSITDNIEKELE 60 Query: 75 KKN 77 + + Sbjct: 61 EHD 63 >gi|282854185|ref|ZP_06263522.1| iojap-like protein [Propionibacterium acnes J139] gi|282583638|gb|EFB89018.1| iojap-like protein [Propionibacterium acnes J139] gi|314981277|gb|EFT25371.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL110PA3] gi|315091751|gb|EFT63727.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL110PA4] Length = 357 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 9/67 (13%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ K DI ++ + I D V++S + + V+++ D + Sbjct: 1 MSATEYAIELARVAAHAALGKKGFDIVALDVSEHL-AITDIFVVISAANERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DKAMHEH 66 >gi|152978374|ref|YP_001344003.1| iojap-like protein [Actinobacillus succinogenes 130Z] gi|150840097|gb|ABR74068.1| iojap-like protein [Actinobacillus succinogenes 130Z] Length = 104 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E L LKA DI I+ +S + DNM+I +G S++HVA++A LI K+ Sbjct: 5 LTKFLTEKLDALKAIDILTIDVR-GKSSVTDNMIICTGTSSRHVAALAQKLIDESKQ 60 >gi|47094100|ref|ZP_00231825.1| iojap-related protein [Listeria monocytogenes str. 4b H7858] gi|47017530|gb|EAL08338.1| iojap-related protein [Listeria monocytogenes str. 4b H7858] Length = 111 Score = 60.9 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +AEDI ++ S D VI G S K V +IA + + Sbjct: 4 AKAADDKRAEDILALDM-KGLSSFADYFVICHGNSDKQVQAIAREIKEKALEN 55 >gi|332296143|ref|YP_004438066.1| iojap-like protein [Thermodesulfobium narugense DSM 14796] gi|332179246|gb|AEE14935.1| iojap-like protein [Thermodesulfobium narugense DSM 14796] Length = 115 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D+ S ++ C+KE + ED+ + +S+ICD +I SG S V +IAD ++ Sbjct: 3 KDNSRSLALEIINCIKEKQGEDVTMLSIGE-KSIICDYFIIASGNSPIQVKAIADKIMER 61 Query: 73 LKK 75 K+ Sbjct: 62 CKE 64 >gi|238924062|ref|YP_002937578.1| iojap-related protein [Eubacterium rectale ATCC 33656] gi|238875737|gb|ACR75444.1| iojap-related protein [Eubacterium rectale ATCC 33656] gi|291524797|emb|CBK90384.1| iojap-related protein [Eubacterium rectale DSM 17629] Length = 115 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ++E L++ KAEDI ++ S I D +I +G + + ++ D + + Sbjct: 5 DLVKKIVEALEDKKAEDITVLDIGE-VSSIADYFIIANGNNANQLTAMEDAVDEAM 59 >gi|326389896|ref|ZP_08211460.1| iojap-like protein [Thermoanaerobacter ethanolicus JW 200] gi|325994164|gb|EGD52592.1| iojap-like protein [Thermoanaerobacter ethanolicus JW 200] Length = 117 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + + L++ KA DI + +++ D VI +G S HV ++ D + Sbjct: 1 MIDGKDKVSKIYKVLEDKKAYDIKILYIGD-LTIVADYFVIATGSSDTHVKALTDEIEKK 59 Query: 73 LKK 75 L + Sbjct: 60 LME 62 >gi|268679061|ref|YP_003303492.1| nicotinate (nicotinamide) nucleotide adenylyltransferase [Sulfurospirillum deleyianum DSM 6946] gi|268617092|gb|ACZ11457.1| nicotinate (nicotinamide) nucleotide adenylyltransferase [Sulfurospirillum deleyianum DSM 6946] Length = 293 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 E A T + +DS I ++ L + KAEDI + S + + ++I + +H S+ Sbjct: 170 EVIAFYTRNPMDSRIEKIVTALSDKKAEDIQVFDM-SGKDYFVNTVIIATTMGERHGLSL 228 Query: 66 ADNLISYLK 74 D+L + LK Sbjct: 229 LDHLKTELK 237 >gi|313902197|ref|ZP_07835605.1| iojap-like protein [Thermaerobacter subterraneus DSM 13965] gi|313467532|gb|EFR63038.1| iojap-like protein [Thermaerobacter subterraneus DSM 13965] Length = 118 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 KA D+ ++ +LI D VI G++ HV +IAD + L +K Sbjct: 17 KKAGDVVVLDM-EGITLIADYFVICHGQNAIHVRAIADGVEEDLAEK 62 >gi|291568394|dbj|BAI90666.1| hypothetical protein [Arthrospira platensis NIES-39] Length = 146 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 14/50 (28%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + KA++I ++ T S + D +IV+G S V +I +I ++++N Sbjct: 44 DDRKADNIKLLKVTE-VSYLADYFLIVTGFSNTQVRAIHQAIIQKVEEEN 92 >gi|254995233|ref|ZP_05277423.1| hypothetical protein AmarM_04600 [Anaplasma marginale str. Mississippi] Length = 116 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 +V+ L E A DI ++ R + ++M+I SG S+ HV S+ +++ Sbjct: 1 MPGYTELKDSVVAVLDEHSASDIVVLDVA-GRCQLTEHMIIASGNSSTHVKSLVEHI 56 >gi|269958533|ref|YP_003328320.1| hypothetical protein ACIS_00362 [Anaplasma centrale str. Israel] gi|269848362|gb|ACZ49006.1| hypothetical protein ACIS_00362 [Anaplasma centrale str. Israel] Length = 117 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +++ L E A DI ++ R + ++M+I SG S+ HV ++ + + Sbjct: 6 KLKDSIVAVLDEHSASDIVVLDVA-GRCQLTEHMIIASGNSSTHVKALVEYVKKKA 60 >gi|145218987|ref|YP_001129696.1| iojap-like protein [Prosthecochloris vibrioformis DSM 265] gi|145205151|gb|ABP36194.1| iojap-like protein [Chlorobium phaeovibrioides DSM 265] Length = 131 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + E E K ED+ ++ + + D VIV+ S + + A+++ Sbjct: 15 VREVEDGELLARRAAELTLEKKCEDVKILDLRE-LTSVTDFFVIVTADSERKAKAAAEHV 73 Query: 70 ISYLKKKN 77 I L+ ++ Sbjct: 74 IEELRGED 81 >gi|251793197|ref|YP_003007925.1| iojap-like protein [Aggregatibacter aphrophilus NJ8700] gi|247534592|gb|ACS97838.1| iojap-related protein [Aggregatibacter aphrophilus NJ8700] Length = 102 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + V+ L +LKA DI + +S I D M++ +G S++HV+S+A LIS K Sbjct: 2 SLVDFVVNKLDDLKATDILPLNV-KGKSSITDTMILCTGTSSRHVSSLAQKLISECK 57 >gi|104774342|ref|YP_619322.1| hypothetical protein Ldb1496 [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|116514437|ref|YP_813343.1| Iojap family protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|300813187|ref|ZP_07093561.1| iojap-like protein [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|313124177|ref|YP_004034436.1| iojap family protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|103423423|emb|CAI98296.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842] gi|116093752|gb|ABJ58905.1| Iojap family protein [Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365] gi|300495845|gb|EFK30993.1| iojap-like protein [Lactobacillus delbrueckii subsp. bulgaricus PB2003/044-T3-4] gi|312280740|gb|ADQ61459.1| Iojap family protein [Lactobacillus delbrueckii subsp. bulgaricus ND02] gi|325126137|gb|ADY85467.1| Hypothetical conserved protein [Lactobacillus delbrueckii subsp. bulgaricus 2038] gi|325685791|gb|EGD27864.1| Iojap family protein [Lactobacillus delbrueckii subsp. lactis DSM 20072] Length = 115 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + V+ + E ED + S++ D V S S++ + +IA+++I Sbjct: 2 KSEELLDLVLNAISERHGEDTEAYDMR-GISILADYFVATSATSSRQLHAIANSIIEACH 60 Query: 75 KKN 77 + N Sbjct: 61 EAN 63 >gi|289578072|ref|YP_003476699.1| iojap-like protein [Thermoanaerobacter italicus Ab9] gi|297544345|ref|YP_003676647.1| iojap-like protein [Thermoanaerobacter mathranii subsp. mathranii str. A3] gi|289527785|gb|ADD02137.1| iojap-like protein [Thermoanaerobacter italicus Ab9] gi|296842120|gb|ADH60636.1| iojap-like protein [Thermoanaerobacter mathranii subsp. mathranii str. A3] Length = 117 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + + L++ KA DI + +++ D +I +G S HV ++ D + Sbjct: 1 MIDVKDKVFKIYKVLEDNKASDIKILYIGD-LTVVADYFIIATGNSDTHVKALTDEIEKK 59 Query: 73 LKKK 76 L ++ Sbjct: 60 LMEE 63 >gi|15807562|ref|NP_296299.1| hypothetical protein DR_2580 [Deinococcus radiodurans R1] gi|6460407|gb|AAF12119.1|AE002087_2 conserved hypothetical protein [Deinococcus radiodurans R1] Length = 116 Score = 60.9 bits (147), Expect = 6e-08, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 +Q + + + ++E +E +AED+ ++ T + S + + VI + + + ++ +N+ Sbjct: 1 MQLEPQIKTQLQAIVEAARERRAEDVVALDLTEVSSSL-EYFVICTASAGLQLNAVQENI 59 Query: 70 ISYLKK 75 ++ Sbjct: 60 REKAQE 65 >gi|194332983|ref|YP_002014843.1| iojap-like protein [Prosthecochloris aestuarii DSM 271] gi|194310801|gb|ACF45196.1| iojap-like protein [Prosthecochloris aestuarii DSM 271] Length = 147 Score = 60.9 bits (147), Expect = 7e-08, Method: Composition-based stats. Identities = 13/72 (18%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 E Q+++ + + E E K ED+ ++ + + D V+ + S + + Sbjct: 11 EDQSVEEVEVSELLARRAAELSLEKKCEDVKILDVR-GLTSVTDFFVLATADSERKAKAA 69 Query: 66 ADNLISYLKKKN 77 ++++ LKK + Sbjct: 70 YEHIVDELKKDD 81 >gi|206890765|ref|YP_002249451.1| hypothetical protein THEYE_A1658 [Thermodesulfovibrio yellowstonii DSM 11347] gi|206891138|ref|YP_002249401.1| hypothetical protein THEYE_A1606 [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742703|gb|ACI21760.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206743076|gb|ACI22133.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii DSM 11347] Length = 125 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D + + T E L + KA+DI +E ++I D VI S ST V ++A+ L Sbjct: 1 MDSKEKALKTA-EFLHDKKAQDIKILELKE-LTIITDYFVICSAESTTQVKALAEYLQET 58 Query: 73 LKKK 76 ++++ Sbjct: 59 MQQE 62 >gi|313205302|ref|YP_004043959.1| iojap-like protein [Paludibacter propionicigenes WB4] gi|312444618|gb|ADQ80974.1| iojap-like protein [Paludibacter propionicigenes WB4] Length = 119 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 32/64 (50%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + ++E ++E K ++I + T L+ C VI G S V +IA ++ + Sbjct: 1 MIENEQIVNKIVEGIQERKGKNIVIVNLTKLQEAPCCYFVICEGDSNTQVNAIAHSIKDW 60 Query: 73 LKKK 76 ++++ Sbjct: 61 VREQ 64 >gi|122921438|pdb|2O5A|A Chain A, Crystal Structure Of Q9kd89 From Bacillus Halodurans. Northeast Structural Genomics Target Bhr21 gi|122921439|pdb|2O5A|B Chain B, Crystal Structure Of Q9kd89 From Bacillus Halodurans. Northeast Structural Genomics Target Bhr21 Length = 125 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + + KAE + + SLI D +I G S K V +IA L +++ Sbjct: 4 QELLQLAVNAVDDKKAEQVVALN-XKGISLIADFFLICHGNSEKQVQAIAHELKKVAQEQ 62 >gi|325294285|ref|YP_004280799.1| iojap-like protein [Desulfurobacterium thermolithotrophum DSM 11699] gi|325064733|gb|ADY72740.1| iojap-like protein [Desulfurobacterium thermolithotrophum DSM 11699] Length = 122 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ + KAE+ I+ + + D +I++ S H +IAD + LK Sbjct: 2 DTLEKLKIALKAALDKKAENPVIIDLKD-LTTLADYFLIITVNSDVHGRTIADEIRKKLK 60 Query: 75 KK 76 ++ Sbjct: 61 EE 62 >gi|297622280|ref|YP_003703714.1| iojap-like protein [Truepera radiovictrix DSM 17093] gi|297163460|gb|ADI13171.1| iojap-like protein [Truepera radiovictrix DSM 17093] Length = 120 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + +++ L + +A+DI ++ + D ++ +G S+ + ++ +++ L Sbjct: 5 VQRIVDALDDRRAKDIAVLDLRRASETL-DYFIVATGESSLQLRALEESVRDKL 57 >gi|226307262|ref|YP_002767222.1| hypothetical protein RER_37750 [Rhodococcus erythropolis PR4] gi|229493169|ref|ZP_04386961.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] gi|226186379|dbj|BAH34483.1| conserved hypothetical protein [Rhodococcus erythropolis PR4] gi|229319900|gb|EEN85729.1| conserved hypothetical protein [Rhodococcus erythropolis SK121] Length = 148 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + E A ++ ++ + +I D VI S + + V SI +N+ Sbjct: 1 MSANTEAIDMARIAALAADEKLATEVVVLDVSEQL-VITDCFVIASATNERQVNSIVENI 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDRLRE 65 >gi|239946791|ref|ZP_04698544.1| iojap protein [Rickettsia endosymbiont of Ixodes scapularis] gi|239921067|gb|EER21091.1| iojap protein [Rickettsia endosymbiont of Ixodes scapularis] Length = 108 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKEAEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVGAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|227510521|ref|ZP_03940570.1| Iojap family protein [Lactobacillus brevis subsp. gravesensis ATCC 27305] gi|227190173|gb|EEI70240.1| Iojap family protein [Lactobacillus brevis subsp. gravesensis ATCC 27305] Length = 118 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ +A DI ++ SL+ D VI S + V +IA+ ++ ++ Sbjct: 2 DSKEISQIVVRAADSKRAHDIVVLDM-EKVSLMADYFVIADANSNRQVKAIAEEVVDQVE 60 Query: 75 KKN 77 + Sbjct: 61 AND 63 >gi|167753107|ref|ZP_02425234.1| hypothetical protein ALIPUT_01378 [Alistipes putredinis DSM 17216] gi|167659421|gb|EDS03551.1| hypothetical protein ALIPUT_01378 [Alistipes putredinis DSM 17216] Length = 116 Score = 60.5 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 31/60 (51%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ T++ +++ K ++I ++ + + IC ++ + ST VA+IA + + + Sbjct: 1 MEKLTGTIIRAIQDKKGKNIVSLDLSKIDGAICSCFIVCNADSTTQVAAIAAGIEEQVLE 60 >gi|95931031|ref|ZP_01313759.1| Iojap-related protein [Desulfuromonas acetoxidans DSM 684] gi|95132927|gb|EAT14598.1| Iojap-related protein [Desulfuromonas acetoxidans DSM 684] Length = 121 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D E + KA D+ + + S + D +V+ +G S + V +IA+++ LK Sbjct: 2 QSDQRALLCSEYALDRKALDVKVLHISK-LSSLADYLVLATGTSDRQVQAIAESVRLGLK 60 Query: 75 KKN 77 + + Sbjct: 61 QNH 63 >gi|184200784|ref|YP_001854991.1| hypothetical protein KRH_11380 [Kocuria rhizophila DC2201] gi|183581014|dbj|BAG29485.1| hypothetical protein [Kocuria rhizophila DC2201] Length = 139 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 9/64 (14%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + KAE++ + + I D ++ S + + V+++ D + Sbjct: 1 MTATTESIDLVRAAALAADQKKAENVVAFDVSESL-AITDVFMVASAPNERQVSAVVDAV 59 Query: 70 ISYL 73 L Sbjct: 60 EEAL 63 >gi|237714480|ref|ZP_04544961.1| conserved hypothetical protein [Bacteroides sp. D1] gi|262408312|ref|ZP_06084859.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|293372243|ref|ZP_06618628.1| iojap-like protein [Bacteroides ovatus SD CMC 3f] gi|294645939|ref|ZP_06723610.1| iojap-like protein [Bacteroides ovatus SD CC 2a] gi|294805893|ref|ZP_06764763.1| iojap-like protein [Bacteroides xylanisolvens SD CC 1b] gi|229445644|gb|EEO51435.1| conserved hypothetical protein [Bacteroides sp. D1] gi|262353864|gb|EEZ02957.1| conserved hypothetical protein [Bacteroides sp. 2_1_22] gi|292632685|gb|EFF51278.1| iojap-like protein [Bacteroides ovatus SD CMC 3f] gi|292638739|gb|EFF57086.1| iojap-like protein [Bacteroides ovatus SD CC 2a] gi|294446922|gb|EFG15519.1| iojap-like protein [Bacteroides xylanisolvens SD CC 1b] gi|295086618|emb|CBK68141.1| iojap-related protein [Bacteroides xylanisolvens XB1A] Length = 119 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K + I + TS+ IC VI G S V++I D++ + Sbjct: 1 MNDTKVLIEKIKEGIQEKKGKKIVVADLTSIEDTICKYFVICQGNSPSQVSAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|156743666|ref|YP_001433795.1| iojap-like protein [Roseiflexus castenholzii DSM 13941] gi|156234994|gb|ABU59777.1| iojap-like protein [Roseiflexus castenholzii DSM 13941] Length = 104 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 10/50 (20%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ +A +I ++ L + + D VI +G S + + +I +++ L ++ Sbjct: 4 AEDKQASNIVLLDLRRLNT-VADYFVICTGGSERQLKAITESIDEGLARE 52 >gi|323704244|ref|ZP_08115823.1| iojap-like protein [Thermoanaerobacterium xylanolyticum LX-11] gi|323536310|gb|EGB26082.1| iojap-like protein [Thermoanaerobacterium xylanolyticum LX-11] Length = 120 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ L + KA DI + + + D VI SG ST HV S+ D + L + Sbjct: 11 KILKILDDKKALDIKGLYVGE-LTTVADYFVIASGTSTTHVKSLCDEISEKLAE 63 >gi|75906958|ref|YP_321254.1| Iojap-like protein [Anabaena variabilis ATCC 29413] gi|75700683|gb|ABA20359.1| Iojap-related protein [Anabaena variabilis ATCC 29413] Length = 152 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + T+ E + KA DI + S + D V+++G S V +IAD + Sbjct: 28 TESSGELALTIAEAASDRKAGDILVLRVAD-VSYLADYFVMLTGYSKVQVRAIADAIQHE 86 Query: 73 LKKK 76 ++ K Sbjct: 87 VETK 90 >gi|317057727|ref|YP_004106194.1| iojap-like protein [Ruminococcus albus 7] gi|315449996|gb|ADU23560.1| iojap-like protein [Ruminococcus albus 7] Length = 122 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + + +++ L + EDI I +++ D +I +G ST ++A+ + Sbjct: 2 AELTTEQKLEIIVKALDSKRGEDIQAIGIGD-LTILADYFIIANGGSTVQTKAMAEEVEF 60 Query: 72 YLKKK 76 L ++ Sbjct: 61 KLSQE 65 >gi|327542712|gb|EGF29181.1| Iojap-related protein [Rhodopirellula baltica WH47] Length = 169 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +D+ + + +S D VI +G S + + +I++ Sbjct: 48 LEDARKLATEAARVALDNNGQDVMVLNVSE-QSAEFDFFVIATGTSRRQLHAISEQTDDA 106 Query: 73 LKK 75 L+K Sbjct: 107 LEK 109 >gi|32473879|ref|NP_866873.1| hypothetical protein RB5749 [Rhodopirellula baltica SH 1] gi|32444415|emb|CAD74414.1| conserved hypothetical protein [Rhodopirellula baltica SH 1] Length = 187 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +D+ + + +S D VI +G S + + +I++ Sbjct: 66 LEDARKLATEAARVALDNNGQDVMVLNVSE-QSAEFDFFVIATGTSRRQLHAISEQTDDA 124 Query: 73 LKK 75 L+K Sbjct: 125 LEK 127 >gi|298480321|ref|ZP_06998519.1| iojap-like protein [Bacteroides sp. D22] gi|298273602|gb|EFI15165.1| iojap-like protein [Bacteroides sp. D22] Length = 119 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K + I + TS+ IC VI G S V++I D++ + Sbjct: 1 MNDTKVLIEKIKEGIQEKKGKKIVVADLTSIEDTICKYFVICQGNSPSQVSAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|270156752|ref|ZP_06185409.1| iojap-like protein [Legionella longbeachae D-4968] gi|289164801|ref|YP_003454939.1| hypothetical protein LLO_1467 [Legionella longbeachae NSW150] gi|269988777|gb|EEZ95031.1| iojap-like protein [Legionella longbeachae D-4968] gi|288857974|emb|CBJ11834.1| putative conserved hypothetical protein [Legionella longbeachae NSW150] Length = 109 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +A D+ I+ ++ I D M+I SGRS++HV +I+ ++ +K Sbjct: 18 NQAIDVKVIDVRK-QTTITDYMIIASGRSSRHVKAISQKIMEEMK 61 >gi|310827280|ref|YP_003959637.1| hypothetical protein ELI_1688 [Eubacterium limosum KIST612] gi|308739014|gb|ADO36674.1| hypothetical protein ELI_1688 [Eubacterium limosum KIST612] Length = 117 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V E + D+ I+ S + D VI SG S + V +IADN+ + Sbjct: 5 EPKEFAEKVKEWIDAKNGTDVEIIDIAE-VSTLGDYFVIASGNSERQVKAIADNVEYEAE 63 Query: 75 K 75 K Sbjct: 64 K 64 >gi|157829087|ref|YP_001495329.1| Iojap-related protein [Rickettsia rickettsii str. 'Sheila Smith'] gi|165933811|ref|YP_001650600.1| iojap family protein [Rickettsia rickettsii str. Iowa] gi|157801568|gb|ABV76821.1| Iojap-related protein [Rickettsia rickettsii str. 'Sheila Smith'] gi|165908898|gb|ABY73194.1| iojap protein family [Rickettsia rickettsii str. Iowa] Length = 108 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 QKETEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVGAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|254421440|ref|ZP_05035158.1| iojap family protein, putative [Synechococcus sp. PCC 7335] gi|196188929|gb|EDX83893.1| iojap family protein, putative [Synechococcus sp. PCC 7335] Length = 161 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + E + KA +I ++ + S + D VIV+G S V +IA+ + Sbjct: 38 EDAKALALMIAEAADDRKAGNITILQTGDI-SYLADYFVIVTGFSNVQVRAIANTIE 93 >gi|157826271|ref|YP_001493991.1| Iojap-related protein [Rickettsia akari str. Hartford] gi|157800229|gb|ABV75483.1| Iojap-related protein [Rickettsia akari str. Hartford] Length = 108 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKETEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVGAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|227513530|ref|ZP_03943579.1| Iojap family protein [Lactobacillus buchneri ATCC 11577] gi|227524673|ref|ZP_03954722.1| Iojap family protein [Lactobacillus hilgardii ATCC 8290] gi|227083403|gb|EEI18715.1| Iojap family protein [Lactobacillus buchneri ATCC 11577] gi|227088157|gb|EEI23469.1| Iojap family protein [Lactobacillus hilgardii ATCC 8290] Length = 118 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ +A DI ++ SL+ D VI S + V +IA+ +I ++ Sbjct: 2 DSKEISQIVVRAADSKRAHDIVVLDM-EKVSLMADYFVIADANSNRQVKAIAEEVIDQVE 60 Query: 75 KKN 77 + Sbjct: 61 AND 63 >gi|291528882|emb|CBK94468.1| iojap-related protein [Eubacterium rectale M104/1] Length = 115 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ++E L+E KAEDI ++ S I D +I +G + + ++ D + + Sbjct: 5 DLVKKIVEALEEKKAEDITVLDIGE-VSSIADYFIIANGNNANQLTAMEDAVDEAM 59 >gi|329770258|ref|ZP_08261647.1| iojap protein 155 [Gemella sanguinis M325] gi|328836962|gb|EGF86608.1| iojap protein 155 [Gemella sanguinis M325] Length = 112 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 10/61 (16%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ + V++ + DI + T+ ++ D VI +++ V +IA + + Sbjct: 2 EVENLLKIVVDACDDKHGYDIVAYDLTN-AGVLYDYSVICHASTSRQVEAIAQEVREKVL 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|302871945|ref|YP_003840581.1| iojap-like protein [Caldicellulosiruptor obsidiansis OB47] gi|302574804|gb|ADL42595.1| iojap-like protein [Caldicellulosiruptor obsidiansis OB47] Length = 110 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I +++ L + KA+DI ++ + ++I D +I S + +HV +I D + Sbjct: 1 MEQKIYEIVKLLSDKKAQDIVVLDISK-LTIIADYFIICSASNVQHVKAIVDEIEEK 56 >gi|157693063|ref|YP_001487525.1| hypothetical protein BPUM_2296 [Bacillus pumilus SAFR-032] gi|194017746|ref|ZP_03056356.1| YqeL [Bacillus pumilus ATCC 7061] gi|157681821|gb|ABV62965.1| hypothetical protein BPUM_2296 [Bacillus pumilus SAFR-032] gi|194010646|gb|EDW20218.1| YqeL [Bacillus pumilus ATCC 7061] Length = 118 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + + +AEDI + SL+ D +I G S K V +IA + + Sbjct: 2 DSSSILNVAAGACDDKRAEDIIALNM-QGISLVADYFLICHGNSDKQVQAIAREVKHLAE 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|296111269|ref|YP_003621651.1| hypothetical protein LKI_05705 [Leuconostoc kimchii IMSNU 11154] gi|295832801|gb|ADG40682.1| hypothetical protein LKI_05705 [Leuconostoc kimchii IMSNU 11154] Length = 123 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + TA ++ + T ++ + KA I ++ SL+ D VI S + V +I + Sbjct: 1 MTTALNVKEVLETAIKAVDSKKANHIVALDMRQ-VSLMADYFVIADAASNRQVQAIVTEV 59 Query: 70 ISYL 73 + Sbjct: 60 KDKV 63 >gi|114567119|ref|YP_754273.1| iojap-like protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] gi|114338054|gb|ABI68902.1| iojap-related protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen] Length = 118 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + KA D+ ++ + ++I D VI + RS V SI + + Sbjct: 1 MLKEEELAQAIAVYCLDEKAVDVVILDVSE-LTIIADYFVIATARSRVQVQSIVEMVQER 59 Query: 73 LKKKN 77 LK+ + Sbjct: 60 LKEFD 64 >gi|312127684|ref|YP_003992558.1| iojap-like protein [Caldicellulosiruptor hydrothermalis 108] gi|311777703|gb|ADQ07189.1| iojap-like protein [Caldicellulosiruptor hydrothermalis 108] Length = 110 Score = 60.1 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I +++ L + KA+DI ++ + ++I D +I S + +HV +I D + Sbjct: 1 MEQKIYEIVKLLSDKKAQDIVVLDISK-LTIIADYFIICSASNVQHVKAIVDEIEEK 56 >gi|284030278|ref|YP_003380209.1| iojap-like protein [Kribbella flavida DSM 17836] gi|283809571|gb|ADB31410.1| iojap-like protein [Kribbella flavida DSM 17836] Length = 127 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ + E + KAE++ + + I D ++ S + + V +I D + Sbjct: 1 MPASERAVELLTAAAEAAHDKKAENVLAFDVSEQL-AITDAFLVASASNDRQVRAIVDAV 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EEKLR 64 >gi|307564520|ref|ZP_07627061.1| iojap-like protein [Prevotella amnii CRIS 21A-A] gi|307346880|gb|EFN92176.1| iojap-like protein [Prevotella amnii CRIS 21A-A] Length = 119 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ +++ +++ K I + + + IC N VI G S V +IA ++ Y Sbjct: 1 MEETKRLVSLIIKGIQDKKGCGIVIADLSDIDGAICRNFVICQGSSPTQVEAIAGSVSDY 60 Query: 73 LKK 75 +++ Sbjct: 61 VRE 63 >gi|238926172|ref|ZP_04657932.1| conserved hypothetical protein [Selenomonas flueggei ATCC 43531] gi|238885852|gb|EEQ49490.1| conserved hypothetical protein [Selenomonas flueggei ATCC 43531] Length = 106 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E KA DI + L S D +I S + V +IADN+ +++ Sbjct: 2 IEAAADEKKARDIVQMNMVGLMST-NDYFIICSANTATQVRAIADNIEEKMEE 53 >gi|312135069|ref|YP_004002407.1| iojap-like protein [Caldicellulosiruptor owensensis OL] gi|311775120|gb|ADQ04607.1| iojap-like protein [Caldicellulosiruptor owensensis OL] Length = 110 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I +++ L + KA+DI ++ + ++I D +I S + +HV +I D + Sbjct: 1 MEQKIYEIVKLLSDKKAQDIVVLDISK-LTIIADYFIICSASNVQHVKAIVDEIEEK 56 >gi|73662475|ref|YP_301256.1| hypothetical protein SSP1166 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] gi|72494990|dbj|BAE18311.1| conserved hypothetical protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305] Length = 117 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D + +E + KAEDI + S + D V+ G + K V SIA + Sbjct: 2 KSDQLLKLAVEATENKKAEDIISLNM-QGISDMTDYFVVCHGNNEKQVQSIARAVKDAAN 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|291533984|emb|CBL07097.1| iojap-related protein [Megamonas hypermegale ART12/1] Length = 116 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 22/59 (37%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + + KA DI + + D ++ S + V +IADN+ + Sbjct: 4 TSQEKSQLIAKAASDKKALDIMIMNM-HDLTTTTDYFIVCSATTATQVRAIADNIEDEM 61 >gi|17231661|ref|NP_488209.1| hypothetical protein alr4169 [Nostoc sp. PCC 7120] gi|17133304|dbj|BAB75868.1| alr4169 [Nostoc sp. PCC 7120] Length = 152 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + T+ E + KA DI + S + D V+++G S V +IAD + Sbjct: 28 TESSGELALTIAEAASDRKAGDILVLRVAD-VSYLADYFVMLTGYSKVQVRAIADAIQHE 86 Query: 73 LKKK 76 ++ K Sbjct: 87 VETK 90 >gi|295398707|ref|ZP_06808729.1| Iojap family protein [Aerococcus viridans ATCC 11563] gi|294973060|gb|EFG48865.1| Iojap family protein [Aerococcus viridans ATCC 11563] Length = 119 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 + + ++ + A DI ++ + + + D VI+SGR+ + V +I D Sbjct: 2 TKKSEVLLEAIVRGADDRLATDIVALDVANT-TPMADYFVIMSGRNDRQVKAIVD 55 >gi|220928791|ref|YP_002505700.1| iojap-like protein [Clostridium cellulolyticum H10] gi|219999119|gb|ACL75720.1| iojap-like protein [Clostridium cellulolyticum H10] Length = 114 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ +++ KA+DI + ++I D VI SG S+ H+ +I D + L Sbjct: 2 DSKTLVDEIVAAMEDKKAKDISI-IDIQNITIIADYFVICSGTSSTHIKAIVDEIDFKLT 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|67459676|ref|YP_247300.1| Iojap-related protein [Rickettsia felis URRWXCal2] gi|67005209|gb|AAY62135.1| Iojap-related protein [Rickettsia felis URRWXCal2] Length = 108 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKEAEELKLFILECLNEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVGAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|34581155|ref|ZP_00142635.1| hypothetical protein [Rickettsia sibirica 246] gi|238650855|ref|YP_002916710.1| iojap superfamily protein [Rickettsia peacockii str. Rustic] gi|28262540|gb|EAA26044.1| unknown [Rickettsia sibirica 246] gi|238624953|gb|ACR47659.1| iojap superfamily protein [Rickettsia peacockii str. Rustic] Length = 108 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKETEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVGAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|27375542|ref|NP_767071.1| hypothetical protein bsr0431 [Bradyrhizobium japonicum USDA 110] gi|27348679|dbj|BAC45696.1| bsr0431 [Bradyrhizobium japonicum USDA 110] Length = 98 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +KAE+ I+ +S D M++ +GR+ +HV +IA+N+ LK+ Sbjct: 1 MKAEETVTIDLR-GKSAYSDYMIVTTGRANRHVGAIAENVTKSLKE 45 >gi|261868793|ref|YP_003256715.1| iojap-like protein [Aggregatibacter actinomycetemcomitans D11S-1] gi|261414125|gb|ACX83496.1| iojap-related protein [Aggregatibacter actinomycetemcomitans D11S-1] Length = 102 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + V+ L LKA DI + +S + D M++ +G S++HV+S+A LI+ K Sbjct: 2 SLVDFVVNKLDNLKATDILSLNV-KGKSSVTDTMILCTGTSSRHVSSLAQKLITECK 57 >gi|296393427|ref|YP_003658311.1| iojap-like protein [Segniliparus rotundus DSM 44985] gi|296180574|gb|ADG97480.1| iojap-like protein [Segniliparus rotundus DSM 44985] Length = 133 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 10/65 (15%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ A D+ I+ + I D V+ S + +HV ++ + + Sbjct: 1 MTARPEAIELARVAAAAAEDKLASDVVIIDVSERL-AITDCFVLASAPNERHVNAVVEAV 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EDALR 64 >gi|269123848|ref|YP_003306425.1| iojap-like protein [Streptobacillus moniliformis DSM 12112] gi|268315174|gb|ACZ01548.1| iojap-like protein [Streptobacillus moniliformis DSM 12112] Length = 101 Score = 60.1 bits (145), Expect = 1e-07, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ + V++ +++ K DI + RS D ++ +G ST++V +I L + Sbjct: 1 MEEIVKLVVDVIEDKKGMDIKVYDL-KGRSPFFDYSILCTGSSTRNVEAIVQELKKSM 57 >gi|15901576|ref|NP_346180.1| iojap-related protein [Streptococcus pneumoniae TIGR4] gi|111657477|ref|ZP_01408224.1| hypothetical protein SpneT_02001328 [Streptococcus pneumoniae TIGR4] gi|14973240|gb|AAK75820.1| iojap-related protein [Streptococcus pneumoniae TIGR4] Length = 117 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V++ E +AEDI ++ + + D +VI S +++ + +IA N+ + + Sbjct: 4 KELLELVVKAADEKRAEDILALDVQD-LTSVTDYLVITSSMNSRQLDAIAANIREKVAQ 61 >gi|322421675|ref|YP_004200898.1| iojap-like protein [Geobacter sp. M18] gi|320128062|gb|ADW15622.1| iojap-like protein [Geobacter sp. M18] Length = 122 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 2/62 (3%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I L + K D+ +E + S I D +V+ +GRS + V ++AD++ Sbjct: 1 MPAVERAIKCAAFAL-DKKGLDVKVLEIKKI-SSIADYLVLATGRSDRQVQAMADSVKQG 58 Query: 73 LK 74 LK Sbjct: 59 LK 60 >gi|33519773|ref|NP_878605.1| hypothetical protein Bfl310 [Candidatus Blochmannia floridanus] gi|33504118|emb|CAD83380.1| unknown function family DUF143; homolog of plant Iojap protein [Candidatus Blochmannia floridanus] Length = 101 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L +LK ++I + ++ I D M++ +GRS HV SIA +++ +K Sbjct: 2 LKNFILNYLDDLKGQNIICFDI-HNKNRITDFMILCTGRSNHHVKSIAQSILKKIK 56 >gi|304392598|ref|ZP_07374538.1| putative iojap-like protein [Ahrensia sp. R2A130] gi|303295228|gb|EFL89588.1| putative iojap-like protein [Ahrensia sp. R2A130] Length = 123 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ L + KAE++ I+ T +S + D+MV+ +GR +HV +I D L+ LK Sbjct: 2 DIILTSLDDSKAEEVTTIDIT-GKSAVADHMVVANGRVHRHVNAITDRLLRDLKD 55 >gi|303229887|ref|ZP_07316663.1| iojap-like protein [Veillonella atypica ACS-134-V-Col7a] gi|302515443|gb|EFL57409.1| iojap-like protein [Veillonella atypica ACS-134-V-Col7a] Length = 120 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + + K DI ++ S++ D +IVS + K SIAD + Sbjct: 1 MKQKEEIKQHVLVLAQAAYDKKGHDIEILDL-EGVSMLGDYFMIVSANNIKQSQSIADEI 59 Query: 70 ISYLKKK 76 ++ Sbjct: 60 EDIAAEQ 66 >gi|313673217|ref|YP_004051328.1| iojap-like protein [Calditerrivibrio nitroreducens DSM 19672] gi|312939973|gb|ADR19165.1| iojap-like protein [Calditerrivibrio nitroreducens DSM 19672] Length = 111 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + + E L E AE++ + S I D ++I +G S H+ S+AD K+ Sbjct: 2 IEEVLRKIKEKLLEKMAENVVIYKIKE-VSSIADYLIICTGNSDTHIKSLADYAEEVCKE 60 Query: 76 KN 77 +N Sbjct: 61 QN 62 >gi|186684461|ref|YP_001867657.1| iojap-like protein [Nostoc punctiforme PCC 73102] gi|186466913|gb|ACC82714.1| iojap-like protein [Nostoc punctiforme PCC 73102] Length = 152 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 16/76 (21%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 + + K T + AT+ E + KA +I ++ S + D V+++G S Sbjct: 16 LTKSVVKSHAHTEEESGKLAATIAEAASDRKAGEILLLKVAE-VSYLADYFVMMTGYSRV 74 Query: 61 HVASIADNLISYLKKK 76 V +IA + ++ + Sbjct: 75 QVRAIAQAIEGKVETE 90 >gi|160880676|ref|YP_001559644.1| iojap-like protein [Clostridium phytofermentans ISDg] gi|160429342|gb|ABX42905.1| iojap-like protein [Clostridium phytofermentans ISDg] Length = 120 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + L++ KAEDI IE ++ S+I D VI +G + V ++ + L K Sbjct: 5 SKEMVRLAFKALEDKKAEDIKVIEIGNI-SVIADYFVIANGNNPSQVEAMVGAVDEELAK 63 Query: 76 K 76 Sbjct: 64 N 64 >gi|330813469|ref|YP_004357708.1| iojap protein [Candidatus Pelagibacter sp. IMCC9063] gi|327486564|gb|AEA80969.1| iojap protein [Candidatus Pelagibacter sp. IMCC9063] Length = 118 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + S ++ + + L + KA +I I+ +S I D M++ SG S++H+ SI + L Sbjct: 4 EKKTSLVSIIKKILDDNKATNIVTIDLKD-KSSIADYMIVASGTSSRHIQSITEITAQEL 62 Query: 74 K 74 K Sbjct: 63 K 63 >gi|222529244|ref|YP_002573126.1| iojap-like protein [Caldicellulosiruptor bescii DSM 6725] gi|312622509|ref|YP_004024122.1| iojap-like protein [Caldicellulosiruptor kronotskyensis 2002] gi|222456091|gb|ACM60353.1| iojap-like protein [Caldicellulosiruptor bescii DSM 6725] gi|312202976|gb|ADQ46303.1| iojap-like protein [Caldicellulosiruptor kronotskyensis 2002] Length = 110 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I +++ L + KA+DI ++ + ++I D +I S + +HV +I D + Sbjct: 1 MEQKIYEIVKLLSDKKAQDIVVLDISK-LTIIADYFIICSASNVQHVKAIVDEIEEK 56 >gi|320528082|ref|ZP_08029247.1| ribosome-associated protein, iojap family [Solobacterium moorei F0204] gi|320131430|gb|EFW23995.1| ribosome-associated protein, iojap family [Solobacterium moorei F0204] Length = 110 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + V L+E AE+I I+ + + D VI + ++ +H S+ + + + K Sbjct: 1 MSELLNLVRHTLEEKLAENIVTIDIRN-VNAYTDYYVICTAKNPRHANSLVEFVEKEVTK 59 Query: 76 K 76 Sbjct: 60 N 60 >gi|241888874|ref|ZP_04776180.1| iojap homolog [Gemella haemolysans ATCC 10379] gi|241864550|gb|EER68926.1| iojap homolog [Gemella haemolysans ATCC 10379] Length = 112 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 10/62 (16%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +++ + V++ + DI + T ++ D VI + + V +IA + + Sbjct: 2 EVENLLKVVVDACDDKHGYDIVAYDLTQ-AGVLYDYSVICHAPTNRQVEAIAQEVREQVL 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|108800495|ref|YP_640692.1| Iojap-related protein [Mycobacterium sp. MCS] gi|119869634|ref|YP_939586.1| iojap-like protein [Mycobacterium sp. KMS] gi|108770914|gb|ABG09636.1| Iojap-related protein [Mycobacterium sp. MCS] gi|119695723|gb|ABL92796.1| iojap-like protein [Mycobacterium sp. KMS] Length = 122 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +D A+D+ I+ S + +I D VI S + + V +I D + Sbjct: 1 MTASDEAIQMATVAARAASSKLADDVVVIDV-SGQLVITDCFVIASASNERQVNAIVDEV 59 Query: 70 ISYLK 74 ++ Sbjct: 60 EEKMR 64 >gi|312793433|ref|YP_004026356.1| iojap-like protein [Caldicellulosiruptor kristjanssonii 177R1B] gi|312876050|ref|ZP_07736039.1| iojap-like protein [Caldicellulosiruptor lactoaceticus 6A] gi|311797248|gb|EFR13588.1| iojap-like protein [Caldicellulosiruptor lactoaceticus 6A] gi|312180573|gb|ADQ40743.1| iojap-like protein [Caldicellulosiruptor kristjanssonii 177R1B] Length = 110 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I +++ L + KA+DI ++ + ++I D +I S + +HV +I D + Sbjct: 1 MEQKIYEIVKLLSDKKAQDIVVLDISK-LTIIADYFIICSASNVQHVKAIVDEIEEK 56 >gi|303232080|ref|ZP_07318783.1| iojap-like protein [Veillonella atypica ACS-049-V-Sch6] gi|302513186|gb|EFL55225.1| iojap-like protein [Veillonella atypica ACS-049-V-Sch6] Length = 120 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + + K DI ++ S++ D +IVS + K SIAD + Sbjct: 1 MKQKEEIKQHVLALAQAAYDKKGHDIEILDL-EGVSMLGDYFMIVSANNIKQSQSIADEI 59 Query: 70 ISYLKKK 76 ++ Sbjct: 60 EDIAAEQ 66 >gi|229587174|ref|YP_002845675.1| Iojap-related protein [Rickettsia africae ESF-5] gi|228022224|gb|ACP53932.1| Iojap-related protein [Rickettsia africae ESF-5] Length = 108 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKETEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVGAIAEYIALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|322378495|ref|ZP_08052946.1| hypothetical protein HSUHS1_0159 [Helicobacter suis HS1] gi|321149097|gb|EFX43546.1| hypothetical protein HSUHS1_0159 [Helicobacter suis HS1] Length = 125 Score = 59.7 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K + IA + L++ KA DI + ++ I D ++I + KH S+ Sbjct: 12 KPLRKPMPT---RIARIATLLEDKKATDIVVFDLCQ-QNYITDYVIIATALVGKHALSLL 67 Query: 67 DNLISYLK 74 D+L + LK Sbjct: 68 DHLKTNLK 75 >gi|325107030|ref|YP_004268098.1| iojap-like protein [Planctomyces brasiliensis DSM 5305] gi|324967298|gb|ADY58076.1| iojap-like protein [Planctomyces brasiliensis DSM 5305] Length = 167 Score = 59.3 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 12/56 (21%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ELK DI ++ T++ + D VI +G S + + +I + + + + Sbjct: 51 ELACRCAKTADELKGGDIKVLDLTNI-TAEFDYFVIATGNSRRQLHAIVEEIDTEM 105 >gi|317495819|ref|ZP_07954182.1| hypothetical protein HMPREF0432_00785 [Gemella moribillum M424] gi|316913996|gb|EFV35479.1| hypothetical protein HMPREF0432_00785 [Gemella moribillum M424] Length = 112 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + V++ + DI + TS ++ D VI +++ V +IA+ + + Sbjct: 2 QIEELLKVVVDACDDKHGYDIVAYDLTS-AGVLYDYSVICHAPTSRQVEAIAEEVREKVL 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|259047026|ref|ZP_05737427.1| iojap-related protein [Granulicatella adiacens ATCC 49175] gi|259036345|gb|EEW37600.1| iojap-related protein [Granulicatella adiacens ATCC 49175] Length = 118 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V++ ++ A+++ ++ S + + + VI G++ K V +I D + ++ Sbjct: 4 TSKKLLQVVLDACEDKLAQEVVALDVAS-LTPVAEYFVITHGKNEKQVQAIVDAVEEAVE 62 Query: 75 KK 76 K+ Sbjct: 63 KE 64 >gi|157826402|ref|YP_001495466.1| Iojap-related protein [Rickettsia bellii OSU 85-389] gi|157801706|gb|ABV78429.1| Iojap-related protein [Rickettsia bellii OSU 85-389] Length = 124 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ S ++ I D ++ +GRSTK+V +IA+ + Sbjct: 18 KKESEELKLFILECLNEKKAEDIDVIDL-SGKNKIADYIIFANGRSTKNVGAIAEYVALE 76 Query: 73 LKKK 76 LK K Sbjct: 77 LKNK 80 >gi|52425889|ref|YP_089026.1| hypothetical protein MS1834 [Mannheimia succiniciproducens MBEL55E] gi|52307941|gb|AAU38441.1| unknown [Mannheimia succiniciproducens MBEL55E] Length = 102 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 21/58 (36%), Positives = 36/58 (62%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +++ L LKA +I I+ +S + DNM+I +G S++HVAS+A LI K+ Sbjct: 2 NLVDFLVDKLDALKATEIECIDVR-GKSSVTDNMIICTGSSSRHVASVAQKLIDESKQ 58 >gi|83589431|ref|YP_429440.1| Iojap-related protein [Moorella thermoacetica ATCC 39073] gi|83572345|gb|ABC18897.1| Iojap-related protein [Moorella thermoacetica ATCC 39073] Length = 115 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + E K D ++ +LI D VI SG ST V +IA + L Sbjct: 2 DAGRVAQLAAQAVLEKKGIDPVILDL-QGITLIADYFVIASGTSTVQVQAIAGRVEEIL 59 >gi|304440690|ref|ZP_07400574.1| iojap-like protein [Peptoniphilus duerdenii ATCC BAA-1640] gi|304370877|gb|EFM24499.1| iojap-like protein [Peptoniphilus duerdenii ATCC BAA-1640] Length = 113 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ++ DI ++ S + D VIVSG S+ V ++AD + + Sbjct: 2 DTNKKLEIIKKSCEDKLGIDIKILDIKR-LSSVADYFVIVSGNSSNQVRALADEIEDKMA 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|291546184|emb|CBL19292.1| iojap-related protein [Ruminococcus sp. SR1/5] Length = 121 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + L + KA+DI I+ S+I D VI S + V ++ DN L Sbjct: 5 KEMVRIACKALDDKKAKDIKIIDI-HEVSVIADYFVIASASNQNQVQAMVDNADEML 60 >gi|270307763|ref|YP_003329821.1| hypothetical protein DhcVS_335 [Dehalococcoides sp. VS] gi|270153655|gb|ACZ61493.1| hypothetical protein DhcVS_335 [Dehalococcoides sp. VS] Length = 116 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ E +AEDI ++ L S C+ V++SG S + +++IAD + K Sbjct: 4 ESIDIARQMVSIASEKQAEDIVLLDVRELVSY-CNYFVLMSGASGRQLSAIADTVEKTFK 62 >gi|262340998|ref|YP_003283853.1| hypothetical protein BLBBGE_222 [Blattabacterium sp. (Blattella germanica) str. Bge] gi|262272335|gb|ACY40243.1| hypothetical protein BLBBGE_222 [Blattabacterium sp. (Blattella germanica) str. Bge] Length = 106 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + ++E +K +K EDI I + + ICD VI +G S V +I+ ++ Sbjct: 2 LLKKIIEGIKMVKGEDIFIINLKNRENFICDYFVICNGNSQNQVYAISQSIEK 54 >gi|157804189|ref|YP_001492738.1| Iojap-related protein [Rickettsia canadensis str. McKiel] gi|157785452|gb|ABV73953.1| Iojap-related protein [Rickettsia canadensis str. McKiel] Length = 108 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKAAEELKLFILECLSEKKAEDIEVIDLT-GKHKLADYIIFASGRSTKNVEAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|126436111|ref|YP_001071802.1| iojap-like protein [Mycobacterium sp. JLS] gi|126235911|gb|ABN99311.1| iojap-like protein [Mycobacterium sp. JLS] Length = 133 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +D A+D+ I+ S + +I D VI S + + V +I D + Sbjct: 1 MTASDEAIQMATVAARAASSKLADDVVVIDV-SGQLVITDCFVIASASNERQVNAIVDEV 59 Query: 70 ISYLK 74 ++ Sbjct: 60 EEKMR 64 >gi|304384431|ref|ZP_07366836.1| iojap-like protein [Prevotella marshii DSM 16973] gi|304334483|gb|EFM00771.1| iojap-like protein [Prevotella marshii DSM 16973] Length = 119 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 28/64 (43%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + ++ + ++E K I + + IC V+ G S + V +IA+ + Sbjct: 1 METTERLVESITKGIQEKKGRGIVIADLKEIDGAICRYFVVCQGNSPQQVEAIAEAIGDS 60 Query: 73 LKKK 76 + + Sbjct: 61 ARTE 64 >gi|322384955|ref|ZP_08058611.1| hypothetical protein PL1_1780 [Paenibacillus larvae subsp. larvae B-3650] gi|321150252|gb|EFX43759.1| hypothetical protein PL1_1780 [Paenibacillus larvae subsp. larvae B-3650] Length = 115 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +++ +++ KA D+ ++ SLI D VI G S V +IA + Sbjct: 6 EKVMTRLVQAVEDKKAMDVVTLDLR-GISLIADYFVICHGNSDTQVQAIATEAKKLADE 63 >gi|167746512|ref|ZP_02418639.1| hypothetical protein ANACAC_01222 [Anaerostipes caccae DSM 14662] gi|317471327|ref|ZP_07930684.1| hypothetical protein HMPREF1011_01032 [Anaerostipes sp. 3_2_56FAA] gi|167653472|gb|EDR97601.1| hypothetical protein ANACAC_01222 [Anaerostipes caccae DSM 14662] gi|316901191|gb|EFV23148.1| hypothetical protein HMPREF1011_01032 [Anaerostipes sp. 3_2_56FAA] Length = 117 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L+E AE+I ++ + S+I D +I +G++ V +I DN+ Sbjct: 1 MNQSLEMTKIAYQALEEKLAEEIKVLDIRQI-SVIADYFIIANGKNKNQVQAIVDNVQDA 59 Query: 73 LKK 75 L+K Sbjct: 60 LQK 62 >gi|219871412|ref|YP_002475787.1| plant Iojap-like protein [Haemophilus parasuis SH0165] gi|219691616|gb|ACL32839.1| plant Iojap-like protein [Haemophilus parasuis SH0165] Length = 104 Score = 59.3 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + E L+ LKA+DI I+ +S I + M++ +G S++HVAS ADNLI KK Sbjct: 4 NLVQFLTETLEGLKAQDIQAIDVR-GKSSITETMIVCTGTSSRHVASTADNLIVESKK 60 >gi|328554298|gb|AEB24790.1| hypothetical protein BAMTA208_13145 [Bacillus amyloliquefaciens TA208] Length = 118 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + + EDI ++ SL+ D +I G S K V +IA + ++ Sbjct: 7 LKIAAKACDDKRTEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQAEEN 62 >gi|317506544|ref|ZP_07964340.1| hypothetical protein HMPREF9336_00710 [Segniliparus rugosus ATCC BAA-974] gi|316255160|gb|EFV14434.1| hypothetical protein HMPREF9336_00710 [Segniliparus rugosus ATCC BAA-974] Length = 134 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ A D+ I+ + I D VI S + +HV +I + + Sbjct: 1 MTATPEAVDLARIAAAAAEDKLASDVVIIDVSERL-AITDCFVIASAPNERHVNAIVEAV 59 Query: 70 ISYLKK 75 +++ Sbjct: 60 DEAVRR 65 >gi|225021702|ref|ZP_03710894.1| hypothetical protein CORMATOL_01730 [Corynebacterium matruchotii ATCC 33806] gi|305681005|ref|ZP_07403812.1| iojap-like protein [Corynebacterium matruchotii ATCC 14266] gi|224945693|gb|EEG26902.1| hypothetical protein CORMATOL_01730 [Corynebacterium matruchotii ATCC 33806] gi|305659210|gb|EFM48710.1| iojap-like protein [Corynebacterium matruchotii ATCC 14266] Length = 154 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + T++ E A DI I+ +S+ IC+ V+ S + + V +I D + Sbjct: 1 MTTSEDTKELAIVAARAAHEKLATDIALIDVSSVM-DICEIFVVASADNERQVRAIVDEV 59 Query: 70 ISYLKK 75 L K Sbjct: 60 EDELAK 65 >gi|332879984|ref|ZP_08447668.1| iojap-like protein [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332681980|gb|EGJ54893.1| iojap-like protein [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 114 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 31/59 (52%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 I ++ ++++K DI ++ + + +CD ++ +G S VA+I+ + + + + Sbjct: 1 MITNIIAGIEKVKGTDITIMDLREVENTVCDYFILCNGSSNTQVAAISGAIQRVVSQAD 59 >gi|160886814|ref|ZP_02067817.1| hypothetical protein BACOVA_04827 [Bacteroides ovatus ATCC 8483] gi|237719263|ref|ZP_04549744.1| conserved hypothetical protein [Bacteroides sp. 2_2_4] gi|260171829|ref|ZP_05758241.1| hypothetical protein BacD2_08188 [Bacteroides sp. D2] gi|315920141|ref|ZP_07916381.1| conserved hypothetical protein [Bacteroides sp. D2] gi|156107225|gb|EDO08970.1| hypothetical protein BACOVA_04827 [Bacteroides ovatus ATCC 8483] gi|229451642|gb|EEO57433.1| conserved hypothetical protein [Bacteroides sp. 2_2_4] gi|313694016|gb|EFS30851.1| conserved hypothetical protein [Bacteroides sp. D2] Length = 119 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K + I + TS+ IC VI G S V++I D++ + Sbjct: 1 MNDTKVLIEKIKEGIQEKKGKKIIVADLTSIEDTICKYFVICQGNSPSQVSAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|89895905|ref|YP_519392.1| hypothetical protein DSY3159 [Desulfitobacterium hafniense Y51] gi|219670335|ref|YP_002460770.1| iojap-like protein [Desulfitobacterium hafniense DCB-2] gi|89335353|dbj|BAE84948.1| hypothetical protein [Desulfitobacterium hafniense Y51] gi|219540595|gb|ACL22334.1| iojap-like protein [Desulfitobacterium hafniense DCB-2] Length = 112 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D + + +++ K + ++ S++ D +I +G ST V +I DNL L + Sbjct: 3 TDKQLHGAVNLVEDKKGRETILLDL-KGISMVTDYFLITTGNSTTQVKAITDNLSEKLPE 61 >gi|322437310|ref|YP_004219522.1| iojap-like protein [Acidobacterium sp. MP5ACTX9] gi|321165037|gb|ADW70742.1| iojap-like protein [Acidobacterium sp. MP5ACTX9] Length = 181 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/49 (26%), Positives = 24/49 (48%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ KAEDI + S + D +I +G + + +I D + LK + Sbjct: 18 EDKKAEDIRILALDPSESGLTDYFLICNGTNDRQNVAITDAIEIKLKHE 66 >gi|297170275|gb|ADI21312.1| uncharacterized homolog of plant Iojap protein [uncultured gamma proteobacterium HF0010_09F21] Length = 113 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 18/66 (27%), Positives = 31/66 (46%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + ++ ELKA DI + S ++I +G S +H+ SIAD + Sbjct: 1 MVYKDSSEKIKKICLKTFDELKANDIKELNI-EKISSFATYLLIATGTSNRHIKSIADKV 59 Query: 70 ISYLKK 75 + LK+ Sbjct: 60 VDDLKE 65 >gi|328912694|gb|AEB64290.1| hypothetical protein LL3_02758 [Bacillus amyloliquefaciens LL3] Length = 120 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + + EDI ++ SL+ D +I G S K V +IA + ++ Sbjct: 9 LKIAAKACDDKRTEDILALDM-EGISLVADYFLICHGNSDKQVQAIAREIKDQAEEN 64 >gi|291544320|emb|CBL17429.1| iojap-related protein [Ruminococcus sp. 18P13] Length = 119 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L + E+I +E + +++ D VIV+G S HV ++AD L Sbjct: 2 TAKEKLEVIVRALDMKRGENIQVLEISD-LTILADYFVIVNGTSNTHVKTLADEAEFKLS 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|284054164|ref|ZP_06384374.1| iojap-like protein [Arthrospira platensis str. Paraca] Length = 109 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 26 CLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + KA++I ++ T S + D +IV+G S V +I +I ++++N Sbjct: 5 AADDRKADNIKLLKVTE-VSYLADYFLIVTGFSNTQVRAIHQAIIQKVEEEN 55 >gi|167856212|ref|ZP_02478948.1| hypothetical protein HPS_02935 [Haemophilus parasuis 29755] gi|167852667|gb|EDS23945.1| hypothetical protein HPS_02935 [Haemophilus parasuis 29755] Length = 104 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 24/58 (41%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + E L+ LKA+DI I+ +S I + M++ +G S++HVAS ADNLI KK Sbjct: 4 NLVQFLTETLEGLKAQDIQAIDVR-GKSSITETMIVCTGTSSRHVASTADNLIVESKK 60 >gi|15604643|ref|NP_221161.1| hypothetical protein RP811 [Rickettsia prowazekii str. Madrid E] gi|3861338|emb|CAA15237.1| unknown [Rickettsia prowazekii] gi|292572462|gb|ADE30377.1| Iojap-related protein [Rickettsia prowazekii Rp22] Length = 108 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ ++ + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKETEELKLFILECLIEKKAEDIEVIDLR-GKNKLADYIIFASGRSTKNVGAIAEYVALA 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|160903278|ref|YP_001568859.1| iojap-like protein [Petrotoga mobilis SJ95] gi|160360922|gb|ABX32536.1| iojap-like protein [Petrotoga mobilis SJ95] Length = 115 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 35/63 (55%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + ++E L+E E+I ++ + L+ D VIV+G S H ++ D ++ YLK Sbjct: 5 DVLNSVKEIVELLEEKDGENIVVLDMENSE-LMVDYFVIVTGNSEPHRVALRDQVVRYLK 63 Query: 75 KKN 77 ++ Sbjct: 64 DED 66 >gi|86607564|ref|YP_476326.1| iojap-like protein [Synechococcus sp. JA-2-3B'a(2-13)] gi|86556106|gb|ABD01063.1| iojap-like protein [Synechococcus sp. JA-2-3B'a(2-13)] Length = 123 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +E K DI ++ + S + D ++VSG S V +IA + + + Sbjct: 16 AARAAEEKKGGDIVLLDVSQ-VSTLADYFLLVSGYSLTQVRAIARAIEEKVWDE 68 >gi|257791753|ref|YP_003182359.1| iojap-like protein [Eggerthella lenta DSM 2243] gi|317487776|ref|ZP_07946369.1| hypothetical protein HMPREF1023_00067 [Eggerthella sp. 1_3_56FAA] gi|325831777|ref|ZP_08164966.1| iojap-like protein [Eggerthella sp. HGA1] gi|257475650|gb|ACV55970.1| iojap-like protein [Eggerthella lenta DSM 2243] gi|316913051|gb|EFV34567.1| hypothetical protein HMPREF1023_00067 [Eggerthella sp. 1_3_56FAA] gi|325486446|gb|EGC88896.1| iojap-like protein [Eggerthella sp. HGA1] Length = 142 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 16/66 (24%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 T C E KA DI E L + D VI + + + V +I D + Sbjct: 5 TTEKTSRECALIAACAADEKKATDIMVQEVRDLIG-VTDYFVIATASNNRQVEAIIDEIE 63 Query: 71 SYLKKK 76 ++ K Sbjct: 64 DAVRTK 69 >gi|299148333|ref|ZP_07041395.1| iojap-like protein [Bacteroides sp. 3_1_23] gi|298513094|gb|EFI36981.1| iojap-like protein [Bacteroides sp. 3_1_23] Length = 119 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 17/63 (26%), Positives = 30/63 (47%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + I + E ++E K + I + TS+ IC VI G S V++I D++ + Sbjct: 1 MNDTKVLIEKIKEGIQEKKGKKIIVADLTSIEDTICKYFVICQGNSPSQVSAIVDSIKEF 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|163852288|ref|YP_001640331.1| iojap-like protein [Methylobacterium extorquens PA1] gi|218531046|ref|YP_002421862.1| iojap-like protein [Methylobacterium chloromethanicum CM4] gi|240139624|ref|YP_002964100.1| hypothetical protein MexAM1_META1p3075 [Methylobacterium extorquens AM1] gi|163663893|gb|ABY31260.1| iojap-like protein [Methylobacterium extorquens PA1] gi|218523349|gb|ACK83934.1| iojap-like protein [Methylobacterium chloromethanicum CM4] gi|240009597|gb|ACS40823.1| Conserved hypothetical protein, Iojap family protein [Methylobacterium extorquens AM1] Length = 100 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +KAE+ I+ ++ + D M+I SGRS +HV SIAD +I +K K Sbjct: 1 MKAEETVEIDLA-GKTSLADTMIIASGRSQRHVGSIADKIIQEMKAK 46 >gi|15893176|ref|NP_360890.1| hypothetical protein RC1253 [Rickettsia conorii str. Malish 7] gi|15620388|gb|AAL03791.1| unknown [Rickettsia conorii str. Malish 7] Length = 108 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ T + + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKETEELKLFILECLSEKKAEDIEVIDLTE-KHKLADYIIFASGRSTKNVGAIAEYVALE 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|86605296|ref|YP_474059.1| iojap protein [Synechococcus sp. JA-3-3Ab] gi|86553838|gb|ABC98796.1| iojap protein [Synechococcus sp. JA-3-3Ab] Length = 112 Score = 58.9 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +E K DI ++ + + S + D +++SG S V +IA + + ++ Sbjct: 5 AARAAEEKKGGDIVLLDVSQI-STLADYFLLISGYSLTQVRAIARAIEEKVWEE 57 >gi|167756984|ref|ZP_02429111.1| hypothetical protein CLORAM_02533 [Clostridium ramosum DSM 1402] gi|167703159|gb|EDS17738.1| hypothetical protein CLORAM_02533 [Clostridium ramosum DSM 1402] Length = 130 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L + AEDI I+ L S I D VI S + + + ++ D++ + Sbjct: 20 LEVIIKALDDKLAEDIVVIDM-QLASPIFDTFVICSASNERLMNALRDSVEDSCHEN 75 >gi|261749485|ref|YP_003257171.1| hypothetical protein BPLAN_414 [Blattabacterium sp. (Periplaneta americana) str. BPLAN] gi|261497578|gb|ACX84028.1| conserved hypothetical protein [Blattabacterium sp. (Periplaneta americana) str. BPLAN] Length = 106 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 31/62 (50%), Gaps = 4/62 (6%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI----SYLK 74 + ++E ++ +K EDI + + + +CD ++ +G S V +I ++ LK Sbjct: 2 LLKKIIEGIQMVKGEDISVLNLKNRNNFVCDYFIVCNGESQNQVYAIYRSIEKITVEKLK 61 Query: 75 KK 76 ++ Sbjct: 62 ER 63 >gi|160871877|ref|ZP_02062009.1| putative iojap homolog [Rickettsiella grylli] gi|159120676|gb|EDP46014.1| putative iojap homolog [Rickettsiella grylli] Length = 114 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ L + KA++I + + + I D+++I +G S +HV ++A LI+ K K Sbjct: 8 KELQTDLVRLLADHKAKNITVLNVSQ-LTDITDHLIICTGNSNRHVKTLAQYLITAAKAK 66 Query: 77 N 77 N Sbjct: 67 N 67 >gi|224476700|ref|YP_002634306.1| hypothetical protein Sca_1214 [Staphylococcus carnosus subsp. carnosus TM300] gi|222421307|emb|CAL28121.1| conserved hypothetical protein [Staphylococcus carnosus subsp. carnosus TM300] Length = 116 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +E ++ +AE++ + + + D VI G + + V +IA + K Sbjct: 4 EEILKLAVEAVESKRAEEVISLNL-EGINDMADYFVICHGNNERQVQAIARAVKEAADK 61 >gi|193213783|ref|YP_001994982.1| iojap-like protein [Chloroherpeton thalassium ATCC 35110] gi|193087260|gb|ACF12535.1| iojap-like protein [Chloroherpeton thalassium ATCC 35110] Length = 154 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 12/73 (16%), Positives = 28/73 (38%), Gaps = 1/73 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 ++ + + + + E K D+ ++ + + D VI + S V Sbjct: 27 TSSSQPSAHLSSEAELLARRAAELAFSKKGYDVVIMDLRK-VAEMTDFFVICTADSDTQV 85 Query: 63 ASIADNLISYLKK 75 ++AD +I L + Sbjct: 86 KAVADAIIEGLHE 98 >gi|254562034|ref|YP_003069129.1| hypothetical protein METDI3639 [Methylobacterium extorquens DM4] gi|254269312|emb|CAX25278.1| Conserved hypothetical protein, Iojap family protein [Methylobacterium extorquens DM4] Length = 100 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 20/47 (42%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +KAE+ I+ ++ + D M+I SGRS +HV SIAD +I +K K Sbjct: 1 MKAEETVEIDLA-GKTSLADAMIIASGRSQRHVGSIADKIIQEMKAK 46 >gi|237732930|ref|ZP_04563411.1| conserved hypothetical protein [Mollicutes bacterium D7] gi|229383999|gb|EEO34090.1| conserved hypothetical protein [Coprobacillus sp. D7] Length = 120 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L + AEDI I+ L S I D VI S + + + ++ D++ + Sbjct: 10 LEVIIKALDDKLAEDIVVIDM-QLASPIFDTFVICSASNERLMNALRDSVEDSCHEN 65 >gi|307718719|ref|YP_003874251.1| hypothetical protein STHERM_c10320 [Spirochaeta thermophila DSM 6192] gi|306532444|gb|ADN01978.1| hypothetical protein STHERM_c10320 [Spirochaeta thermophila DSM 6192] gi|315185750|gb|EFU19516.1| iojap-like protein [Spirochaeta thermophila DSM 6578] Length = 123 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + E L++ KA D+ ++ S I D VI + +S H+ + L ++ ++K Sbjct: 11 VREIAEFLEDHKARDVVALDLR-GISPIADFFVIATFQSEGHLRGLLGQLTTFCEEK 66 >gi|258647439|ref|ZP_05734908.1| iojap-like protein [Prevotella tannerae ATCC 51259] gi|260852705|gb|EEX72574.1| iojap-like protein [Prevotella tannerae ATCC 51259] Length = 119 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 31/63 (49%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + T+++ ++E KA D+ ++ + + + V+ + S + V ++A ++ Sbjct: 1 MNSTPEIVNTIVQGMQEKKAFDVTIVDLRKIDTAPAEYFVLCNAGSPQQVEAVAGSVSDE 60 Query: 73 LKK 75 +K Sbjct: 61 TRK 63 >gi|189499115|ref|YP_001958585.1| iojap-like protein [Chlorobium phaeobacteroides BS1] gi|189494556|gb|ACE03104.1| iojap-like protein [Chlorobium phaeobacteroides BS1] Length = 143 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E E K +D+ ++ S + D VI + S + + ++++ LK Sbjct: 22 SELLAKRAAELSLERKCDDVVILDVRD-VSAVTDFFVIATADSERKAKAAYEHIVDELKH 80 Query: 76 KN 77 ++ Sbjct: 81 ED 82 >gi|315651834|ref|ZP_07904837.1| Iojap family protein [Eubacterium saburreum DSM 3986] gi|315485836|gb|EFU76215.1| Iojap family protein [Eubacterium saburreum DSM 3986] Length = 112 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L + + + +++ K +DI I+ + + S I D +I + V +I+D + L Sbjct: 2 ELKEIVKKIYKIIEDKKGDDIKVIDISKI-SSIADYFIIAGANNINQVQAISDEIDFILG 60 Query: 75 KK 76 K+ Sbjct: 61 KE 62 >gi|225425859|ref|XP_002266055.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 186 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + L ++KA+DI I CD MVI +GRS+ HV +IA LI K+K Sbjct: 52 LQEIEQILSDVKADDIRVIPVRQH----CDFMVIATGRSSWHVKNIAQALIYKAKQK 104 >gi|269797879|ref|YP_003311779.1| iojap-like protein [Veillonella parvula DSM 2008] gi|269094508|gb|ACZ24499.1| iojap-like protein [Veillonella parvula DSM 2008] Length = 120 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 29/66 (43%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ + + + + + + K DI ++ S++ D +I+S ++K SI D + Sbjct: 1 MKKKEDIKQIVLELAQAAFDKKGRDIEILDL-DGISMLGDYFLIISANNSKQSQSITDEM 59 Query: 70 ISYLKK 75 + Sbjct: 60 EDKAAE 65 >gi|320335706|ref|YP_004172417.1| iojap-like protein [Deinococcus maricopensis DSM 21211] gi|319756995|gb|ADV68752.1| iojap-like protein [Deinococcus maricopensis DSM 21211] Length = 123 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + +++ +E +AED+ ++ T + S + D VI + + + ++ N+ Sbjct: 10 QQLRVIVDAARERRAEDVVVLDLTQVSSTL-DYFVICTATAGLQLNAVQQNIRDQA 64 >gi|300361208|ref|ZP_07057385.1| iojap-like protein [Lactobacillus gasseri JV-V03] gi|300353827|gb|EFJ69698.1| iojap-like protein [Lactobacillus gasseri JV-V03] Length = 115 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 10/62 (16%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E + E ED + S++ D V+ + S + + +I +++I + Sbjct: 2 DSKKLLDLTVEAIDERHGEDTEAYDM-QGISILADYYVVTTAGSNRQLHAIVNSIIDKIH 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|217966811|ref|YP_002352317.1| iojap-like protein [Dictyoglomus turgidum DSM 6724] gi|217335910|gb|ACK41703.1| iojap-like protein [Dictyoglomus turgidum DSM 6724] Length = 116 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 31/66 (46%), Gaps = 2/66 (3%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + + E KAE++ I+ + + + D +VI +G + +I ++ Sbjct: 1 MNFLESKEKALR-IARIVLEKKAENVIIIDVSQIPG-LTDYLVICTGLTNTQRKAIQRSV 58 Query: 70 ISYLKK 75 ++K Sbjct: 59 EEEMEK 64 >gi|220909910|ref|YP_002485221.1| iojap-like protein [Cyanothece sp. PCC 7425] gi|219866521|gb|ACL46860.1| iojap-like protein [Cyanothece sp. PCC 7425] Length = 138 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/62 (17%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 T+ + K +I ++ + S + D ++V+G S V +IA +++ Sbjct: 23 SSRELALTIAHTADDRKGGNILVLQVGDI-SYLTDFFIVVTGFSKTQVRAIAQAIVAATT 81 Query: 75 KK 76 ++ Sbjct: 82 EQ 83 >gi|238853784|ref|ZP_04644150.1| iojap family protein [Lactobacillus gasseri 202-4] gi|282851353|ref|ZP_06260718.1| iojap-like protein [Lactobacillus gasseri 224-1] gi|311110341|ref|ZP_07711738.1| iojap-like protein [Lactobacillus gasseri MV-22] gi|238833593|gb|EEQ25864.1| iojap family protein [Lactobacillus gasseri 202-4] gi|282557321|gb|EFB62918.1| iojap-like protein [Lactobacillus gasseri 224-1] gi|311065495|gb|EFQ45835.1| iojap-like protein [Lactobacillus gasseri MV-22] Length = 115 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 10/62 (16%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E + E ED + S++ D V+ + S + + +I +++I + Sbjct: 2 DSKKLLDLTVEAIDERHGEDTEAYDM-QGISILADYYVVTTAGSNRQLHAIVNSIIDKIH 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|269957037|ref|YP_003326826.1| iojap-like protein [Xylanimonas cellulosilytica DSM 15894] gi|269305718|gb|ACZ31268.1| iojap-like protein [Xylanimonas cellulosilytica DSM 15894] Length = 130 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + LKA++I ++ + ++ D +I SG + + V++I D + Sbjct: 1 MTATERAVELAVVAARAASNLKADEIIALDVSEQL-VLTDVFLIASGTNERQVSAIVDAV 59 Query: 70 ISYL 73 + Sbjct: 60 EEAM 63 >gi|119944893|ref|YP_942573.1| iojap-like protein [Psychromonas ingrahamii 37] gi|119863497|gb|ABM02974.1| iojap-like protein [Psychromonas ingrahamii 37] Length = 108 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V++ L++ KA+DI I+ ++ S + D M+I +G S +HV S+A+ K Sbjct: 5 QLKKFVLQHLEDFKAKDITVIDVSAT-SDVTDTMIICTGNSKRHVRSVAEQTALAAK 60 >gi|331002192|ref|ZP_08325711.1| iojap protein 155 [Lachnospiraceae oral taxon 107 str. F0167] gi|330411286|gb|EGG90702.1| iojap protein 155 [Lachnospiraceae oral taxon 107 str. F0167] Length = 112 Score = 58.2 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + +++ K EDI I+ T S I D +I S + V+SI+D + L Sbjct: 2 EVKDIVKKIYNIIEDKKGEDIKVIDITK-VSTIADYFIIASANNVNQVSSISDEIDFILG 60 Query: 75 KK 76 K+ Sbjct: 61 KE 62 >gi|213692595|ref|YP_002323181.1| iojap-like protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213524056|gb|ACJ52803.1| iojap-like protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|320458748|dbj|BAJ69369.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 137 Score = 58.2 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E LKA DI + L I D M+I + + V ++A+ + Sbjct: 1 MPALQDSINAVRVAAEAADRLKATDIVAFDVADLLG-ITDIMMIAGASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|91204833|ref|YP_537188.1| Iojap-related protein [Rickettsia bellii RML369-C] gi|91068377|gb|ABE04099.1| Iojap-related protein [Rickettsia bellii RML369-C] Length = 108 Score = 58.2 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAEDI I+ S ++ I D ++ +GRSTK+V +IA+ + Sbjct: 2 KKESEELKLFILECLNEKKAEDIDVIDL-SGKNKIADYIIFANGRSTKNVGAIAEYVALE 60 Query: 73 LKKK 76 LK K Sbjct: 61 LKNK 64 >gi|89092029|ref|ZP_01164984.1| hypothetical protein MED92_07676 [Oceanospirillum sp. MED92] gi|89083764|gb|EAR62981.1| hypothetical protein MED92_07676 [Oceanospirillum sp. MED92] Length = 110 Score = 58.2 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + V L+++KA++I ++ RS + D M+I SG S +H Sbjct: 2 QTEKILELVHGALEDMKAKEITDLDVR-GRSTVTDYMIIASGTSKRH 47 >gi|159903485|ref|YP_001550829.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9211] gi|159888661|gb|ABX08875.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9211] Length = 122 Score = 58.2 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + ++ ++ KA +I I S + D ++I G S V +I+ ++ L+ Sbjct: 2 DSRSIVDIAIQACEDKKARNIQVINI-DKVSSLADWILITEGLSDVQVKAISKSVEDRLE 60 Query: 75 KK 76 ++ Sbjct: 61 EE 62 >gi|119716055|ref|YP_923020.1| iojap-like protein [Nocardioides sp. JS614] gi|119536716|gb|ABL81333.1| iojap-like protein [Nocardioides sp. JS614] Length = 127 Score = 58.2 bits (140), Expect = 3e-07, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + T E A+ + + + I D ++ S + + V +I D + Sbjct: 1 MTATDRAVELVHTAARAASEKLAQQLIAFDVSEQL-AITDAFLLASASNDRQVKAIVDEI 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDKLRE 65 >gi|281355303|ref|ZP_06241797.1| nicotinate (nicotinamide) nucleotide adenylyltransferase [Victivallis vadensis ATCC BAA-548] gi|281318183|gb|EFB02203.1| nicotinate (nicotinamide) nucleotide adenylyltransferase [Victivallis vadensis ATCC BAA-548] Length = 353 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 18/76 (23%), Positives = 30/76 (39%), Gaps = 5/76 (6%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M TEK+ + +A C E KAE++ I S + D VI + S Sbjct: 214 MENMTEKKKISSA----ELADFCAACALEKKAENVLKIHVGP-ASSVADWFVISTANSEP 268 Query: 61 HVASIADNLISYLKKK 76 + ++ L++K Sbjct: 269 QLRALVSFTERELREK 284 >gi|315121756|ref|YP_004062245.1| hypothetical protein CKC_00030 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495158|gb|ADR51757.1| hypothetical protein CKC_00030 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 86 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 50/70 (71%), Positives = 58/70 (82%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M NT+K Q D++ +C+ T++ECL ELKAEDI HIENTS +SLICDNMVIVSGRSTK Sbjct: 1 MPVNTKKTEEQINDNIAACVTTIIECLTELKAEDIRHIENTSAQSLICDNMVIVSGRSTK 60 Query: 61 HVASIADNLI 70 HVASIADNLI Sbjct: 61 HVASIADNLI 70 >gi|168705004|ref|ZP_02737281.1| hypothetical protein GobsU_36060 [Gemmata obscuriglobus UQM 2246] Length = 139 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 11/68 (16%), Positives = 27/68 (39%), Gaps = 3/68 (4%) Query: 11 QTADHLDSCIATVMEC--LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + K DI ++ S + + D VI +G S + + ++A+ Sbjct: 19 TAKPLSSALHRACVAARTAADNKGRDIVVLDMRS-STPLFDYFVISTGTSRRQIHAVAEE 77 Query: 69 LISYLKKK 76 + L+ + Sbjct: 78 TDAALRAE 85 >gi|312195843|ref|YP_004015904.1| iojap-like protein [Frankia sp. EuI1c] gi|311227179|gb|ADP80034.1| iojap-like protein [Frankia sp. EuI1c] Length = 155 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 9/65 (13%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + A+DI ++ + + D V+ S + + V ++ D + Sbjct: 1 MTASPRAVELALIAAQAAADKLAKDITVLDVSDRL-ALTDCFVLASADNERQVKAVVDEV 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EEKLR 64 >gi|294791527|ref|ZP_06756684.1| iojap-like protein [Scardovia inopinata F0304] gi|294457998|gb|EFG26352.1| iojap-like protein [Scardovia inopinata F0304] Length = 149 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +K EDI + T I D ++++G + + V SIA+ + Sbjct: 1 MQESIDAVRLAAKAADSMKGEDIVAFDVTEPL-AITDIFLLITGDNPRQVLSIAEEVEKQ 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|23336315|ref|ZP_00121537.1| COG0799: Uncharacterized homolog of plant Iojap protein [Bifidobacterium longum DJO10A] gi|189439582|ref|YP_001954663.1| hypothetical protein BLD_0719 [Bifidobacterium longum DJO10A] gi|227546033|ref|ZP_03976082.1| family protein of plant Iojap protein [Bifidobacterium longum subsp. infantis ATCC 55813] gi|322690836|ref|YP_004220406.1| hypothetical protein BLLJ_0646 [Bifidobacterium longum subsp. longum JCM 1217] gi|189428017|gb|ACD98165.1| Hypothetical protein BLD_0719 [Bifidobacterium longum DJO10A] gi|227213519|gb|EEI81376.1| family protein of plant Iojap protein [Bifidobacterium longum subsp. infantis ATCC 55813] gi|320455692|dbj|BAJ66314.1| conserved hypothetical protein [Bifidobacterium longum subsp. longum JCM 1217] Length = 137 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E +KA DI + L I D M+I + + V ++A+ + Sbjct: 1 MPALQDSINAVRVAAEAADRIKATDIVAFDVADLLG-ITDIMMIAGASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|294462113|gb|ADE76609.1| unknown [Picea sitchensis] Length = 261 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I V + L +++AED+ I + D MV +GRS HV +IA L+ +K+K Sbjct: 125 TIEEVDKVLTDVRAEDVKSINV-HKQCEWTDYMVFATGRSNWHVRNIAQALLYKVKQK 181 >gi|282896703|ref|ZP_06304711.1| Iojap-related protein [Raphidiopsis brookii D9] gi|281198421|gb|EFA73309.1| Iojap-related protein [Raphidiopsis brookii D9] Length = 145 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/74 (18%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 ++T D T+ + E KA +I ++ T S + D ++++G S V Sbjct: 19 KTVNTPMVETEDSSGKLALTIAQAASERKAGEILLLKVTD-VSYLSDYFLVMTGYSRVQV 77 Query: 63 ASIADNLISYLKKK 76 +I+ + ++ + Sbjct: 78 RAISSAIEEKVQTE 91 >gi|254443369|ref|ZP_05056845.1| iojap family protein [Verrucomicrobiae bacterium DG1235] gi|198257677|gb|EDY81985.1| iojap family protein [Verrucomicrobiae bacterium DG1235] Length = 126 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + +A + L + KAE+I ++ S I + +V+ S + H+ ++ + Sbjct: 4 KTKAELKGEELLAICCKTLDDAKAENIVALDVR-GVSSITNYLVLASALAEPHLRALRRD 62 Query: 69 LISYLKKK 76 L LK Sbjct: 63 LDKALKDH 70 >gi|297568621|ref|YP_003689965.1| iojap-like protein [Desulfurivibrio alkaliphilus AHT2] gi|296924536|gb|ADH85346.1| iojap-like protein [Desulfurivibrio alkaliphilus AHT2] Length = 140 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +KAE++ ++ S + D V+++GRST+HV S+A + L K Sbjct: 17 ELARIAAAAALNMKAENLVILDVR-GLSSVTDYFVLMNGRSTRHVQSLARAVEEALASK 74 >gi|227484970|ref|ZP_03915286.1| iojap family protein [Anaerococcus lactolyticus ATCC 51172] gi|227237125|gb|EEI87140.1| iojap family protein [Anaerococcus lactolyticus ATCC 51172] Length = 102 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L++ A+DI I+ S + D ++ +G S ++AD + L K+ Sbjct: 2 EKLDVIVKTLEDKLADDINVIKLED--SSVADYFIVATGNSINQTRALADYIEDDLHKE 58 >gi|332706313|ref|ZP_08426376.1| iojap-related protein [Lyngbya majuscula 3L] gi|332354862|gb|EGJ34339.1| iojap-related protein [Lyngbya majuscula 3L] Length = 135 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + D TV + + K D+ + + S I D VIV+G S V +I+ + Sbjct: 17 ENQDASYGLALTVAQAADDRKGADLVILSVSE-VSYITDYFVIVTGFSRVQVRAISQWIE 75 Query: 71 SYLKK 75 +++ Sbjct: 76 QQVEE 80 >gi|260891164|ref|ZP_05902427.1| iojap-like protein [Leptotrichia hofstadii F0254] gi|260859191|gb|EEX73691.1| iojap-like protein [Leptotrichia hofstadii F0254] Length = 121 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + ++ + + +++ +++ KA+DI + +S D ++ +G S++++ +IA + Sbjct: 1 MSEVNNNYEKEVQEIVDIMEDKKAQDIKIYDMR-GKSPFFDYSILCTGSSSRNIEAIATD 59 Query: 69 LISYL 73 + L Sbjct: 60 IKKSL 64 >gi|326201668|ref|ZP_08191539.1| iojap-like protein [Clostridium papyrosolvens DSM 2782] gi|325988268|gb|EGD49093.1| iojap-like protein [Clostridium papyrosolvens DSM 2782] Length = 114 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + ++ +++ KA+ I + ++I D VI SG S+ H+ +IAD + L Sbjct: 2 DSKTLVDRIVAAMEDKKAK-DISIIDIHSITVIADYFVICSGTSSTHIKAIADEVDFKLA 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|300173709|ref|YP_003772875.1| iojap-related protein [Leuconostoc gasicomitatum LMG 18811] gi|299888088|emb|CBL92056.1| Iojap-related protein [Leuconostoc gasicomitatum LMG 18811] Length = 123 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + TA + + + T + + +A I ++ SL+ D VI S + V +I + Sbjct: 1 MTTALDVTTLLKTAVVAVDNKQANHIVALDMRK-VSLMADYFVIADAASNRQVQAIVTEV 59 Query: 70 ISYL 73 + Sbjct: 60 KDQV 63 >gi|325678474|ref|ZP_08158090.1| iojap-like protein [Ruminococcus albus 8] gi|324109842|gb|EGC04042.1| iojap-like protein [Ruminococcus albus 8] Length = 122 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + +++ L + EDI I +++ D VI +G S+ ++A+ + L Sbjct: 5 TTEQKLEIIVKALDSKRGEDIQAIGIGD-LTILADYFVIANGGSSVQTKAMAEEVEFKL 62 >gi|319892649|ref|YP_004149524.1| Iojap protein [Staphylococcus pseudintermedius HKU10-03] gi|317162345|gb|ADV05888.1| Iojap protein [Staphylococcus pseudintermedius HKU10-03] gi|323464313|gb|ADX76466.1| iojap-related protein [Staphylococcus pseudintermedius ED99] Length = 118 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + + +E KAE+I + S S + D V+ G + + V +IA + Sbjct: 2 NAKDLLMLTVEAADAKKAEEIISLNM-SGVSDLTDYFVVCHGNNERQVQAIARAVKE 57 >gi|288922000|ref|ZP_06416209.1| iojap-like protein [Frankia sp. EUN1f] gi|288346662|gb|EFC80982.1| iojap-like protein [Frankia sp. EUN1f] Length = 129 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + +DI ++ + I D VI S + + V +I D + Sbjct: 1 MTASPRAVELALAAAQTAADKIGQDILVLDVSERL-AITDCFVIASADNERQVKAIVDEI 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EEKLR 64 >gi|23465537|ref|NP_696140.1| hypothetical protein BL0965 [Bifidobacterium longum NCC2705] gi|239621914|ref|ZP_04664945.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis CCUG 52486] gi|312132991|ref|YP_004000330.1| protein [Bifidobacterium longum subsp. longum BBMN68] gi|317481914|ref|ZP_07940941.1| hypothetical protein HMPREF0177_00333 [Bifidobacterium sp. 12_1_47BFAA] gi|322688854|ref|YP_004208588.1| hypothetical protein BLIF_0667 [Bifidobacterium longum subsp. infantis 157F] gi|23326199|gb|AAN24776.1| hypothetical protein with duf143 [Bifidobacterium longum NCC2705] gi|239515105|gb|EEQ54972.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis CCUG 52486] gi|291517085|emb|CBK70701.1| iojap-related protein [Bifidobacterium longum subsp. longum F8] gi|311773976|gb|ADQ03464.1| Hypothetical protein BBMN68_726 [Bifidobacterium longum subsp. longum BBMN68] gi|316916705|gb|EFV38100.1| hypothetical protein HMPREF0177_00333 [Bifidobacterium sp. 12_1_47BFAA] gi|320460190|dbj|BAJ70810.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis 157F] Length = 137 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E +KA DI + L I D M+I + + V ++A+ + Sbjct: 1 MPALQDSINAVRVAAEAADRIKATDIVAFDVADLLG-ITDIMMIAGASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|304403900|ref|ZP_07385562.1| iojap-like protein [Paenibacillus curdlanolyticus YK9] gi|304346878|gb|EFM12710.1| iojap-like protein [Paenibacillus curdlanolyticus YK9] Length = 115 Score = 57.8 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + D + + +E KA I + + SL+ D VI G S V +IA + Sbjct: 4 NSDQLLEATVAAAEEKKAGRIVALNLKEI-SLVADYFVICQGNSDVQVQAIATEIRKQA 61 >gi|259500530|ref|ZP_05743432.1| conserved hypothetical protein [Lactobacillus iners DSM 13335] gi|302191220|ref|ZP_07267474.1| Iojap family protein [Lactobacillus iners AB-1] gi|312871776|ref|ZP_07731864.1| iojap-like protein [Lactobacillus iners LEAF 3008A-a] gi|312874170|ref|ZP_07734204.1| iojap-like protein [Lactobacillus iners LEAF 2052A-d] gi|325912118|ref|ZP_08174516.1| iojap-like protein [Lactobacillus iners UPII 143-D] gi|325912615|ref|ZP_08174998.1| iojap-like protein [Lactobacillus iners UPII 60-B] gi|329920149|ref|ZP_08276980.1| iojap-like protein [Lactobacillus iners SPIN 1401G] gi|259167914|gb|EEW52409.1| conserved hypothetical protein [Lactobacillus iners DSM 13335] gi|311090240|gb|EFQ48650.1| iojap-like protein [Lactobacillus iners LEAF 2052A-d] gi|311092718|gb|EFQ51074.1| iojap-like protein [Lactobacillus iners LEAF 3008A-a] gi|325476068|gb|EGC79236.1| iojap-like protein [Lactobacillus iners UPII 143-D] gi|325478036|gb|EGC81165.1| iojap-like protein [Lactobacillus iners UPII 60-B] gi|328936603|gb|EGG33047.1| iojap-like protein [Lactobacillus iners SPIN 1401G] Length = 114 Score = 57.8 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +E + E E+ + S++ D VI + S + + +IA+++I + +K Sbjct: 5 ELLDLTLEAISERHGEETKAYDMR-GISILADYYVITTAGSNRQLHAIANSIIEKVHEK 62 >gi|225873011|ref|YP_002754470.1| iojap family protein [Acidobacterium capsulatum ATCC 51196] gi|225793481|gb|ACO33571.1| iojap family protein [Acidobacterium capsulatum ATCC 51196] Length = 225 Score = 57.8 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 24/65 (36%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + T E K ED +E S D VI S + + +IAD + Sbjct: 2 PTQETRQMVLTAAAICDEKKGEDTRVLELDPADSGFTDFFVITSTTNDRQSVAIADEIEL 61 Query: 72 YLKKK 76 LK++ Sbjct: 62 RLKRE 66 >gi|116630029|ref|YP_815201.1| Iojap family protein [Lactobacillus gasseri ATCC 33323] gi|116095611|gb|ABJ60763.1| Iojap family protein [Lactobacillus gasseri ATCC 33323] Length = 121 Score = 57.8 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 10/66 (15%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + +E + E ED + S++ D V+ + S + + +I +++I Sbjct: 4 KIKLDSKKLLDLTVEAIDERHGEDTEAYDM-QGISILADYYVVTTAGSNRQLHAIVNSII 62 Query: 71 SYLKKK 76 + ++ Sbjct: 63 DKIHEQ 68 >gi|83814587|ref|YP_446646.1| hypothetical protein SRU_2548 [Salinibacter ruber DSM 13855] gi|294508579|ref|YP_003572638.1| conserved hypothetical protein with DUF143 domain [Salinibacter ruber M8] gi|83755981|gb|ABC44094.1| Domain of unknown function DUF143 family [Salinibacter ruber DSM 13855] gi|294344908|emb|CBH25686.1| conserved hypothetical protein with DUF143 domain [Salinibacter ruber M8] Length = 155 Score = 57.8 bits (139), Expect = 4e-07, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 A V + + + +A +I I+ S + D V+ +G S V +IA+ + ++++ Sbjct: 25 LAARVADAMADKRAMNISVIDLRE-VSSMADFFVLGTGESDLQVKAIANGIADHVQE 80 >gi|116492476|ref|YP_804211.1| Iojap family protein [Pediococcus pentosaceus ATCC 25745] gi|116102626|gb|ABJ67769.1| Iojap family protein [Pediococcus pentosaceus ATCC 25745] Length = 118 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ +AE+ + S + D +I S S + VA+IAD +I K+ Sbjct: 5 EELELLVKAADSKRAENTIVLNVRE-VSTLADYFMITSADSNRQVAAIADAIIEKAKEN 62 >gi|317486615|ref|ZP_07945432.1| zinc finger protein 638 [Bilophila wadsworthia 3_1_6] gi|316921998|gb|EFV43267.1| zinc finger protein 638 [Bilophila wadsworthia 3_1_6] Length = 166 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 + TA + A V + L+E KA D+ ++ +S D +++V+ S +H S+AD Sbjct: 33 RKFSTASASEKTAALV-KWLEESKARDVVALDVA-GKSPCMDVVIVVTASSLRHAKSLAD 90 Query: 68 NLISYLKKKN 77 L+ K N Sbjct: 91 GLMEQCTKNN 100 >gi|225378067|ref|ZP_03755288.1| hypothetical protein ROSEINA2194_03727 [Roseburia inulinivorans DSM 16841] gi|225210068|gb|EEG92422.1| hypothetical protein ROSEINA2194_03727 [Roseburia inulinivorans DSM 16841] Length = 115 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + L++ KAED+ I+ + + S I D +I +G + + ++ D L Sbjct: 2 TSKELTKLAVAALEDRKAEDVTVIDISEI-SPIADYFIIANGTNQNQLQAMRDAADEALY 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|332655279|ref|ZP_08421019.1| iojap-like protein [Ruminococcaceae bacterium D16] gi|332515784|gb|EGJ45394.1| iojap-like protein [Ruminococcaceae bacterium D16] Length = 121 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 23/52 (44%), Gaps = 1/52 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + L K E+I ++ T + + D VI + S V +++D + Sbjct: 11 LLAKTLDSKKGEEIKVLK-TEGLTTLADYFVICTATSNTQVKAMSDACEEAM 61 >gi|298372587|ref|ZP_06982577.1| iojap-like protein [Bacteroidetes oral taxon 274 str. F0058] gi|298275491|gb|EFI17042.1| iojap-like protein [Bacteroidetes oral taxon 274 str. F0058] Length = 119 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + I ++ ++E KA++I ++ T L + C VI G S++ V SIAD + Y+ Sbjct: 3 NDDQKLIEAIVAGMQEQKAQNIAIVDMTKLDAP-CSYFVICEGNSSRQVESIADTMSDYV 61 Query: 74 KK 75 +K Sbjct: 62 RK 63 >gi|170782182|ref|YP_001710515.1| hypothetical protein CMS_1808 [Clavibacter michiganensis subsp. sepedonicus] gi|169156751|emb|CAQ01913.1| conserved hypothetical protein [Clavibacter michiganensis subsp. sepedonicus] Length = 125 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 9/64 (14%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + +A D+ ++ S + D +I S R+ ++ ++AD + Sbjct: 1 MTASPRALDLLKVAASAADSKQAIDLVALDV-SGPLPLTDVFLIASARNERNAQAVADEI 59 Query: 70 ISYL 73 + Sbjct: 60 EDKM 63 >gi|154707373|ref|YP_001424855.1| iojap protein family [Coxiella burnetii Dugway 5J108-111] gi|154356659|gb|ABS78121.1| iojap protein family [Coxiella burnetii Dugway 5J108-111] Length = 116 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L E KA I ++ T + + D M++ S S +H +++AD +I K Sbjct: 2 KSAELANLVINTLDEHKALQITDLDVT-TLTDLMDRMIVCSATSERHASALADKVIRRAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|256396363|ref|YP_003117927.1| iojap-like protein [Catenulispora acidiphila DSM 44928] gi|256362589|gb|ACU76086.1| iojap-like protein [Catenulispora acidiphila DSM 44928] Length = 173 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + A+DI + + + +I D V+ S S + V +I D + Sbjct: 1 MTATDRARELAIAAAQAASDKVADDIVAYDVSDVF-VITDAFVLASANSDRQVRAIVDGI 59 Query: 70 ISYLKK 75 L + Sbjct: 60 EEKLLE 65 >gi|163752397|ref|ZP_02159591.1| iojap domain protein [Shewanella benthica KT99] gi|161327734|gb|EDP98922.1| iojap domain protein [Shewanella benthica KT99] Length = 101 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++LKA+DI + +S + D MV+ SG S HV +IA+N++ K+ Sbjct: 6 IEDLKAKDIVTLAVAE-QSDMTDYMVVCSGTSKTHVKAIAENVVLECKR 53 >gi|255325512|ref|ZP_05366614.1| conserved hypothetical protein [Corynebacterium tuberculostearicum SK141] gi|311741299|ref|ZP_07715123.1| Iojap family protein [Corynebacterium pseudogenitalium ATCC 33035] gi|255297450|gb|EET76765.1| conserved hypothetical protein [Corynebacterium tuberculostearicum SK141] gi|311303469|gb|EFQ79548.1| Iojap family protein [Corynebacterium pseudogenitalium ATCC 33035] Length = 156 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + T+D T +E A +I I+ + + I + V+ S + + V SI D + Sbjct: 1 MSTSDLARRMAETAAHAAQEKLATNIAAIDVSDVL-AITEVFVLASADNERQVGSIVDEV 59 Query: 70 ISYLKKK 76 + K+ Sbjct: 60 EDEMTKQ 66 >gi|307297827|ref|ZP_07577633.1| iojap-like protein [Thermotogales bacterium mesG1.Ag.4.2] gi|306917087|gb|EFN47469.1| iojap-like protein [Thermotogales bacterium mesG1.Ag.4.2] Length = 130 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 LD + + E + E EDI ++ + S + D V+ + S H+ S+ + ++ Y+++ Sbjct: 9 LDKVVKEIAEIIDEKLGEDIVILDVSK-VSNLADYFVVTTANSDPHMDSLREAILQYIER 67 Query: 76 K 76 + Sbjct: 68 E 68 >gi|110637032|ref|YP_677239.1| hypothetical protein CHU_0612 [Cytophaga hutchinsonii ATCC 33406] gi|110279713|gb|ABG57899.1| conserved hypothetical protein [Cytophaga hutchinsonii ATCC 33406] Length = 125 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 2/65 (3%) Query: 9 ALQTADHLDS--CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 ++T + TV+ ++E KA I I+ L+ + D +I S S V SI Sbjct: 1 MVETKNKTKKTSLADTVVFAMQEKKAYSITVIDLRKLKEAVADYFIICSANSDTQVDSIH 60 Query: 67 DNLIS 71 D++ Sbjct: 61 DSIDE 65 >gi|167751482|ref|ZP_02423609.1| hypothetical protein EUBSIR_02478 [Eubacterium siraeum DSM 15702] gi|167655290|gb|EDR99419.1| hypothetical protein EUBSIR_02478 [Eubacterium siraeum DSM 15702] gi|291557103|emb|CBL34220.1| iojap-related protein [Eubacterium siraeum V10Sc8a] Length = 117 Score = 57.8 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++ L KA+DI ++ +++ + VIVSG S+ V ++AD + L +K Sbjct: 5 EILKEGIKALDSKKADDIRILKVRD-LTILANYFVIVSGSSSTQVKALADEVDFKLGEK 62 >gi|289548802|ref|YP_003473790.1| iojap-like protein [Thermocrinis albus DSM 14484] gi|289182419|gb|ADC89663.1| iojap-like protein [Thermocrinis albus DSM 14484] Length = 110 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query: 32 AEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 AEDI ++ +S + + D VI + S H ++AD L+ L+K Sbjct: 17 AEDIVILDVSS-LTNLADYFVIATANSPTHARALADYLVEELEK 59 >gi|225620039|ref|YP_002721296.1| iojap superfamily-like protein [Brachyspira hyodysenteriae WA1] gi|225214858|gb|ACN83592.1| iojap superfamily ortholog [Brachyspira hyodysenteriae WA1] Length = 154 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L + K EDI ++ + + D ++ + S+ + + +D + Sbjct: 38 KEKAKELTLKAAKALYDKKLEDIVILDL-EDVTTLSDFFILATASSSPQMKAGSDAVYKD 96 Query: 73 LKK 75 LK+ Sbjct: 97 LKE 99 >gi|295695842|ref|YP_003589080.1| iojap-like protein [Bacillus tusciae DSM 2912] gi|295411444|gb|ADG05936.1| iojap-like protein [Bacillus tusciae DSM 2912] Length = 116 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ ++ S+I D VI SG+S V +IAD++ +++ Sbjct: 23 NVVILDIGE-LSIIADYFVICSGQSRTQVQAIADHVREKMEEH 64 >gi|291530288|emb|CBK95873.1| iojap-related protein [Eubacterium siraeum 70/3] Length = 117 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++ L KA+DI ++ +++ + VIVSG S+ V ++AD + L +K Sbjct: 5 EILKEGIKALDSKKADDIKILKVRD-LTILANYFVIVSGSSSTQVKALADEVDFKLGEK 62 >gi|170746551|ref|YP_001752811.1| iojap-like protein [Methylobacterium radiotolerans JCM 2831] gi|170653073|gb|ACB22128.1| iojap-like protein [Methylobacterium radiotolerans JCM 2831] Length = 99 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +KAE+ I+ ++ + D M+I SGRS +HV SIAD +I +K Sbjct: 1 MKAEETIAIDLA-GKTSLADTMIITSGRSQRHVGSIADKIIQEMK 44 >gi|50842323|ref|YP_055550.1| hypothetical protein PPA0837 [Propionibacterium acnes KPA171202] gi|50839925|gb|AAT82592.1| conserved protein, DUF143 domain [Propionibacterium acnes KPA171202] gi|315107031|gb|EFT79007.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL030PA1] Length = 134 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ V + K DI ++ + I D V++S + + V+++ D + Sbjct: 1 MSATEYAIELARVVAYAALDKKGFDIVALDVSEHL-AITDIFVVISAANERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DKAMHEH 66 >gi|323359809|ref|YP_004226205.1| hypothetical protein MTES_3361 [Microbacterium testaceum StLB037] gi|323276180|dbj|BAJ76325.1| uncharacterized homolog of plant Iojap protein [Microbacterium testaceum StLB037] Length = 126 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 28/66 (42%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + ED+ ++ + + D ++V+GR+ ++VA+IAD + Sbjct: 1 MTATQNGREMAQIAALAADSKSGEDLVALDVSEPL-PLVDIFLLVTGRNERNVAAIADEI 59 Query: 70 ISYLKK 75 L + Sbjct: 60 EEKLLE 65 >gi|57239383|ref|YP_180519.1| hypothetical protein Erum6550 [Ehrlichia ruminantium str. Welgevonden] gi|58579351|ref|YP_197563.1| hypothetical protein ERWE_CDS_06870 [Ehrlichia ruminantium str. Welgevonden] gi|58617405|ref|YP_196604.1| hypothetical protein ERGA_CDS_06780 [Ehrlichia ruminantium str. Gardel] gi|57161462|emb|CAH58387.1| conserved hypothetical protein [Ehrlichia ruminantium str. Welgevonden] gi|58417017|emb|CAI28130.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel] gi|58417977|emb|CAI27181.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Welgevonden] Length = 121 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + V+ L + KA +I I ++ S + ++IVSG+S HV S+A+ + +K Sbjct: 14 EDLKDLVISILDQHKATNIVTINIGNI-SNLAKYLIIVSGQSNYHVKSLAEKVRKAIK 70 >gi|299822869|ref|ZP_07054755.1| iojap-like protein [Listeria grayi DSM 20601] gi|299816398|gb|EFI83636.1| iojap-like protein [Listeria grayi DSM 20601] Length = 118 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 TV + + +AEDI IE S I D +I G S K V +IA + + Sbjct: 9 TVAKAADDKRAEDIIAIEMKK-LSSIADYFMICHGNSDKQVEAIAKEIKDKADEN 62 >gi|161830653|ref|YP_001596482.1| iojap family protein [Coxiella burnetii RSA 331] gi|161762520|gb|ABX78162.1| iojap family protein [Coxiella burnetii RSA 331] Length = 116 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L E KA I ++ T + + D M++ S S +H +++AD +I K Sbjct: 2 KSTELANLVINTLDEHKALQITDLDVT-TLTDLMDRMIVCSATSKRHASALADKVIRRAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|15827762|ref|NP_302025.1| hypothetical protein ML1453 [Mycobacterium leprae TN] gi|221230239|ref|YP_002503655.1| hypothetical protein MLBr_01453 [Mycobacterium leprae Br4923] gi|13093314|emb|CAC30403.1| conserved hypothetical protein [Mycobacterium leprae] gi|219933346|emb|CAR71547.1| conserved hypothetical protein [Mycobacterium leprae Br4923] Length = 129 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 22/66 (33%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + A D+ I+ + I D VI S + + V +I D + Sbjct: 1 MNATKEAIDMATVAAAAAAAKLANDVVVIDVSEQLVGITDCFVIASASNERQVNAIVDEV 60 Query: 70 ISYLKK 75 +++ Sbjct: 61 EEKMRQ 66 >gi|206900415|ref|YP_002250011.1| iojap domain protein [Dictyoglomus thermophilum H-6-12] gi|206739518|gb|ACI18576.1| iojap domain protein [Dictyoglomus thermophilum H-6-12] Length = 116 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + I V + E KAE++ I+ + + S + D +VI +G + +I ++ Sbjct: 1 MNFLESREKAIR-VARIVLEKKAENVIIIDVSQI-SGLTDYLVICTGLTNTQRKAIQRSV 58 Query: 70 ISYLKK 75 ++K Sbjct: 59 EEEMEK 64 >gi|313891951|ref|ZP_07825552.1| iojap-like protein [Dialister microaerophilus UPII 345-E] gi|329120979|ref|ZP_08249610.1| Iojap family protein [Dialister micraerophilus DSM 19965] gi|313119594|gb|EFR42785.1| iojap-like protein [Dialister microaerophilus UPII 345-E] gi|327471141|gb|EGF16595.1| Iojap family protein [Dialister micraerophilus DSM 19965] Length = 117 Score = 57.4 bits (138), Expect = 6e-07, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ + T+ + L E K DI T + I D ++ + + KH S+ADN+ L Sbjct: 1 MNQIVETICKALSEKKGLDIKIFHVTD-VTSIADYFIVCTSMNKKHGQSLADNVEIKL 57 >gi|229823189|ref|ZP_04449258.1| hypothetical protein GCWU000282_00487 [Catonella morbi ATCC 51271] gi|229787355|gb|EEP23469.1| hypothetical protein GCWU000282_00487 [Catonella morbi ATCC 51271] Length = 121 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 11/63 (17%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + A+DI ++ + + I D V+ R+ K + +I D+++ Sbjct: 2 TKTALEILELAVRAADDRLAQDIVALDVRN-VTPIADYFVVTHARNDKQLDAIVDSIVEA 60 Query: 73 LKK 75 K Sbjct: 61 AHK 63 >gi|194335274|ref|YP_002017068.1| iojap-like protein [Pelodictyon phaeoclathratiforme BU-1] gi|194307751|gb|ACF42451.1| iojap-like protein [Pelodictyon phaeoclathratiforme BU-1] Length = 131 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 14/79 (17%), Positives = 35/79 (44%), Gaps = 7/79 (8%) Query: 2 LANTEKQALQTADHLDS------CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVS 55 +++ +++ + +A + E E K E++ ++ + + D VIV+ Sbjct: 1 MSSLKEEEMVSATQVKEVAVGELLARRAAELALEKKCEEVKILDLR-GLTSVTDYFVIVT 59 Query: 56 GRSTKHVASIADNLISYLK 74 S + + A+++I LK Sbjct: 60 ADSDRKAKAAAEHIIDELK 78 >gi|302560693|ref|ZP_07313035.1| iojap-like protein [Streptomyces griseoflavus Tu4000] gi|302478311|gb|EFL41404.1| iojap-like protein [Streptomyces griseoflavus Tu4000] Length = 147 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + T + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSLELVTTAAQAAADKLAHDIVAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLSKE 66 >gi|303246724|ref|ZP_07333002.1| iojap-like protein [Desulfovibrio fructosovorans JJ] gi|302492064|gb|EFL51942.1| iojap-like protein [Desulfovibrio fructosovorans JJ] Length = 132 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Query: 9 ALQTADHLDSCIATVMEC--LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 A+ + LD+ +M L E KA+DI ++ + + +C+ MV+ S S + ++A Sbjct: 3 AITSDKDLDARQKAIMVAGWLAEKKAKDILALDVAPI-NPVCEAMVVASAVSARQAKALA 61 Query: 67 DNLISYL 73 D+++ Sbjct: 62 DHVLEQC 68 >gi|51473980|ref|YP_067737.1| hypothetical protein RT0799 [Rickettsia typhi str. Wilmington] gi|51460292|gb|AAU04255.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington] Length = 108 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ECL E KAE+I I+ ++ + D ++ SGRSTK+V +IA+ + Sbjct: 2 KKDTEELKLFILECLIEKKAENIEVIDLRD-KNKLADYIIFASGRSTKNVGAIAEYVALA 60 Query: 73 LK 74 LK Sbjct: 61 LK 62 >gi|309807123|ref|ZP_07701100.1| iojap-like protein [Lactobacillus iners LactinV 03V1-b] gi|309808123|ref|ZP_07702037.1| iojap-like protein [Lactobacillus iners LactinV 01V1-a] gi|309810239|ref|ZP_07704084.1| iojap-like protein [Lactobacillus iners SPIN 2503V10-D] gi|312873009|ref|ZP_07733069.1| iojap-like protein [Lactobacillus iners LEAF 2062A-h1] gi|312875568|ref|ZP_07735569.1| iojap-like protein [Lactobacillus iners LEAF 2053A-b] gi|315653635|ref|ZP_07906555.1| Iojap family protein [Lactobacillus iners ATCC 55195] gi|308166474|gb|EFO68676.1| iojap-like protein [Lactobacillus iners LactinV 03V1-b] gi|308168635|gb|EFO70739.1| iojap-like protein [Lactobacillus iners LactinV 01V1-a] gi|308169511|gb|EFO71559.1| iojap-like protein [Lactobacillus iners SPIN 2503V10-D] gi|311088822|gb|EFQ47265.1| iojap-like protein [Lactobacillus iners LEAF 2053A-b] gi|311091531|gb|EFQ49915.1| iojap-like protein [Lactobacillus iners LEAF 2062A-h1] gi|315488997|gb|EFU78639.1| Iojap family protein [Lactobacillus iners ATCC 55195] Length = 114 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +E + E E+ + S++ D VI + S + + +IA+++I + +K Sbjct: 5 ELLDLTLEAISERHGEETKAYDMR-GISILADYYVITTAGSNRQLHAIANSIIEKVHEK 62 >gi|257125128|ref|YP_003163242.1| iojap-like protein [Leptotrichia buccalis C-1013-b] gi|257049067|gb|ACV38251.1| iojap-like protein [Leptotrichia buccalis C-1013-b] Length = 118 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + + + ++ +++ KA+DI + +S D ++ +G S++++ +IA + Sbjct: 1 MSEINNSYEKQVQEIIAIMEDKKAQDIKVYDMR-GKSPFFDYSILCTGSSSRNIEAIATD 59 Query: 69 LISYL 73 + L Sbjct: 60 IKKSL 64 >gi|314918398|gb|EFS82229.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL050PA1] gi|314919887|gb|EFS83718.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL050PA3] Length = 134 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ V + K DI ++ + I D V++S + + V+++ D + Sbjct: 1 MSATEYAIELARVVAYAALDKKGFDIVALDVSEHL-AITDIFVVISAANERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DKAMHEH 66 >gi|326428127|gb|EGD73697.1| hypothetical protein PTSG_05405 [Salpingoeca sp. ATCC 50818] Length = 367 Score = 57.4 bits (138), Expect = 7e-07, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 33/57 (57%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I V+ + E+K +D+C ++ R D +V+V+G+S +H+ ++A +L +K Sbjct: 138 IEDVVRNIFEMKGDDVCVLQVDQQRQSFADFVVVVTGKSPRHLRAMATSLADMCNEK 194 >gi|51246470|ref|YP_066354.1| hypothetical protein DP2618 [Desulfotalea psychrophila LSv54] gi|50877507|emb|CAG37347.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54] Length = 124 Score = 57.0 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + KAEDI ++ R D VI+SGRST+HV +A+N+ + Sbjct: 11 KSSVELAEICAQIALDNKAEDIVIVDV-QGRVSFTDQFVIMSGRSTRHVLGLAENIEAAF 69 Query: 74 KKK 76 + K Sbjct: 70 RSK 72 >gi|167630739|ref|YP_001681238.1| iojap-like protein [Heliobacterium modesticaldum Ice1] gi|167593479|gb|ABZ85227.1| iojap-like protein [Heliobacterium modesticaldum Ice1] Length = 122 Score = 57.0 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 DI ++ +S + D V+ +G ST V +I N+ LK Sbjct: 23 DITLLDLR-GKSNVTDYFVLCNGNSTPQVQAICMNIEEKLKD 63 >gi|310779508|ref|YP_003967841.1| iojap-like protein [Ilyobacter polytropus DSM 2926] gi|309748831|gb|ADO83493.1| iojap-like protein [Ilyobacter polytropus DSM 2926] Length = 111 Score = 57.0 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + TV++ ++ KA+ I ++ S +CD VI +G S +++ +I D + +++ Sbjct: 5 LQTVVDAIESKKAKGILVLDF-QGESSLCDYAVICTGSSNRNIQAITDEVDKKIRE 59 >gi|46199720|ref|YP_005387.1| iojap superfamily protein [Thermus thermophilus HB27] gi|46197346|gb|AAS81760.1| iojap protein family [Thermus thermophilus HB27] Length = 113 Score = 57.0 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 + + I + E L E KAE++ ++ S D V+ S ST H+ + Sbjct: 1 MVKTKEAVALIERIKELLAEKKAENVVALDLRR-VSETLDYFVVASATSTPHLQA 54 >gi|331701561|ref|YP_004398520.1| iojap-like protein [Lactobacillus buchneri NRRL B-30929] gi|329128904|gb|AEB73457.1| iojap-like protein [Lactobacillus buchneri NRRL B-30929] Length = 118 Score = 57.0 bits (137), Expect = 7e-07, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V+ +A DI ++ SL+ D VI S++ V +IAD ++ + Sbjct: 2 NSKEISEVVVRAADSKRANDIVVLDM-QKVSLMADYFVIADAASSRQVKAIADEIVDQV 59 >gi|219683751|ref|YP_002470134.1| Iojap-like protein [Bifidobacterium animalis subsp. lactis AD011] gi|219621401|gb|ACL29558.1| Iojap-like protein [Bifidobacterium animalis subsp. lactis AD011] gi|289178521|gb|ADC85767.1| iojap protein family [Bifidobacterium animalis subsp. lactis BB-12] Length = 137 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + +KAED+ ICD M+I S + + V +IA+ + Sbjct: 1 MNALEQSINSVRVAATAADGMKAEDVVAYNVGDKLG-ICDLMMIASASNERQVLAIAEEV 59 Query: 70 ISYL 73 L Sbjct: 60 EKQL 63 >gi|224438008|ref|ZP_03658947.1| hypothetical protein HcinC1_08530 [Helicobacter cinaedi CCUG 18818] gi|313144454|ref|ZP_07806647.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818] gi|313129485|gb|EFR47102.1| conserved hypothetical protein [Helicobacter cinaedi CCUG 18818] Length = 124 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + +++T + + + L++ K EDI + S R I D +VIVS +H ++ Sbjct: 2 QTDSIKTQLTISERLQHIQTLLEDKKGEDIEIFDL-SGRDYIVDKVVIVSAMIGRHSFAL 60 Query: 66 ADNLISYLKKK 76 D+L + LK + Sbjct: 61 LDHLKTELKPQ 71 >gi|319948124|ref|ZP_08022287.1| hypothetical protein ES5_02239 [Dietzia cinnamea P4] gi|319438192|gb|EFV93149.1| hypothetical protein ES5_02239 [Dietzia cinnamea P4] Length = 147 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + A + A DI I+ + +I D V+ S + + V S+ + + Sbjct: 1 MTASPEALEMAAVAARAADDKLATDIVVIDVSDQL-VITDCFVLASADTERQVNSVVEEI 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDKLRE 65 >gi|251798002|ref|YP_003012733.1| iojap-like protein [Paenibacillus sp. JDR-2] gi|247545628|gb|ACT02647.1| iojap-like protein [Paenibacillus sp. JDR-2] Length = 115 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 H D + + ++ KA I + + SL+ D VI G S V +I + Sbjct: 4 HSDELMQITVAAAEDKKAHRIVALNLKEI-SLVADYFVICHGNSDTQVQAITTEIRKQA 61 >gi|68171196|ref|ZP_00544602.1| Iojap-related protein [Ehrlichia chaffeensis str. Sapulpa] gi|88657570|ref|YP_507166.1| iojap-related protein [Ehrlichia chaffeensis str. Arkansas] gi|67999390|gb|EAM86033.1| Iojap-related protein [Ehrlichia chaffeensis str. Sapulpa] gi|88599027|gb|ABD44496.1| iojap-related protein [Ehrlichia chaffeensis str. Arkansas] Length = 123 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 36/67 (53%), Gaps = 1/67 (1%) Query: 8 QALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 ++ + + ++ L + KA +I I ++ +S + ++++I SG S+ HV S+A+ Sbjct: 5 KSKKPFSSPEELKELIVFILDKHKANNIVTINISN-KSNLAEHLIIASGESSYHVKSLAE 63 Query: 68 NLISYLK 74 + +K Sbjct: 64 RIRKEIK 70 >gi|42519510|ref|NP_965440.1| hypothetical protein LJ1634 [Lactobacillus johnsonii NCC 533] gi|227889538|ref|ZP_04007343.1| Iojap family protein [Lactobacillus johnsonii ATCC 33200] gi|268319899|ref|YP_003293555.1| hypothetical protein FI9785_1428 [Lactobacillus johnsonii FI9785] gi|41583798|gb|AAS09406.1| hypothetical protein LJ_1634 [Lactobacillus johnsonii NCC 533] gi|227850016|gb|EEJ60102.1| Iojap family protein [Lactobacillus johnsonii ATCC 33200] gi|262398274|emb|CAX67288.1| conserved hypothetical protein [Lactobacillus johnsonii FI9785] gi|329667749|gb|AEB93697.1| Iojap-related protein [Lactobacillus johnsonii DPC 6026] Length = 121 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 10/66 (15%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + +E + E ED + S++ D V+ + S + + +I +++I Sbjct: 4 KIKLDSKKLLDLTVEAIDERHGEDTEAYDM-QGISILADYYVVTTAGSNRQLHAIVNSII 62 Query: 71 SYLKKK 76 + + Sbjct: 63 DKIHEH 68 >gi|295425295|ref|ZP_06817998.1| iojap-like protein [Lactobacillus amylolyticus DSM 11664] gi|295065071|gb|EFG55976.1| iojap-like protein [Lactobacillus amylolyticus DSM 11664] Length = 115 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + V++ + + ED + S++ D V+ S S + + +IA++++ + N Sbjct: 5 EVLDFVLKAISDRHGEDTEAYDMR-GISILSDFFVVTSAGSNRQLHAIANSIVDEAHENN 63 >gi|119713201|gb|ABL97269.1| hypothetical protein MBMO_EB0-50A10.0033 [uncultured marine bacterium EB0_50A10] Length = 114 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 13/58 (22%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L + KAED+ ++ + S D ++I + S +H S+++ L+ +K Sbjct: 4 KNLQDICSKTLVDNKAEDVLTLDI-NGISSFADAIIIATANSNRHAKSLSERLVESVK 60 >gi|115924174|ref|XP_001188526.1| PREDICTED: similar to Chromosome 7 open reading frame 30 [Strongylocentrotus purpuratus] gi|115953035|ref|XP_797268.2| PREDICTED: similar to Chromosome 7 open reading frame 30 [Strongylocentrotus purpuratus] Length = 375 Score = 57.0 bits (137), Expect = 8e-07, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A+DIC I + + D V+V+GRS +H+ ++A ++ K Sbjct: 182 IDDLVSILRDENAQDICVINIPKKKQYV-DYFVVVTGRSPRHLKAMALHINQQYK 235 >gi|297181490|gb|ADI17677.1| uncharacterized homolog of plant iojap protein [uncultured gamma proteobacterium HF0130_23I23] Length = 115 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 19/68 (27%), Positives = 30/68 (44%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 +Q ++ L ELKA++I E S ++I +G S +H+ SIA Sbjct: 1 MVQKSNSSKQIKDLCAAALDELKAKNINIFEV-EKISSFASYILIGTGTSNRHIQSIARK 59 Query: 69 LISYLKKK 76 +I LK Sbjct: 60 VIDNLKDN 67 >gi|227488354|ref|ZP_03918670.1| iojap family protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227542967|ref|ZP_03973016.1| iojap family protein [Corynebacterium glucuronolyticum ATCC 51866] gi|227091568|gb|EEI26880.1| iojap family protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227181189|gb|EEI62161.1| iojap family protein [Corynebacterium glucuronolyticum ATCC 51866] Length = 146 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 23/57 (40%), Gaps = 1/57 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 E A +I ++ T + I D VI S + + V +I D + +K+ Sbjct: 1 MATVAARAADEKLATNIAVLDVTQPLT-ITDLFVIASAETERQVQAIVDEIEFQMKE 56 >gi|262193757|ref|YP_003264966.1| iojap-like protein [Haliangium ochraceum DSM 14365] gi|262077104|gb|ACY13073.1| iojap-like protein [Haliangium ochraceum DSM 14365] Length = 166 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D + ++ + KA + ++ + +++VSGRS +HV SI + ++ + Sbjct: 28 DEGLEAVHVALQAALDNKALEPMVLDVR-GLCSYTNYLLLVSGRSDRHVESICNGVMKTM 86 Query: 74 KKK 76 +++ Sbjct: 87 REQ 89 >gi|212212955|ref|YP_002303891.1| iojap protein family [Coxiella burnetii CbuG_Q212] gi|212011365|gb|ACJ18746.1| iojap protein family [Coxiella burnetii CbuG_Q212] Length = 116 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L E KA I ++ T+ + + D M++ S S +H +++AD +I K Sbjct: 2 KSAELANLVINTLDEHKALQITDLDVTA-LTDLMDRMIVCSATSKRHASALADKVIRRAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|297626056|ref|YP_003687819.1| hypothetical protein PFREUD_08540 [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] gi|296921821|emb|CBL56381.1| Conserved protein, DUF143 domain [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1] Length = 127 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +H E ED+ + + I D +IVSG + + V +I D + Sbjct: 1 MSATEHAVEMTRVAAEAALGKLGEDLVAFDVSEQL-AIADVFLIVSGHNERQVGAIVDAI 59 Query: 70 ISYL 73 L Sbjct: 60 QDAL 63 >gi|295838938|ref|ZP_06825871.1| conserved hypothetical protein [Streptomyces sp. SPB74] gi|197695493|gb|EDY42426.1| conserved hypothetical protein [Streptomyces sp. SPB74] Length = 155 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELIKAASQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDAI 59 Query: 70 ISYLKK 75 L K Sbjct: 60 EERLAK 65 >gi|291287789|ref|YP_003504605.1| iojap-like protein [Denitrovibrio acetiphilus DSM 12809] gi|290884949|gb|ADD68649.1| iojap-like protein [Denitrovibrio acetiphilus DSM 12809] Length = 114 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + +++ L E K EDI S + D +VI + S H +IAD L+ LK K Sbjct: 4 RTTLDLILKELVERKTEDITAHYVAP-VSSVADYIVIGTATSEPHANAIADYLLENLKAK 62 >gi|168045028|ref|XP_001774981.1| predicted protein [Physcomitrella patens subsp. patens] gi|162673728|gb|EDQ60247.1| predicted protein [Physcomitrella patens subsp. patens] Length = 276 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V E L + +A+D+ I D++VI SG S +H+ IAD + +KK+ Sbjct: 160 TVEEVKEILDKTRADDVQVIRVRD-LCEWADHLVIASGHSGRHLRGIADAICFEVKKR 216 >gi|253702446|ref|YP_003023635.1| iojap-like protein [Geobacter sp. M21] gi|251777296|gb|ACT19877.1| iojap-like protein [Geobacter sp. M21] Length = 128 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 +K+ L + C A + + KA D+ +E + S I D +V+ +GRS + V ++ Sbjct: 3 DKEVLTAEERAIKCAAFAL----DKKALDVKVLEIKKI-SSIADYLVLATGRSDRQVMAM 57 Query: 66 ADNLISYLK 74 AD++ +K Sbjct: 58 ADSVKQGMK 66 >gi|116333664|ref|YP_795191.1| Iojap family protein [Lactobacillus brevis ATCC 367] gi|116099011|gb|ABJ64160.1| Iojap family protein [Lactobacillus brevis ATCC 367] Length = 118 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + ++ + +AED+ ++ T SL+ D +I+ S++ + +IAD + + Sbjct: 2 ESKEILEIAVKAAENKRAEDLTALDMTK-VSLMADYFLIMEANSSRQIQAIADEITDQM 59 >gi|81428999|ref|YP_395999.1| hypothetical protein LSA1389 [Lactobacillus sakei subsp. sakei 23K] gi|78610641|emb|CAI55692.1| Hypothetical protein LCA_1389 [Lactobacillus sakei subsp. sakei 23K] Length = 119 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ +AEDI + SL+ D V+++G S + + +I D + Sbjct: 2 KSLDLLKIAVKAADGKRAEDIVALNM-EGISLLADYFVMMTGSSERQLDAIVDAIEDA 58 >gi|289644655|ref|ZP_06476719.1| iojap-like protein [Frankia symbiont of Datisca glomerata] gi|289505530|gb|EFD26565.1| iojap-like protein [Frankia symbiont of Datisca glomerata] Length = 137 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + A DI ++ + I D V+ S + + V ++ D + L+ Sbjct: 20 DKLARDIVVLDVSERL-AITDCFVVASADNERQVKAVVDGIEERLR 64 >gi|289426291|ref|ZP_06428037.1| iojap-like protein [Propionibacterium acnes SK187] gi|289427159|ref|ZP_06428875.1| iojap-like protein [Propionibacterium acnes J165] gi|295130408|ref|YP_003581071.1| iojap-like protein [Propionibacterium acnes SK137] gi|289153456|gb|EFD02171.1| iojap-like protein [Propionibacterium acnes SK187] gi|289159628|gb|EFD07816.1| iojap-like protein [Propionibacterium acnes J165] gi|291375054|gb|ADD98908.1| iojap-like protein [Propionibacterium acnes SK137] gi|313764653|gb|EFS36017.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL013PA1] gi|313772308|gb|EFS38274.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL074PA1] gi|313791702|gb|EFS39813.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL110PA1] gi|313802214|gb|EFS43446.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL110PA2] gi|313809830|gb|EFS47551.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL083PA1] gi|313813130|gb|EFS50844.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL025PA1] gi|313815720|gb|EFS53434.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL059PA1] gi|313818369|gb|EFS56083.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL046PA2] gi|313820131|gb|EFS57845.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL036PA1] gi|313823060|gb|EFS60774.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL036PA2] gi|313825664|gb|EFS63378.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL063PA1] gi|313827908|gb|EFS65622.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL063PA2] gi|313830743|gb|EFS68457.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL007PA1] gi|313833961|gb|EFS71675.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL056PA1] gi|313838541|gb|EFS76255.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL086PA1] gi|314915148|gb|EFS78979.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL005PA4] gi|314925359|gb|EFS89190.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL036PA3] gi|314931902|gb|EFS95733.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL067PA1] gi|314955765|gb|EFT00165.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL027PA1] gi|314958250|gb|EFT02353.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL002PA1] gi|314960195|gb|EFT04297.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL002PA2] gi|314963001|gb|EFT07101.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL082PA1] gi|314967924|gb|EFT12023.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL037PA1] gi|314973169|gb|EFT17265.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL053PA1] gi|314976339|gb|EFT20434.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL045PA1] gi|314978181|gb|EFT22275.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL072PA2] gi|314983453|gb|EFT27545.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL005PA1] gi|314987645|gb|EFT31736.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL005PA2] gi|314990125|gb|EFT34216.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL005PA3] gi|315077646|gb|EFT49702.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL053PA2] gi|315080250|gb|EFT52226.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL078PA1] gi|315084512|gb|EFT56488.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL027PA2] gi|315085849|gb|EFT57825.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL002PA3] gi|315088734|gb|EFT60710.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL072PA1] gi|315096364|gb|EFT68340.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL038PA1] gi|315098343|gb|EFT70319.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL059PA2] gi|315100962|gb|EFT72938.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL046PA1] gi|315108298|gb|EFT80274.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL030PA2] gi|327325997|gb|EGE67787.1| iojap-like protein [Propionibacterium acnes HL096PA2] gi|327330698|gb|EGE72444.1| iojap-like protein [Propionibacterium acnes HL097PA1] gi|327332132|gb|EGE73869.1| iojap-like protein [Propionibacterium acnes HL096PA3] gi|327442752|gb|EGE89406.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL013PA2] gi|327446123|gb|EGE92777.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL043PA2] gi|327447898|gb|EGE94552.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL043PA1] gi|327450975|gb|EGE97629.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL087PA3] gi|327452946|gb|EGE99600.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL092PA1] gi|327453676|gb|EGF00331.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL083PA2] gi|328753663|gb|EGF67279.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL020PA1] gi|328754399|gb|EGF68015.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL087PA1] gi|328755007|gb|EGF68623.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL025PA2] gi|328760504|gb|EGF74072.1| iojap-like protein [Propionibacterium acnes HL099PA1] gi|332675247|gb|AEE72063.1| putative ACR [Propionibacterium acnes 266] Length = 134 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ V + K DI ++ + I D V++S + + V+++ D + Sbjct: 1 MSATEYAIELARVVAYAALDKKGFDIVALDVSEHL-AITDIFVVISAANERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DKAMHEH 66 >gi|319760446|ref|YP_004124384.1| hypothetical protein BVAF_313 [Candidatus Blochmannia vafer str. BVAF] gi|318039160|gb|ADV33710.1| conserved hypothetical protein [Candidatus Blochmannia vafer str. BVAF] Length = 109 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 16/63 (25%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Query: 15 HLDSCIATVMECLKELKAEDICHIEN--TSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D ++ C+++LK ++I + + I + M+ +G+S++HV SIA N++ Sbjct: 2 KFDILKQLILNCIEDLKGQNIVCLNINTDKYKYSITNLMIFCTGQSSRHVVSIAQNILKK 61 Query: 73 LKK 75 L++ Sbjct: 62 LRQ 64 >gi|300933229|ref|ZP_07148485.1| iojap homolog [Corynebacterium resistens DSM 45100] Length = 156 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + AEDI I+ + I D VI SG + + V +I D + L + Sbjct: 20 DKLAEDILVIDVSERL-AITDCFVIASGDNERQVNAIIDEVEDQLNDE 66 >gi|29653891|ref|NP_819583.1| iojap family protein [Coxiella burnetii RSA 493] gi|29541154|gb|AAO90097.1| iojap protein family [Coxiella burnetii RSA 493] Length = 116 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L E KA I ++ T + + D M++ S S +H +++AD +I K Sbjct: 2 KSAELANLVINTLDEHKALQITDLDVT-TLTDLMDRMIVCSATSKRHASALADKVIRRAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|55981746|ref|YP_145043.1| hypothetical protein TTHA1777 [Thermus thermophilus HB8] gi|55773159|dbj|BAD71600.1| conserved hypothetical protein [Thermus thermophilus HB8] Length = 113 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 + A + I + E L E KAE++ ++ S D V+ S ST H+ + Sbjct: 1 MVKAKEAVALIERIKELLAEKKAENVVALDLRR-VSETLDYFVVASATSTPHLQA 54 >gi|282900122|ref|ZP_06308079.1| Iojap-related protein [Cylindrospermopsis raciborskii CS-505] gi|281195004|gb|EFA69944.1| Iojap-related protein [Cylindrospermopsis raciborskii CS-505] Length = 134 Score = 57.0 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 14/68 (20%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 ++T D T+ + E KA +I ++ T S + D ++++G S V +I+ Sbjct: 1 MVETGDSSGKLAFTIAQAASERKAGEILLLKVTD-VSYLSDYFLVMTGYSRVQVRAISSA 59 Query: 69 LISYLKKK 76 + ++ + Sbjct: 60 IEEKVQTE 67 >gi|313807323|gb|EFS45810.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL087PA2] Length = 134 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ V + K DI ++ + I D V++S + + V+++ D + Sbjct: 1 MSATEYAIELARVVAYAALDKKGFDIVALDVSEHL-AITDIFVVISAANERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DKTMHEH 66 >gi|154174084|ref|YP_001407671.1| putative nicotinate (nicotinamide) nucleotide adenylyltransferase [Campylobacter curvus 525.92] gi|112803616|gb|EAU00960.1| putative nicotinate (nicotinamide) nucleotide adenylyltransferase [Campylobacter curvus 525.92] Length = 291 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I +++ L E KAE+I + + R ++I + +H S++D+L LK Sbjct: 184 SMNERIENIVKILDEKKAEEIQVFDMSD-RDYFVKFVIIATTMGERHAYSLSDDLKENLK 242 >gi|294629312|ref|ZP_06707872.1| iojap protein 155 [Streptomyces sp. e14] gi|292832645|gb|EFF90994.1| iojap protein 155 [Streptomyces sp. e14] Length = 148 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I T + + A DI + + + S I D ++ S + + V +I D + Sbjct: 1 MTATDRSIELINTAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKAIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLHKE 66 >gi|313837364|gb|EFS75078.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL037PA2] gi|314927962|gb|EFS91793.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL044PA1] gi|314971748|gb|EFT15846.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL037PA3] gi|328907088|gb|EGG26854.1| iojap-like protein [Propionibacterium sp. P08] Length = 128 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + E K DI I+ + I D V++S S + V+++ D + Sbjct: 1 MSATEQAIEFARVAAHAALEKKGFDIVAIDVSEHL-AITDIFVVISAASERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DEAMHEH 66 >gi|307266914|ref|ZP_07548433.1| Iojap-related protein [Thermoanaerobacter wiegelii Rt8.B1] gi|306918071|gb|EFN48326.1| Iojap-related protein [Thermoanaerobacter wiegelii Rt8.B1] Length = 79 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/63 (23%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + + L++ KA DI + +++ D VI +G S HV ++ D + Sbjct: 1 MIDGKDKVSKIYKVLEDKKAYDIKILYIGD-LTIVADYFVIATGSSDTHVKALTDEIEKN 59 Query: 73 LKK 75 L K Sbjct: 60 LWK 62 >gi|146296823|ref|YP_001180594.1| iojap-like protein [Caldicellulosiruptor saccharolyticus DSM 8903] gi|145410399|gb|ABP67403.1| iojap-like protein [Caldicellulosiruptor saccharolyticus DSM 8903] Length = 108 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + ++ L + KA+DI ++ + ++I D +I S + +HV ++ D + Sbjct: 1 MEKILQ-IVRILSQKKAQDIVVLDISK-LTIIADYFIICSASNIQHVKALVDEIEEK 55 >gi|239931331|ref|ZP_04688284.1| hypothetical protein SghaA1_24130 [Streptomyces ghanaensis ATCC 14672] gi|291439706|ref|ZP_06579096.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] gi|291342601|gb|EFE69557.1| conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 148 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + T + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSLELVTTAAQAAADKLAHDIVAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLNKE 66 >gi|257066426|ref|YP_003152682.1| iojap-like protein [Anaerococcus prevotii DSM 20548] gi|256798306|gb|ACV28961.1| iojap-like protein [Anaerococcus prevotii DSM 20548] Length = 102 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + T+++ L + AED+ I+ S S I D VI SG S ++AD + L+K+ Sbjct: 2 EKLETILKTLNDKLAEDVKVIDLDS--SSIADKFVIASGGSINQTRALADYIEDDLEKE 58 >gi|318060752|ref|ZP_07979475.1| hypothetical protein SSA3_22610 [Streptomyces sp. SA3_actG] gi|318078328|ref|ZP_07985660.1| hypothetical protein SSA3_16839 [Streptomyces sp. SA3_actF] gi|333027146|ref|ZP_08455210.1| hypothetical protein STTU_4650 [Streptomyces sp. Tu6071] gi|332746998|gb|EGJ77439.1| hypothetical protein STTU_4650 [Streptomyces sp. Tu6071] Length = 155 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELIKAASQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDAI 59 Query: 70 ISYLKK 75 L K Sbjct: 60 EERLAK 65 >gi|262203083|ref|YP_003274291.1| iojap-like protein [Gordonia bronchialis DSM 43247] gi|262086430|gb|ACY22398.1| iojap-like protein [Gordonia bronchialis DSM 43247] Length = 120 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + ++ A D+ I+ + +I D VI S + + V +I D + Sbjct: 1 MTASAQALDMARVAAAAAEDKLAHDVTVIDVSEQL-VITDLFVIASADNERQVNAIVDEI 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDKLRE 65 >gi|171912071|ref|ZP_02927541.1| iojap-like protein [Verrucomicrobium spinosum DSM 4136] Length = 192 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 KAEDI ++ S + D VI + S H+ +I + + Sbjct: 33 KKAEDIVIMDV-QGISPVADYFVICTATSMPHLKAIRNEVKDR 74 >gi|284047529|ref|YP_003397868.1| iojap-like protein [Acidaminococcus fermentans DSM 20731] gi|283951750|gb|ADB46553.1| iojap-like protein [Acidaminococcus fermentans DSM 20731] Length = 117 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 DI + S + D +I S ST V +IAD + L ++ Sbjct: 20 RDILLLNM-EGLSSVTDYFMICSAPSTTQVRAIADGIEDKLAQE 62 >gi|268608892|ref|ZP_06142619.1| iojap-like protein [Ruminococcus flavefaciens FD-1] Length = 119 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L K EDI ++ +++ D VIV+G S H ++AD + + +K Sbjct: 4 KEKLELIVKTLDLKKGEDIQVLKIAD-LTILADYFVIVNGTSNTHARTLADEVEFQMSQK 62 >gi|73667276|ref|YP_303292.1| Iojap-related protein [Ehrlichia canis str. Jake] gi|72394417|gb|AAZ68694.1| Iojap-related protein [Ehrlichia canis str. Jake] Length = 118 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + L + KA +I + + +S + + ++I SG S+ HV S+A+ + Sbjct: 6 SETNSTEELKNLITCILDKHKASNIVTMNISD-KSNLAEYLIIASGESSYHVKSLAEKIK 64 Query: 71 SYLK 74 +K Sbjct: 65 KEIK 68 >gi|218281646|ref|ZP_03488047.1| hypothetical protein EUBIFOR_00614 [Eubacterium biforme DSM 3989] gi|218217253|gb|EEC90791.1| hypothetical protein EUBIFOR_00614 [Eubacterium biforme DSM 3989] Length = 112 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + V+ + E KA+D+ + TS + D+M++ S + + +IA N+ L++ Sbjct: 2 EILDIVVHAICEKKAQDVRVYDVTS-LTPFMDSMIVCSTTNIRQNNAIAQNIKDRLRE 58 >gi|220903836|ref|YP_002479148.1| iojap-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219868135|gb|ACL48470.1| iojap-like protein [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 143 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 V + L+E KA + ++ D +V+ S +H S+AD + ++ N Sbjct: 33 VAQWLEEHKALRVVCLDL-EGEGSFADVLVVAGANSVRHAQSLADGVAQLCREHN 86 >gi|291538940|emb|CBL12051.1| iojap-related protein [Roseburia intestinalis XB6B4] Length = 115 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++ L++ KAED+ I+ + S I D +I G + + ++ D + L K + Sbjct: 8 KIAVKALEDKKAEDVKVIDIREI-SPIADFFIIADGMNQNQIQAMRDAVDEALYKAD 63 >gi|291456543|ref|ZP_06595933.1| iojap-like protein [Bifidobacterium breve DSM 20213] gi|291381820|gb|EFE89338.1| iojap-like protein [Bifidobacterium breve DSM 20213] Length = 128 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + I E +KA DI + L I D M+I + + V ++A+ + Sbjct: 1 MPAVQDSINAIRVAAEAADRIKATDIVAFDVADLLG-ITDIMMIAGASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|332982276|ref|YP_004463717.1| iojap-like protein [Mahella australiensis 50-1 BON] gi|332699954|gb|AEE96895.1| iojap-like protein [Mahella australiensis 50-1 BON] Length = 118 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + KA+DI ++ ++I D VI S RST ++ D + + Sbjct: 4 KSKEMALMIGRMMDDKKAQDIIVLDVAE-MTIIADEFVICSVRSTVQSRALCDYIEEKMD 62 Query: 75 K 75 + Sbjct: 63 E 63 >gi|289758550|ref|ZP_06517928.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] gi|289714114|gb|EFD78126.1| conserved hypothetical protein [Mycobacterium tuberculosis T85] Length = 133 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI SG + + V +I D + +++ Sbjct: 48 DDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQ 89 >gi|283778857|ref|YP_003369612.1| iojap-like protein [Pirellula staleyi DSM 6068] gi|283437310|gb|ADB15752.1| iojap-like protein [Pirellula staleyi DSM 6068] Length = 134 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 14/77 (18%), Positives = 33/77 (42%), Gaps = 2/77 (2%) Query: 1 MLANTEKQALQTADHLD-SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRST 59 M + E + L +E + +D+ ++ +++I D VI +G S Sbjct: 1 MASTAENPTTKRDPELSLKLAVAAAIAAEENRGQDVAVLDMRE-QTVIFDFFVIATGTSQ 59 Query: 60 KHVASIADNLISYLKKK 76 + + ++ D + L+K+ Sbjct: 60 RQLRAMGDAVDDVLQKE 76 >gi|326563449|gb|EGE13714.1| hypothetical protein E9O_08984 [Moraxella catarrhalis 12P80B1] Length = 121 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T +LD +A V + L +LKA++I +E + I + +VI S +HV ++AD L + Sbjct: 2 TTLNLDQTLALVTKTLDDLKAKNITTLEI-EHLTEIAERIVICEATSKRHVKALADKLGA 60 Query: 72 YLKK 75 K+ Sbjct: 61 ATKE 64 >gi|226356989|ref|YP_002786729.1| iojap-like protein [Deinococcus deserti VCD115] gi|226318979|gb|ACO46975.1| putative iojap-related protein [Deinococcus deserti VCD115] Length = 121 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 10/62 (16%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T + + +++ +E +AED+ ++ T + S + + VI + + + ++ +N+ Sbjct: 2 TDQTIQQQLRAIVDAARERRAEDVTVLDLTDVSSTL-EYFVICTASAGLQLNAVQENIRE 60 Query: 72 YL 73 Sbjct: 61 KA 62 >gi|229815335|ref|ZP_04445670.1| hypothetical protein COLINT_02381 [Collinsella intestinalis DSM 13280] gi|229809115|gb|EEP44882.1| hypothetical protein COLINT_02381 [Collinsella intestinalis DSM 13280] Length = 151 Score = 56.6 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 AEDIC I+ T S +CD V+ +G +T+ V +I D + + K Sbjct: 55 KGAEDICIIDLTE-LSDVCDYFVLATGSNTRMVDAIVDEVEEKVAK 99 >gi|317123002|ref|YP_004103005.1| iojap-like protein [Thermaerobacter marianensis DSM 12885] gi|315592982|gb|ADU52278.1| iojap-like protein [Thermaerobacter marianensis DSM 12885] Length = 118 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 D+ ++ +LI D VI G++ HV +IAD + L ++ Sbjct: 21 DVVILDM-EGLTLIADYFVICHGQNPIHVRAIADGVEEDLAEQ 62 >gi|197120137|ref|YP_002140564.1| hypothetical protein Gbem_3776 [Geobacter bemidjiensis Bem] gi|197089497|gb|ACH40768.1| protein of unknown function DUF143 [Geobacter bemidjiensis Bem] Length = 128 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + KA D+ +E + S I D +V+ +GRS + V ++AD++ Sbjct: 4 KEILTAEERAIKCAAFALDKKALDVKVLEIKKI-SSIADYLVLATGRSDRQVMAMADSVK 62 Query: 71 SYLK 74 +K Sbjct: 63 QSMK 66 >gi|325479556|gb|EGC82652.1| iojap-like protein [Anaerococcus prevotii ACS-065-V-Col13] Length = 102 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L E AEDI + + S I D +I SG S ++AD + L+K+ Sbjct: 4 VEIILKTLDEKLAEDIKVVNLDN--SSIADTFIIASGGSINQTKALADYIEDDLEKE 58 >gi|326803783|ref|YP_004321601.1| iojap-like protein [Aerococcus urinae ACS-120-V-Col10a] gi|326650787|gb|AEA00970.1| iojap-like protein [Aerococcus urinae ACS-120-V-Col10a] Length = 125 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + +++ + +DI +E + + + D VIVS ++ + V +I +++ + Sbjct: 9 LMELIVKAADDRLGQDIVALEV-NQLTPLADYFVIVSAKNDRQVNAIVESIAEAV 62 >gi|283850695|ref|ZP_06367982.1| iojap-like protein [Desulfovibrio sp. FW1012B] gi|283573938|gb|EFC21911.1| iojap-like protein [Desulfovibrio sp. FW1012B] Length = 140 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 2/71 (2%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 EK++ + D + V L E KA+DI IE + +CD M++ S S + ++ Sbjct: 3 EKKSDKNLSARDKAV-IVASWLAEKKAKDILAIEVAP-LNPVCDAMILASAVSLRQAKAL 60 Query: 66 ADNLISYLKKK 76 AD+++ ++ Sbjct: 61 ADHVLLRSGEE 71 >gi|153207796|ref|ZP_01946396.1| iojap family protein [Coxiella burnetii 'MSU Goat Q177'] gi|165919092|ref|ZP_02219178.1| iojap family protein [Coxiella burnetii RSA 334] gi|212218826|ref|YP_002305613.1| iojap protein family [Coxiella burnetii CbuK_Q154] gi|120576348|gb|EAX32972.1| iojap family protein [Coxiella burnetii 'MSU Goat Q177'] gi|165917226|gb|EDR35830.1| iojap family protein [Coxiella burnetii RSA 334] gi|212013088|gb|ACJ20468.1| iojap protein family [Coxiella burnetii CbuK_Q154] Length = 112 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V+ L E KA I ++ T + + D M++ S S +H +++AD +I K Sbjct: 2 KSAELANLVINTLDEHKALQITDLDVT-TLTDLMDRMIVCSATSKRHASALADKVIRRAK 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|313633193|gb|EFS00072.1| YqeL [Listeria seeligeri FSL N1-067] Length = 55 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + + +AEDI ++ S D VI G S K V +IA Sbjct: 11 AKAADDKRAEDILALDM-KGLSSFADYFVICHGNSDKQVQAIARE 54 >gi|224418454|ref|ZP_03656460.1| hypothetical protein HcanM9_04165 [Helicobacter canadensis MIT 98-5491] gi|253827770|ref|ZP_04870655.1| conserved hypothetical protein [Helicobacter canadensis MIT 98-5491] gi|313141986|ref|ZP_07804179.1| gerC2 protein [Helicobacter canadensis MIT 98-5491] gi|253511176|gb|EES89835.1| conserved hypothetical protein [Helicobacter canadensis MIT 98-5491] gi|313131017|gb|EFR48634.1| gerC2 protein [Helicobacter canadensis MIT 98-5491] Length = 113 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I +++ L++ K E+I + + D ++I + KH ++ D+L Sbjct: 2 QENRQPIIKFIIQILEDKKGENIEVFDLKNT-DYFVDYVIITTAFVDKHALALLDSLKKE 60 Query: 73 LKKKN 77 LK+KN Sbjct: 61 LKQKN 65 >gi|78045095|ref|YP_359253.1| iojap protein,-like protein [Carboxydothermus hydrogenoformans Z-2901] gi|77997210|gb|ABB16109.1| iojap protein, homolog [Carboxydothermus hydrogenoformans Z-2901] Length = 120 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I M+ + K ++ ++ +S + ICD +IVS ST V +I DN+ L + Sbjct: 9 INIAMDAALDKKGFNLSLLDVSS-LTPICDYFLIVSASSTIQVKAIVDNIEEKLSE 63 >gi|296112394|ref|YP_003626332.1| hypothetical protein MCR_0167 [Moraxella catarrhalis RH4] gi|295920088|gb|ADG60439.1| conserved hypothetical protein [Moraxella catarrhalis RH4] gi|326561902|gb|EGE12237.1| hypothetical protein E9G_02363 [Moraxella catarrhalis 7169] gi|326563336|gb|EGE13603.1| hypothetical protein E9M_03854 [Moraxella catarrhalis 46P47B1] gi|326565989|gb|EGE16150.1| hypothetical protein E9K_02691 [Moraxella catarrhalis 103P14B1] gi|326568877|gb|EGE18946.1| hypothetical protein E9Q_02543 [Moraxella catarrhalis BC1] gi|326569177|gb|EGE19238.1| hypothetical protein E9S_06675 [Moraxella catarrhalis BC7] gi|326571849|gb|EGE21854.1| hypothetical protein E9U_01346 [Moraxella catarrhalis BC8] gi|326575362|gb|EGE25287.1| hypothetical protein E9Y_02791 [Moraxella catarrhalis 101P30B1] gi|326576552|gb|EGE26460.1| hypothetical protein E9W_00610 [Moraxella catarrhalis CO72] gi|326578022|gb|EGE27886.1| hypothetical protein EA1_00845 [Moraxella catarrhalis O35E] Length = 121 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T +LD +A V L +LKA++I +E + I + +VI S +HV ++AD L + Sbjct: 2 TTLNLDQTLALVTTTLDDLKAKNITTLEI-EHLTEIAERIVICEATSKRHVKALADKLGA 60 Query: 72 YLKK 75 K+ Sbjct: 61 ATKE 64 >gi|72162569|ref|YP_290226.1| Iojap-like protein [Thermobifida fusca YX] gi|71916301|gb|AAZ56203.1| Iojap-related protein [Thermobifida fusca YX] Length = 134 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 26/67 (38%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + A+DI + + +I D ++ S + + V +I D + Sbjct: 1 MTATERTVELVTIAATAAADKLAQDIVAYDVSDQL-VITDAFLLCSAPNDRQVRAIVDEI 59 Query: 70 ISYLKKK 76 L ++ Sbjct: 60 EERLYRQ 66 >gi|302545449|ref|ZP_07297791.1| iojap-like protein [Streptomyces hygroscopicus ATCC 53653] gi|302463067|gb|EFL26160.1| iojap-like protein [Streptomyces himastatinicus ATCC 53653] Length = 162 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 15/74 (20%), Positives = 29/74 (39%), Gaps = 1/74 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 + + + D I + + A DI + + + S I D ++ S + + V Sbjct: 10 TDRKASPVTATDRSIELINAAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQV 68 Query: 63 ASIADNLISYLKKK 76 SI D + L K+ Sbjct: 69 KSIVDEIEERLNKE 82 >gi|169350473|ref|ZP_02867411.1| hypothetical protein CLOSPI_01241 [Clostridium spiroforme DSM 1552] gi|169292793|gb|EDS74926.1| hypothetical protein CLOSPI_01241 [Clostridium spiroforme DSM 1552] Length = 114 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 11/57 (19%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L + A+DI I+ L S + D V+ S + + + ++ D++ + + Sbjct: 4 LEIIVKALDDKLAKDIVVIDM-QLASPVFDTFVVCSADNERLMNALKDSVEDSMAEN 59 >gi|242083302|ref|XP_002442076.1| hypothetical protein SORBIDRAFT_08g009421 [Sorghum bicolor] gi|241942769|gb|EES15914.1| hypothetical protein SORBIDRAFT_08g009421 [Sorghum bicolor] Length = 130 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 31/70 (44%), Gaps = 5/70 (7%) Query: 12 TADHLDSCIAT--VMECLKELKAEDICHIENTSLR---SLICDNMVIVSGRSTKHVASIA 66 + + V + L++++A D+ D MV+ +GRS HV +IA Sbjct: 36 ARPQAAALLELSEVEKVLRDVRAGDVRVFPVGEGGLHGGACADYMVVATGRSDWHVRNIA 95 Query: 67 DNLISYLKKK 76 L+ +K+K Sbjct: 96 QALLYKIKQK 105 >gi|296453915|ref|YP_003661058.1| iojap-like protein [Bifidobacterium longum subsp. longum JDM301] gi|296183346|gb|ADH00228.1| iojap-like protein [Bifidobacterium longum subsp. longum JDM301] Length = 137 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E +KA DI + L I D M+I + + V ++A+ + Sbjct: 1 MPALQDSINAVRVAAEAADRIKATDIMAFDVADLLG-ITDIMMIAGASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|78777950|ref|YP_394265.1| Iojap-related protein [Sulfurimonas denitrificans DSM 1251] gi|78498490|gb|ABB45030.1| Iojap-related protein [Sulfurimonas denitrificans DSM 1251] Length = 111 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + I + + L + KAE+I + ++ D +I S ++H +++ D+L + LK Sbjct: 1 MQNRIEKITDVLDKNKAENIEVFDLRE-KNYFVDYAIIASSLGSRHTSALLDHLKNELK 58 >gi|34557083|ref|NP_906898.1| hypothetical protein WS0670 [Wolinella succinogenes DSM 1740] gi|34482798|emb|CAE09798.1| conserved hypothetical protein [Wolinella succinogenes] Length = 260 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++E L KAE+I + S + D +VI + + KH AS+ D L + LK K Sbjct: 151 KERAQEIVEILDSKKAENIELFDL-SGSDYLVDYVVIATALADKHAASLLDTLKTELKPK 209 >gi|291166378|gb|EFE28424.1| iojap-like protein [Filifactor alocis ATCC 35896] Length = 114 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + T++ +K+ E+I ++ S I + +I S + + V++IA N+ +K Sbjct: 4 LKTIISAIKDKLGENIVILDIKK-VSTISEYFIIASADNERKVSAIAKNVEDEMK 57 >gi|119358428|ref|YP_913072.1| iojap-like protein [Chlorobium phaeobacteroides DSM 266] gi|119355777|gb|ABL66648.1| iojap-like protein [Chlorobium phaeobacteroides DSM 266] Length = 131 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + E E K E++ ++ + + D VI++ S + + AD++++ LK+ + Sbjct: 24 LARRIAELSLEKKCENVKILDLKR-LTSVTDYFVIITADSDRKARAAADHIVAMLKEDD 81 >gi|302551366|ref|ZP_07303708.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] gi|302468984|gb|EFL32077.1| conserved hypothetical protein [Streptomyces viridochromogenes DSM 40736] Length = 148 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I T + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTVTDRSQELINTAAHAAADKLAHDIVAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L+K+ Sbjct: 60 EERLQKE 66 >gi|227504486|ref|ZP_03934535.1| iojap family protein [Corynebacterium striatum ATCC 6940] gi|227198903|gb|EEI78951.1| iojap family protein [Corynebacterium striatum ATCC 6940] Length = 156 Score = 56.2 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D T E A +I I+ + + I + V+ S + + VASI + + Sbjct: 1 MSVTDVARKMAETAAHAADEKLATNIVAIDVSDVL-AITEIFVLASAETERQVASIVEEI 59 Query: 70 ISYLKK 75 L K Sbjct: 60 EDELTK 65 >gi|332799463|ref|YP_004460962.1| iojap-like protein [Tepidanaerobacter sp. Re1] gi|332697198|gb|AEE91655.1| iojap-like protein [Tepidanaerobacter sp. Re1] Length = 134 Score = 56.2 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +C LK+ K +DI ++ +S+ + D VI +G S HV ++AD + L Sbjct: 4 DPKTCAIEAAGILKDKKGQDILVLDISSIA-VFSDYFVIATGISPIHVQALADEVEQRL 61 >gi|254393600|ref|ZP_05008731.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] gi|294812580|ref|ZP_06771223.1| DUF143 domain-containing protein [Streptomyces clavuligerus ATCC 27064] gi|326440968|ref|ZP_08215702.1| hypothetical protein SclaA2_07860 [Streptomyces clavuligerus ATCC 27064] gi|197707218|gb|EDY53030.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] gi|294325179|gb|EFG06822.1| DUF143 domain-containing protein [Streptomyces clavuligerus ATCC 27064] Length = 148 Score = 56.2 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELVNLAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLSKE 66 >gi|148266139|ref|YP_001232845.1| iojap-like protein [Geobacter uraniireducens Rf4] gi|146399639|gb|ABQ28272.1| iojap-like protein [Geobacter uraniireducens Rf4] Length = 128 Score = 56.2 bits (135), Expect = 2e-06, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 5/70 (7%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 +K+ + + + C A + + KA D+ +E S I D +V+ +GRS K +I Sbjct: 3 DKKEMTSRERAIKCAACAL----DKKALDVKILEIKK-LSSIADYLVLATGRSDKQAQAI 57 Query: 66 ADNLISYLKK 75 AD++ LKK Sbjct: 58 ADSVKQGLKK 67 >gi|239907179|ref|YP_002953920.1| hypothetical protein DMR_25430 [Desulfovibrio magneticus RS-1] gi|239797045|dbj|BAH76034.1| hypothetical protein [Desulfovibrio magneticus RS-1] Length = 152 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Query: 26 CLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 L E KA++I ++ T S IC+ MV+ S S + ++AD++++ + Sbjct: 22 WLYEKKAKEIQAVDVT-GLSPICEAMVMASAGSARQAQALADHVLARCGE 70 >gi|212702073|ref|ZP_03310201.1| hypothetical protein DESPIG_00080 [Desulfovibrio piger ATCC 29098] gi|212674478|gb|EEB34961.1| hypothetical protein DESPIG_00080 [Desulfovibrio piger ATCC 29098] Length = 130 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/73 (20%), Positives = 32/73 (43%), Gaps = 2/73 (2%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 + + + + L+E KA D+ I+ + D +++VS S +H S Sbjct: 6 STPKKYSELPTAEKMA-VIKAWLEEHKAVDVVEIDLA-GQGAFTDALLVVSATSVRHAQS 63 Query: 65 IADNLISYLKKKN 77 +AD + + ++N Sbjct: 64 LADGVSALCHEQN 76 >gi|326403743|ref|YP_004283825.1| hypothetical protein ACMV_15960 [Acidiphilium multivorum AIU301] gi|325050605|dbj|BAJ80943.1| hypothetical protein ACMV_15960 [Acidiphilium multivorum AIU301] Length = 107 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + E L + KAE+I I+ S R+ D MV+ +G + + +A++A +L+ L Sbjct: 3 RVITESLADDKAENIVTIDLAS-RASFADRMVVATGLADRQIAAMATHLLEKL 54 >gi|297180051|gb|ADI16276.1| uncharacterized homolog of plant iojap protein [uncultured bacterium HF0010_16H03] Length = 114 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L + KAE++ ++ + S D ++I + S +H S+++ L+ +K Sbjct: 4 RNLQEICSKTLVDNKAENVLTLDI-NGISSFADAIIIATASSNRHAKSLSERLVESVK 60 >gi|148272677|ref|YP_001222238.1| hypothetical protein CMM_1497 [Clavibacter michiganensis subsp. michiganensis NCPPB 382] gi|147830607|emb|CAN01543.1| conserved hypothetical protein [Clavibacter michiganensis subsp. michiganensis NCPPB 382] Length = 125 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/64 (14%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + +A D+ ++ S + D +I S R+ ++ ++AD + Sbjct: 1 MTASPRALDLLKVAALAADSKQAIDLVALDV-SGPLPLTDVFLIASARNERNAQAVADEI 59 Query: 70 ISYL 73 + Sbjct: 60 EDKM 63 >gi|240144155|ref|ZP_04742756.1| iojap-like protein [Roseburia intestinalis L1-82] gi|257203858|gb|EEV02143.1| iojap-like protein [Roseburia intestinalis L1-82] Length = 115 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++ L++ KAED+ I+ + S I D +I G + + ++ D + L K + Sbjct: 8 KIAVKALEDKKAEDVKVIDIREI-SPIADFFIIADGMNQNQIQAMRDAVDEALYKAD 63 >gi|224045254|ref|XP_002191496.1| PREDICTED: hypothetical protein [Taeniopygia guttata] Length = 217 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 4/60 (6%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY---LKKK 76 I V+ L++ A+DIC I+ + CD +IVSG ST+H+ ++A+ ++ LK++ Sbjct: 80 IDLVVALLRQENAKDICVIQLSPELKY-CDYFIIVSGFSTRHLYAMANYMLKMYKHLKEE 138 >gi|116328786|ref|YP_798506.1| hypothetical protein LBL_2161 [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116331697|ref|YP_801415.1| hypothetical protein LBJ_2167 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] gi|116121530|gb|ABJ79573.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116125386|gb|ABJ76657.1| Conserved hypothetical protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197] Length = 124 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + + + + + K E+I + S+ S + VI + S ++A + Sbjct: 7 KQNPTTEKVLQVIYDIMVDKKCEEISILNLESVNSYLS-FFVICTVNSAVQANAVAREIR 65 Query: 71 SYLKK 75 LK+ Sbjct: 66 KTLKE 70 >gi|45644635|gb|AAS73023.1| hypothetical protein Red20E09_20 [uncultured marine gamma proteobacterium EBAC20E09] Length = 114 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S L E KAED+ ++ S D ++I + S +H S+++ L+ LK+ Sbjct: 3 TKSLSNICNHSLDESKAEDVIILDV-KAVSSFADEIIIATANSNRHATSVSNKLVEALKE 61 Query: 76 K 76 Sbjct: 62 N 62 >gi|302343832|ref|YP_003808361.1| iojap-like protein [Desulfarculus baarsii DSM 2075] gi|301640445|gb|ADK85767.1| iojap-like protein [Desulfarculus baarsii DSM 2075] Length = 150 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D+ ++ L D +I +GRST+ +IA+N+ KK Sbjct: 35 DLIVLDVGQLAGY-ADYFIIATGRSTRQAQAIAENVARVCKK 75 >gi|290968193|ref|ZP_06559737.1| iojap-like protein [Megasphaera genomosp. type_1 str. 28L] gi|290781771|gb|EFD94355.1| iojap-like protein [Megasphaera genomosp. type_1 str. 28L] Length = 125 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + E KA +I + SL+ D VI S R+ + S+AD + L Sbjct: 18 EIAAQAADEKKAWNITILNI-EESSLMADYFVICSVRNERMARSVADAVEEAL 69 >gi|227833678|ref|YP_002835385.1| hypothetical protein cauri_1854 [Corynebacterium aurimucosum ATCC 700975] gi|262184683|ref|ZP_06044104.1| hypothetical protein CaurA7_11869 [Corynebacterium aurimucosum ATCC 700975] gi|227454694|gb|ACP33447.1| hypothetical protein cauri_1854 [Corynebacterium aurimucosum ATCC 700975] Length = 155 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 26/67 (38%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D T E A +I IE + + I + V+ S + + V SI + + Sbjct: 1 MSITDEARQMAETAALAADEKLATNIAAIEVSDVL-AITEVFVLASADTERQVGSIVEEV 59 Query: 70 ISYLKKK 76 L KK Sbjct: 60 EDELTKK 66 >gi|261337838|ref|ZP_05965722.1| iojap-like protein [Bifidobacterium gallicum DSM 20093] gi|270277304|gb|EFA23158.1| iojap-like protein [Bifidobacterium gallicum DSM 20093] Length = 141 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + T + LKA D + + I D M+IVS + + V +IA+ + Sbjct: 1 MTALQESIDLVRTAAQAADRLKATDPVAYDVSDRLG-ITDAMLIVSANNERQVLAIAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|309389594|gb|ADO77474.1| iojap-like protein [Halanaerobium praevalens DSM 2228] Length = 124 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + + KAE I ++ ++I D VI S S K V ++A + L Sbjct: 5 SIKDLALLAADTADDKKAEAIDVLDV-QGLTVIADYFVICSANSDKQVRAVARAIEDKL 62 >gi|189219374|ref|YP_001940015.1| hypothetical protein Minf_1363 [Methylacidiphilum infernorum V4] gi|189186232|gb|ACD83417.1| Uncharacterized conserved protein, Iojap family [Methylacidiphilum infernorum V4] Length = 107 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 9/58 (15%), Positives = 24/58 (41%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + E K ++ + S D V+ + S H+ ++A L ++++ Sbjct: 2 LAQSCKKVILEKKGISPIILDLRKI-SSFVDFFVVCTATSEPHLKALAFGLEQKIREE 58 >gi|260654982|ref|ZP_05860470.1| iojap-like protein [Jonquetella anthropi E3_33 E1] gi|260630297|gb|EEX48491.1| iojap-like protein [Jonquetella anthropi E3_33 E1] Length = 115 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I ++ L++ KA D+ I+ R+ + D ++ +G S H++++ L K Sbjct: 6 TQRVINAIVSALEDKKAIDVKVIDL-EGRTSLADAFILATGNSDVHMSTLVRVADETLTK 64 Query: 76 K 76 + Sbjct: 65 E 65 >gi|189426674|ref|YP_001953851.1| iojap-like protein [Geobacter lovleyi SZ] gi|189422933|gb|ACD97331.1| iojap-like protein [Geobacter lovleyi SZ] Length = 138 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 TEK A + E + K D+ ++ T++ S I D +VI+SG+S K + Sbjct: 2 TEKTAEKQTLSPRERAIRCAELASDKKGYDLRVLDITAI-STIADFLVIISGQSDKQNQA 60 Query: 65 IADNLISYLKK 75 I D++ LKK Sbjct: 61 ICDHIRRELKK 71 >gi|297199620|ref|ZP_06917017.1| iojap superfamily protein [Streptomyces sviceus ATCC 29083] gi|197713453|gb|EDY57487.1| iojap superfamily protein [Streptomyces sviceus ATCC 29083] Length = 167 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/72 (22%), Positives = 30/72 (41%), Gaps = 1/72 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 TE + D + T + + A D+ + + + S I D ++ S + + V S Sbjct: 16 TESLVVTATDRSLELVNTAAQAAADKLAHDVIAYDVSDVLS-ITDAFLLASAPNDRQVKS 74 Query: 65 IADNLISYLKKK 76 I D + L K+ Sbjct: 75 IVDEIEERLSKE 86 >gi|183601717|ref|ZP_02963087.1| hypothetical protein BIFLAC_03657 [Bifidobacterium animalis subsp. lactis HN019] gi|241190785|ref|YP_002968179.1| hypothetical protein Balac_0745 [Bifidobacterium animalis subsp. lactis Bl-04] gi|241196191|ref|YP_002969746.1| hypothetical protein Balat_0745 [Bifidobacterium animalis subsp. lactis DSM 10140] gi|183219323|gb|EDT89964.1| hypothetical protein BIFLAC_03657 [Bifidobacterium animalis subsp. lactis HN019] gi|240249177|gb|ACS46117.1| hypothetical protein Balac_0745 [Bifidobacterium animalis subsp. lactis Bl-04] gi|240250745|gb|ACS47684.1| hypothetical protein Balat_0745 [Bifidobacterium animalis subsp. lactis DSM 10140] gi|295793774|gb|ADG33309.1| hypothetical protein BalV_0721 [Bifidobacterium animalis subsp. lactis V9] Length = 134 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + +KAED+ ICD M+I S + + V +IA+ + Sbjct: 1 MEQSINSVRVAATAADGMKAEDVVAYNVGDKLG-ICDLMMIASASNERQVLAIAEEVEKQ 59 Query: 73 L 73 L Sbjct: 60 L 60 >gi|326332975|ref|ZP_08199232.1| iojap-like protein [Nocardioidaceae bacterium Broad-1] gi|325949333|gb|EGD41416.1| iojap-like protein [Nocardioidaceae bacterium Broad-1] Length = 124 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +H T E KA I + + I D V+ S + + V SI D + Sbjct: 1 MTATEHAIELTITAARAASEKKAAHIMAFDVSDQL-AITDAFVLASAPNERQVQSIVDEV 59 Query: 70 ISYLKK 75 L+ Sbjct: 60 ELKLRD 65 >gi|312898646|ref|ZP_07758036.1| ribosome-associated protein, iojap family [Megasphaera micronuciformis F0359] gi|310620565|gb|EFQ04135.1| ribosome-associated protein, iojap family [Megasphaera micronuciformis F0359] Length = 116 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + K I ++ + SL+ D VIV+ + K +IADN+ LKK+ Sbjct: 9 EVAVRAAADKKGSAIEVLDMSQT-SLMADQFVIVTANNVKQAQAIADNVEENLKKE 63 >gi|212696197|ref|ZP_03304325.1| hypothetical protein ANHYDRO_00733 [Anaerococcus hydrogenalis DSM 7454] gi|212676826|gb|EEB36433.1| hypothetical protein ANHYDRO_00733 [Anaerococcus hydrogenalis DSM 7454] Length = 61 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L++ +A DI I+ +S + D V+ +G S ++ + + LKK+ Sbjct: 4 LDIIVKTLEDKQAYDIKVIDL-ENKSSVADYFVLATGNSINQNKALLEYIEENLKKR 59 >gi|302036460|ref|YP_003796782.1| hypothetical protein NIDE1097 [Candidatus Nitrospira defluvii] gi|300604524|emb|CBK40856.1| conserved protein of unknown function, Iojap family [Candidatus Nitrospira defluvii] Length = 140 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V + + KA D+ + + + D +VI SG S + ++AD++ L Sbjct: 5 ESKAKALAVASAILDKKATDVLILHIAK-LTSVADYLVIGSGDSERQARAMADHVGDVL 62 >gi|299472319|emb|CBN77507.1| conserved unknown protein [Ectocarpus siliculosus] Length = 170 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 15/69 (21%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 A++ L + T ++ E KA +I I +++ + MV++ G S +IA N Sbjct: 31 AMEDDPTLPEVL-TAVKAADERKAGNIVAIRVA-TLTVMTEFMVVLEGNSRPQNQAIAQN 88 Query: 69 LISYLKKKN 77 + +++ + Sbjct: 89 IEEKMEEMH 97 >gi|227892820|ref|ZP_04010625.1| Iojap family protein [Lactobacillus ultunensis DSM 16047] gi|227865322|gb|EEJ72743.1| Iojap family protein [Lactobacillus ultunensis DSM 16047] Length = 95 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ED + S++ D VI S S + + +I ++++ Sbjct: 2 TSQEILDFTTKAISDRHGEDTEAYDMR-GISILADYYVITSAGSNRQLHAIVNSIVEAAH 60 Query: 75 KKN 77 + N Sbjct: 61 ENN 63 >gi|257460191|ref|ZP_05625295.1| iojap homolog [Campylobacter gracilis RM3268] gi|257442632|gb|EEV17771.1| iojap homolog [Campylobacter gracilis RM3268] Length = 552 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + E L E KAEDI I+ + R I +VI + +++H AS+ + L Sbjct: 440 KDMQDPKQRAERIAEILNEKKAEDIQIIDMSE-REYIAKLVVIATTLTSRHAASLIEELK 498 Query: 71 SYLK 74 S LK Sbjct: 499 SVLK 502 >gi|158317002|ref|YP_001509510.1| iojap-like protein [Frankia sp. EAN1pec] gi|158112407|gb|ABW14604.1| iojap-like protein [Frankia sp. EAN1pec] Length = 144 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 25/65 (38%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + A+DI ++ + + I D VI S + + V + D + Sbjct: 1 MTASPRATELALAAAQAAADKIAQDILILDVSERLT-ITDCFVIASAENERQVKAAVDEI 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EEKLR 64 >gi|261368251|ref|ZP_05981134.1| iojap-like protein [Subdoligranulum variabile DSM 15176] gi|282569766|gb|EFB75301.1| iojap-like protein [Subdoligranulum variabile DSM 15176] Length = 124 Score = 55.5 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + L KA ++ + + + + VI +G ST HV ++AD L Sbjct: 2 ESRELAIRLARALDAKKALNVHILAV-EDLTTVTEYFVIATGTSTTHVGALADEAEFQLG 60 Query: 75 KK 76 ++ Sbjct: 61 RQ 62 >gi|297160547|gb|ADI10259.1| putative iojap [Streptomyces bingchenggensis BCW-1] Length = 149 Score = 55.5 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELINAAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEV 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLNKE 66 >gi|24214064|ref|NP_711545.1| hypothetical protein LA_1364 [Leptospira interrogans serovar Lai str. 56601] gi|45658213|ref|YP_002299.1| hypothetical protein LIC12367 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|24194941|gb|AAN48563.1|AE011316_4 conserved hypothetical protein [Leptospira interrogans serovar Lai str. 56601] gi|45601455|gb|AAS70936.1| conserved hypothetical protein [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length = 123 Score = 55.5 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 10/65 (15%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + + + + + K E++ + S+ S + VI + S ++A + Sbjct: 6 KQNPSTEDILRIIRDIMTDKKCEEVSILNLESVNSYLS-YFVICTVNSAVQANAVAREVR 64 Query: 71 SYLKK 75 LK+ Sbjct: 65 KTLKE 69 >gi|227877769|ref|ZP_03995802.1| Iojap family protein [Lactobacillus crispatus JV-V01] gi|256843620|ref|ZP_05549108.1| iojap protein [Lactobacillus crispatus 125-2-CHN] gi|256850096|ref|ZP_05555526.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US] gi|293380729|ref|ZP_06626777.1| iojap-like ribosome-associated protein [Lactobacillus crispatus 214-1] gi|295693365|ref|YP_003601975.1| iojap family protein [Lactobacillus crispatus ST1] gi|227862628|gb|EEJ70114.1| Iojap family protein [Lactobacillus crispatus JV-V01] gi|256615040|gb|EEU20241.1| iojap protein [Lactobacillus crispatus 125-2-CHN] gi|256713068|gb|EEU28059.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US] gi|290922693|gb|EFD99647.1| iojap-like ribosome-associated protein [Lactobacillus crispatus 214-1] gi|295031471|emb|CBL50950.1| Iojap family protein [Lactobacillus crispatus ST1] Length = 115 Score = 55.5 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ED + S++ D VI S S + + +I ++++ Sbjct: 2 TSQEILDFTTQAISDRHGEDTEAYDMR-GISILADYYVITSAGSNRQLHAIVNSIVDAAH 60 Query: 75 KKN 77 + N Sbjct: 61 ENN 63 >gi|58337793|ref|YP_194378.1| hypothetical protein LBA1528 [Lactobacillus acidophilus NCFM] gi|227904443|ref|ZP_04022248.1| Iojap family protein [Lactobacillus acidophilus ATCC 4796] gi|58255110|gb|AAV43347.1| hypothetical protein LBA1528 [Lactobacillus acidophilus NCFM] gi|227867818|gb|EEJ75239.1| Iojap family protein [Lactobacillus acidophilus ATCC 4796] Length = 115 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ED + S++ D VI S S + + +I ++++ Sbjct: 2 TSQEILDFTTKAISDRHGEDTEAYDMR-GVSILADYYVITSAGSNRQLHAIVNSIVDAAH 60 Query: 75 KKN 77 + N Sbjct: 61 ENN 63 >gi|291542647|emb|CBL15757.1| iojap-related protein [Ruminococcus bromii L2-63] Length = 117 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + L K DI I+ S++ D MVI +G S+ HV ++AD + L Sbjct: 9 LAAKALSSKKGLDIQIIKIAD-VSVLADYMVIATGTSSTHVKALADEVEYKL 59 >gi|315924334|ref|ZP_07920557.1| Iojap superfamily protein [Pseudoramibacter alactolyticus ATCC 23263] gi|315622405|gb|EFV02363.1| Iojap superfamily protein [Pseudoramibacter alactolyticus ATCC 23263] Length = 125 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 25/62 (40%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ +++ K I+ + D VI SG S + V +IA+N+ Sbjct: 13 SSEAFADLAQSWIEDRKGIRTKIIDVR-GSASYADFFVITSGGSERQVHAIAENIQYEAS 71 Query: 75 KK 76 K+ Sbjct: 72 KR 73 >gi|317970258|ref|ZP_07971648.1| Iojap-related protein [Synechococcus sp. CB0205] Length = 142 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 KA DI I + S I D VI SG + V ++ ++ L++ Sbjct: 37 RKATDIVLIRVEEI-SSIADWFVIASGFTDVQVRAMGRSVEDKLEEH 82 >gi|307106832|gb|EFN55077.1| hypothetical protein CHLNCDRAFT_134963 [Chlorella variabilis] Length = 364 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V + L E +A+D+ I+ R D MV+ + RS + V +A ++ LK Sbjct: 239 QEVADILAEARADDVAIIDVR-GRCAFTDYMVLATARSQRLVRMLAAAVLHQLK 291 >gi|315038847|ref|YP_004032415.1| Iojap family protein [Lactobacillus amylovorus GRL 1112] gi|325957285|ref|YP_004292697.1| Iojap family protein [Lactobacillus acidophilus 30SC] gi|312276980|gb|ADQ59620.1| Iojap family protein [Lactobacillus amylovorus GRL 1112] gi|325333850|gb|ADZ07758.1| Iojap family protein [Lactobacillus acidophilus 30SC] gi|327184015|gb|AEA32462.1| Iojap family protein [Lactobacillus amylovorus GRL 1118] Length = 115 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ED + S++ D VI S S + + +I ++++ Sbjct: 2 TSQEILDFTTKAISDRHGEDTEAYDMR-GISILADYYVITSAGSNRQLHAIVNSIVDEAH 60 Query: 75 KKN 77 + N Sbjct: 61 QNN 63 >gi|291394535|ref|XP_002713868.1| PREDICTED: 312-like [Oryctolagus cuniculus] Length = 235 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L++ A DIC I+ D VI SG ST+H+ ++A L+ K Sbjct: 95 VDLLVSLLRQENARDICVIQVPPEMKY-TDYFVIASGTSTRHLHAMACYLVKMYK 148 >gi|297180561|gb|ADI16773.1| uncharacterized homolog of plant iojap protein [uncultured gamma proteobacterium HF0010_11B23] Length = 113 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + L ELKA D+C E + S +++ SG S +H+ SIAD + Sbjct: 1 MPIPKSSKEIVKNCKSSLDELKAIDVCSFEVEEI-SSFTSFIMVASGTSGRHIQSIADKV 59 Query: 70 ISYLKKK 76 I LK K Sbjct: 60 IENLKDK 66 >gi|314923168|gb|EFS86999.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL001PA1] gi|314966936|gb|EFT11035.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL082PA2] gi|315093146|gb|EFT65122.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL060PA1] gi|315103208|gb|EFT75184.1| ribosome-associated protein, iojap family [Propionibacterium acnes HL050PA2] gi|327327757|gb|EGE69533.1| iojap-like protein [Propionibacterium acnes HL103PA1] Length = 134 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 9/67 (13%), Positives = 25/67 (37%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ K DI ++ + I D V++S + + V+++ D + Sbjct: 1 MSATEYAIELARVAAHAALGKKGFDIVALDVSEHL-AITDIFVVISAANERQVSAVVDAV 59 Query: 70 ISYLKKK 76 + + Sbjct: 60 DKAMHEH 66 >gi|111221375|ref|YP_712169.1| hypothetical protein FRAAL1937 [Frankia alni ACN14a] gi|111148907|emb|CAJ60586.1| conserved hypothetical protein [Frankia alni ACN14a] Length = 149 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 10/66 (15%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + D+ ++ + I D VI S + + V I D + Sbjct: 1 MTASPRAVELALAAAQAAADKLGHDLLILDVSERL-AITDCFVIASAGNERQVKGIVDEV 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EEKLRR 65 >gi|88606809|ref|YP_504828.1| iojap-related protein [Anaplasma phagocytophilum HZ] gi|88597872|gb|ABD43342.1| iojap-related protein [Anaplasma phagocytophilum HZ] Length = 127 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 15/59 (25%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ V+ L E A DI ++ R + + ++I SG ST HV ++A+++ + Sbjct: 4 STENLKDLVVAVLDEHSARDIAALDVRD-RCQLTEYIIISSGNSTSHVKALAEHVKKKV 61 >gi|298530229|ref|ZP_07017631.1| iojap-like protein [Desulfonatronospira thiodismutans ASO3-1] gi|298509603|gb|EFI33507.1| iojap-like protein [Desulfonatronospira thiodismutans ASO3-1] Length = 129 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 14/76 (18%), Positives = 36/76 (47%), Gaps = 4/76 (5%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + + K++ + + + L E KA D+ ++ T + + +++ + +S +H Sbjct: 1 MTQSRKKSPSPM---EQKLHHLAGALHEKKATDLYALDVT-VYCSAFEGLILATAQSERH 56 Query: 62 VASIADNLISYLKKKN 77 S+AD+L+ +N Sbjct: 57 ARSLADHLLEVAHGQN 72 >gi|62859279|ref|NP_001016140.1| hypothetical protein LOC548894 [Xenopus (Silurana) tropicalis] gi|213624100|gb|AAI70644.1| hypothetical protein LOC548894 [Xenopus (Silurana) tropicalis] gi|213625456|gb|AAI70648.1| hypothetical protein LOC548894 [Xenopus (Silurana) tropicalis] Length = 243 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 25/78 (32%), Positives = 39/78 (50%), Gaps = 6/78 (7%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 A E Q L D I T++ L++ A+D+C I D V+VSG ST+HV Sbjct: 88 AEAEVQLLDLLPSFD--INTLVSLLRQENAKDLCVIRVPPQLKY-TDYFVVVSGFSTRHV 144 Query: 63 ASIAD---NLISYLKKKN 77 ++A + YLK+++ Sbjct: 145 QAMAQYSVKVYKYLKRED 162 >gi|296121594|ref|YP_003629372.1| iojap-like protein [Planctomyces limnophilus DSM 3776] gi|296013934|gb|ADG67173.1| iojap-like protein [Planctomyces limnophilus DSM 3776] Length = 144 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 10/74 (13%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 +++ + +E + +D+ ++ T + + I D VI + + + Sbjct: 10 TTYQQELVLQQQDSLKNACHCARLAEEFRCKDVVLLDLTKI-TPIADYFVIATATNLRQT 68 Query: 63 ASIADNLISYLKKK 76 A++ + + KK+ Sbjct: 69 AALIEEVRGIFKKR 82 >gi|224006702|ref|XP_002292311.1| predicted protein [Thalassiosira pseudonana CCMP1335] gi|220971953|gb|EED90286.1| predicted protein [Thalassiosira pseudonana CCMP1335] Length = 100 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ KA DI + TS + + + +VIVSG S +IA+++ +++K Sbjct: 1 IVHSADMRKASDIVALRVTSC-TSLTNFVVIVSGTSRPQNQAIANSIAKDVEEK 53 >gi|307330514|ref|ZP_07609656.1| iojap-like protein [Streptomyces violaceusniger Tu 4113] gi|306883849|gb|EFN14893.1| iojap-like protein [Streptomyces violaceusniger Tu 4113] Length = 169 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 15/66 (22%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 24 VTATDRSLELINAAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 82 Query: 70 ISYLKK 75 L K Sbjct: 83 EERLNK 88 >gi|116670929|ref|YP_831862.1| iojap-like protein [Arthrobacter sp. FB24] gi|116611038|gb|ABK03762.1| iojap-like protein [Arthrobacter sp. FB24] Length = 133 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + A+DI ++ + + D +I S S + V +I D + Sbjct: 1 MTATDSSIAIARVAARAAADKIAQDIVGLDVSERL-ALADVFLIASAPSERQVNAIVDGI 59 Query: 70 ISYLKKKN 77 L K++ Sbjct: 60 EEELGKQD 67 >gi|300869172|ref|ZP_07113768.1| iojap-like protein [Oscillatoria sp. PCC 6506] gi|300332821|emb|CBN58966.1| iojap-like protein [Oscillatoria sp. PCC 6506] Length = 145 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ K +I ++ + S + D VIV+G S V +I + ++ + Sbjct: 41 EDRKGGNIVLLQVSE-VSYLADYFVIVTGFSNAQVRAITQAIAHKVETE 88 >gi|332670915|ref|YP_004453923.1| iojap-like protein [Cellulomonas fimi ATCC 484] gi|332339953|gb|AEE46536.1| iojap-like protein [Cellulomonas fimi ATCC 484] Length = 127 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +LKA++I ++ + ++ D +I SG + + V +I D + L Sbjct: 20 DLKAQEIIALDVSEQL-VLTDVFLIASGTNERQVGAIVDAVEEAL 63 >gi|160915282|ref|ZP_02077495.1| hypothetical protein EUBDOL_01291 [Eubacterium dolichum DSM 3991] gi|158433081|gb|EDP11370.1| hypothetical protein EUBDOL_01291 [Eubacterium dolichum DSM 3991] Length = 111 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + E K E + + S + DN+++ S + + V +IA N+ ++ Sbjct: 2 ELLDVIKKAIDEKKGEHVIKYDFRS-LNPFIDNVILCSAGNIRQVHAIAQNVKERARE 58 >gi|255630873|gb|ACU15799.1| unknown [Glycine max] Length = 177 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + L ++KA+++ I D MV+ +GRST HV +IA LI K+K Sbjct: 41 LQEIETVLTDVKADNVKVIPVPKH-CDWADFMVLATGRSTWHVKNIAQALIYKAKQK 96 >gi|227548748|ref|ZP_03978797.1| iojap family protein [Corynebacterium lipophiloflavum DSM 44291] gi|227079160|gb|EEI17123.1| iojap family protein [Corynebacterium lipophiloflavum DSM 44291] Length = 163 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + E +I I+ + + I D VIVS + + A+I + + Sbjct: 1 MTALQTSIDQATIAAKAADEKLGRNIAVIDVSDVVG-ITDIFVIVSADNERQAAAIVEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EGDL 63 >gi|119961258|ref|YP_948093.1| iojap-like protein [Arthrobacter aurescens TC1] gi|119948117|gb|ABM07028.1| putative iojap-like protein [Arthrobacter aurescens TC1] Length = 134 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 12/68 (17%), Positives = 27/68 (39%), Gaps = 1/68 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + AEDI ++ + + D +I S + + V +I D + Sbjct: 1 MSAHEQSITLARHAARAAADKLAEDIVALDVSERL-ALTDVFLIASAPTERQVNAIVDGI 59 Query: 70 ISYLKKKN 77 L K++ Sbjct: 60 EEELMKQD 67 >gi|296119919|ref|ZP_06838473.1| iojap-like protein [Corynebacterium ammoniagenes DSM 20306] gi|295967073|gb|EFG80344.1| iojap-like protein [Corynebacterium ammoniagenes DSM 20306] Length = 144 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 E A +I I+ + + I + VI S + + V SI + + L Sbjct: 1 MAELAARAADEKSASNIAVIDVSDVL-AITELFVIASADNERQVRSIVEEIEDAL 54 >gi|210633024|ref|ZP_03297624.1| hypothetical protein COLSTE_01532 [Collinsella stercoris DSM 13279] gi|210159311|gb|EEA90282.1| hypothetical protein COLSTE_01532 [Collinsella stercoris DSM 13279] Length = 154 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 AED+C ++ T S +CD VI +G +T+ V +I D + + K Sbjct: 60 KGAEDVCIVDLTE-LSDVCDYFVIATGSNTRMVDAIVDEVEEKVAK 104 >gi|119713339|gb|ABL97403.1| hypothetical protein MBMO_EB80-02D08.0035 [uncultured marine bacterium EB80_02D08] Length = 112 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + L + KAE++ ++ + S DN+VI + S +H S+++ L+ +K Sbjct: 4 KTLNDICTSTLSDNKAENVLSLDIKEI-SSFADNIVIATASSNRHAKSLSEKLVEEIK 60 >gi|306820574|ref|ZP_07454205.1| iojap-like protein [Eubacterium yurii subsp. margaretiae ATCC 43715] gi|304551391|gb|EFM39351.1| iojap-like protein [Eubacterium yurii subsp. margaretiae ATCC 43715] Length = 115 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + E L + EDI ++ S I D VIVS S + V ++ + L L+K+ Sbjct: 5 EKLKKIHEVLDKKLGEDIVILKI-EGISTITDYFVIVSAPSERQVKALEEALDYELEKE 62 >gi|124025597|ref|YP_001014713.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. NATL1A] gi|123960665|gb|ABM75448.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. NATL1A] Length = 124 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + KA DI ++ S I D ++I G S V +I +N+ L+ Sbjct: 2 DSNRLVELAAVACDDRKAGDIKLLKV-DKVSSIADWILITEGLSDVQVRAIVNNVEKTLR 60 Query: 75 KK 76 ++ Sbjct: 61 EE 62 >gi|37650591|emb|CAD69015.1| YqeL protein [Bacillus megaterium] Length = 97 Score = 54.7 bits (131), Expect = 4e-06, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 DI + SL+ D VI G S K V +IA + ++ Sbjct: 1 DIVALNM-EGISLVADYFVICHGNSDKQVQAIAREIKEKAHEQ 42 >gi|94987456|ref|YP_595389.1| hypothetical protein LI1014 [Lawsonia intracellularis PHE/MN1-00] gi|94731705|emb|CAJ55068.1| conserved hypothetical protein [Lawsonia intracellularis PHE/MN1-00] Length = 160 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K + + + L+E KA+++ + + ++L D +VI++ S++H +A Sbjct: 36 KSKFSQVSAIQKTV-ILTGWLEEHKAQNVLAFDVVN-KNLCMDIVVILTATSSRHAKGLA 93 Query: 67 DNLISYLKKKN 77 D ++ K+N Sbjct: 94 DGILEECTKQN 104 >gi|325185613|emb|CCA20095.1| conserved hypothetical protein [Albugo laibachii Nc14] Length = 633 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/74 (22%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 + + I V++ + K D+ ++ +S + MV V+ RS H+ Sbjct: 474 ERHADLIPVIPNTYFTIDEVIQAVTREKGIDVRTLDL-EGKSSLAKYMVFVTCRSQSHMR 532 Query: 64 SIADNLISYLKKKN 77 +AD +I LK +N Sbjct: 533 RLADMMIRSLKARN 546 >gi|291277398|ref|YP_003517170.1| hypothetical protein HMU11900 [Helicobacter mustelae 12198] gi|290964592|emb|CBG40445.1| Putative hypothetical protein [Helicobacter mustelae 12198] Length = 109 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L KAEDI I+ + I D ++I + + +H ++ D L + LK Sbjct: 3 QERLDFIIEILGSKKAEDIECIDVRE-KDYIVDYVIIATSMAGRHTYALLDLLKTELK 59 >gi|296488594|gb|DAA30707.1| hypothetical protein LOC509253 [Bos taurus] Length = 234 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 94 IDMLVSLLRQENARDICVIKVPPEMKY-TDYFVIGSGTSTRHLHAMAHYIVKMYK 147 >gi|115494970|ref|NP_001068866.1| hypothetical protein LOC509253 [Bos taurus] gi|112362261|gb|AAI20472.1| Hypothetical LOC509253 [Bos taurus] Length = 234 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 94 IDMLVSLLRQENARDICVIKVPPEMKY-TDYFVIGSGTSTRHLHAMAHYIVKMYK 147 >gi|313884920|ref|ZP_07818672.1| iojap-like protein [Eremococcus coleocola ACS-139-V-Col8] gi|312619611|gb|EFR31048.1| iojap-like protein [Eremococcus coleocola ACS-139-V-Col8] Length = 118 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 9/64 (14%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + +++ + A DI ++ + I D VI+S ++ + + +I + Sbjct: 1 MKEVLDKVQVIVKAADDRLATDIEVLDVKE-LTPIADYFVIMSAKNERQLDAIVQAITEA 59 Query: 73 LKKK 76 + Sbjct: 60 AEDH 63 >gi|313901246|ref|ZP_07834734.1| iojap-like protein [Clostridium sp. HGF2] gi|312954204|gb|EFR35884.1| iojap-like protein [Clostridium sp. HGF2] Length = 112 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D ++ V + + E K E + + D++VI S S + +IADN+ +++ Sbjct: 1 MDELLSIVQKAIDEKKGERALLYDF-HELNPFIDHVVICSAPSVRQTHAIADNIKDRVRE 59 Query: 76 K 76 Sbjct: 60 N 60 >gi|72173023|ref|XP_788764.1| PREDICTED: similar to Chromosome 7 open reading frame 30 [Strongylocentrotus purpuratus] gi|115664027|ref|XP_001204012.1| PREDICTED: similar to Chromosome 7 open reading frame 30 [Strongylocentrotus purpuratus] Length = 321 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A+DIC I + + D V+V+GRS +H+ ++A ++ K Sbjct: 170 IDDLVSILRDENAQDICVINIPKKKQYV-DYFVVVTGRSPRHLKAMALHINQQYK 223 >gi|258645351|ref|ZP_05732820.1| iojap-like protein [Dialister invisus DSM 15470] gi|260402700|gb|EEW96247.1| iojap-like protein [Dialister invisus DSM 15470] Length = 117 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + + E L K I ++ + I D +I S + K + AD + L++ Sbjct: 1 MEKTLELICEALSNKKGVLIKVLDVKD-LTSIADYFIISSVMNKKQAQASADEVEEKLEE 59 >gi|227499553|ref|ZP_03929660.1| iojap family protein [Anaerococcus tetradius ATCC 35098] gi|227218312|gb|EEI83566.1| iojap family protein [Anaerococcus tetradius ATCC 35098] Length = 102 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +++ L + AED+ I S I D V+ SG S ++AD + L+K+ Sbjct: 4 LDIILKTLDDKLAEDVKVINLEG--SSIADTFVLASGASINQTRALADYIEDDLEKE 58 >gi|212721350|ref|NP_001131842.1| hypothetical protein LOC100193217 [Zea mays] gi|194692690|gb|ACF80429.1| unknown [Zea mays] gi|195619642|gb|ACG31651.1| hypothetical protein [Zea mays] gi|195624574|gb|ACG34117.1| hypothetical protein [Zea mays] Length = 182 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 5/70 (7%) Query: 12 TADHLDSCIAT--VMECLKELKAEDICHIENTS---LRSLICDNMVIVSGRSTKHVASIA 66 + + + V + L++++A D+ D MV+ +GRS HV +IA Sbjct: 33 ARPQVGALLELPEVEKVLRDVRAGDVRVFPVGESGLHGGACADYMVVATGRSDWHVRNIA 92 Query: 67 DNLISYLKKK 76 L+ +K+K Sbjct: 93 QALLYKIKQK 102 >gi|242279958|ref|YP_002992087.1| iojap-like protein [Desulfovibrio salexigens DSM 2638] gi|242122852|gb|ACS80548.1| iojap-like protein [Desulfovibrio salexigens DSM 2638] Length = 128 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 16/74 (21%), Positives = 36/74 (48%), Gaps = 2/74 (2%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 T+++ + D D + V E L E +A D+ ++ I + +++ + +H Sbjct: 2 KTKEKKFKQIDTKDK-VQLVAEWLDEKQASDVSAVDV-QGICPIAEVVMVAGAKGVRHAQ 59 Query: 64 SIADNLISYLKKKN 77 ++AD ++ L K+N Sbjct: 60 ALADFVLEQLSKEN 73 >gi|297729007|ref|NP_001176867.1| Os12g0241000 [Oryza sativa Japonica Group] gi|108862390|gb|ABG21940.1| AGR_C_5039p, putative, expressed [Oryza sativa Japonica Group] gi|108862391|gb|ABG21941.1| AGR_C_5039p, putative, expressed [Oryza sativa Japonica Group] gi|215697169|dbj|BAG91163.1| unnamed protein product [Oryza sativa Japonica Group] gi|222616870|gb|EEE53002.1| hypothetical protein OsJ_35690 [Oryza sativa Japonica Group] gi|255670183|dbj|BAH95595.1| Os12g0241000 [Oryza sativa Japonica Group] Length = 183 Score = 54.3 bits (130), Expect = 5e-06, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 20 IATVMECLKELKAEDICHIENTSLR---SLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L++++A D+ D MV+ +GRS HV +IA L+ +K+K Sbjct: 44 LPEVEKVLRDVRAGDVRVFPVGEGGLHGGSCADYMVVATGRSDWHVRNIAQALLYKIKQK 103 >gi|29832023|ref|NP_826657.1| hypothetical protein SAV_5480 [Streptomyces avermitilis MA-4680] gi|29609141|dbj|BAC73192.1| hypothetical protein [Streptomyces avermitilis MA-4680] Length = 148 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I T + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSLELINTAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLNKE 66 >gi|47779369|gb|AAT38598.1| uncharacterized plant Iojap-like protein [uncultured gamma proteobacterium eBACHOT4E07] Length = 114 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + L + KAED+ ++ S D ++I + S +H S+++ L+ LK+ Sbjct: 4 KTLSEICNNSLTDSKAEDLLVLDV-ENISSFADKIIIATATSNRHALSVSEKLVESLKEN 62 >gi|308177592|ref|YP_003916998.1| Iojap-like protein [Arthrobacter arilaitensis Re117] gi|307745055|emb|CBT76027.1| Iojap-like protein [Arthrobacter arilaitensis Re117] Length = 126 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E AE++ ++ + D +IVSG S V +I D + Sbjct: 1 MGAHADSIALVKVAAHAASEKMAENMVALDVADRLG-VTDAFLIVSGGSEPQVNAIVDEI 59 Query: 70 ISYLKKK 76 ++ + ++ Sbjct: 60 VAEVLEE 66 >gi|326381581|ref|ZP_08203275.1| hypothetical protein SCNU_01480 [Gordonia neofelifaecis NRRL B-59395] gi|326199828|gb|EGD57008.1| hypothetical protein SCNU_01480 [Gordonia neofelifaecis NRRL B-59395] Length = 138 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + A DI I+ + +I D I S + + V SI + + Sbjct: 1 MTASAEARQMVTIAALAAADKVATDIVAIDVSETL-VITDAFFIASADNERQVNSIVEEI 59 Query: 70 ISYLKK 75 L++ Sbjct: 60 EDKLRE 65 >gi|126341885|ref|XP_001369779.1| PREDICTED: hypothetical protein [Monodelphis domestica] Length = 279 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I + + D V+ SG S +H+ ++A L+ K Sbjct: 137 IDLLVSLLRQENARDICVIWVSPALKYV-DYFVVASGASPRHLQAMAQYLLKTHK 190 >gi|213966180|ref|ZP_03394366.1| iojap homolog [Corynebacterium amycolatum SK46] gi|213951195|gb|EEB62591.1| iojap homolog [Corynebacterium amycolatum SK46] Length = 152 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + K ED+ ++ S +I D V+VS + + VA+I D + Sbjct: 1 MTAQPRAIELATAAAKAADSKKGEDVVVLDV-SGPVVITDAFVLVSADNERLVAAIVDEI 59 Query: 70 ISYLKK 75 L+ Sbjct: 60 EDDLRD 65 >gi|291519391|emb|CBK74612.1| iojap-related protein [Butyrivibrio fibrisolvens 16/4] Length = 115 Score = 54.3 bits (130), Expect = 6e-06, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 29/62 (46%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 V + L + KA DI I+ +++ S++ D ++ S + + ++ D + L Sbjct: 2 DSREIAKIVCKALDDKKAIDIKAIDISNI-SIMADYFIVSSASNQSQLNAMQDEVDRLLY 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|288924701|ref|ZP_06418638.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Prevotella buccae D17] gi|288338488|gb|EFC76837.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Prevotella buccae D17] Length = 110 Score = 53.9 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 21/46 (45%) Query: 31 KAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 K I + + I + VI G S V +IA+++ + +KK Sbjct: 10 KGSGIVIADLREIEGSIANYFVICQGSSPAQVEAIAESVSDFARKK 55 >gi|182438763|ref|YP_001826482.1| hypothetical protein SGR_4970 [Streptomyces griseus subsp. griseus NBRC 13350] gi|178467279|dbj|BAG21799.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus NBRC 13350] Length = 143 Score = 53.9 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELINAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L+K+ Sbjct: 60 EERLQKE 66 >gi|218186638|gb|EEC69065.1| hypothetical protein OsI_37926 [Oryza sativa Indica Group] Length = 180 Score = 53.9 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 3/60 (5%) Query: 20 IATVMECLKELKAEDICHIENTSLR---SLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L++++A D+ D MV+ +GRS HV +IA L+ +K+K Sbjct: 41 LPEVEKVLRDVRAGDVRVFPVGEGGLHGGSCADYMVVATGRSDWHVRNIAQALLYKIKQK 100 >gi|187251306|ref|YP_001875788.1| hypothetical protein Emin_0896 [Elusimicrobium minutum Pei191] gi|186971466|gb|ACC98451.1| Domain of unknown function DUF143 [Elusimicrobium minutum Pei191] Length = 204 Score = 53.9 bits (129), Expect = 6e-06, Method: Composition-based stats. Identities = 14/63 (22%), Positives = 29/63 (46%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + E KAE++ I+ S +CD +V+ + S H+ ++ + + LK Sbjct: 2 NTKELVFLTARYADEKKAENVTVIDL-KGMSSLCDYIVLATVTSRPHLEAVEQEVSTNLK 60 Query: 75 KKN 77 + N Sbjct: 61 QVN 63 >gi|239979407|ref|ZP_04701931.1| hypothetical protein SalbJ_08220 [Streptomyces albus J1074] gi|291451282|ref|ZP_06590672.1| conserved hypothetical protein [Streptomyces albus J1074] gi|291354231|gb|EFE81133.1| conserved hypothetical protein [Streptomyces albus J1074] Length = 143 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSTELITVAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLNKQ 66 >gi|152991236|ref|YP_001356958.1| hypothetical protein NIS_1494 [Nitratiruptor sp. SB155-2] gi|151423097|dbj|BAF70601.1| conserved hypothetical protein [Nitratiruptor sp. SB155-2] Length = 111 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + E +++ K E++ I+ + D +++ + S +H A++ D+L LK Sbjct: 3 IEKRAKRIKEVIEDKKGENVEIIDTSKG-DYFVDRVIVGTSLSDRHTAALLDHLKEKLKP 61 Query: 76 K 76 + Sbjct: 62 E 62 >gi|302786472|ref|XP_002975007.1| hypothetical protein SELMODRAFT_37611 [Selaginella moellendorffii] gi|300157166|gb|EFJ23792.1| hypothetical protein SELMODRAFT_37611 [Selaginella moellendorffii] Length = 114 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L++L+ D+ + R D MV VSG+ST+H+ +AD++++ +KKK Sbjct: 11 TVREVAKILRKLRGIDLKILNV-QARCQWTDYMVFVSGKSTRHIRGMADSIVARVKKK 67 >gi|329934606|ref|ZP_08284647.1| hypothetical protein SGM_0359 [Streptomyces griseoaurantiacus M045] gi|329305428|gb|EGG49284.1| hypothetical protein SGM_0359 [Streptomyces griseoaurantiacus M045] Length = 148 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I T + + A D+ + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSLQLINTAAQAAADKLAHDVIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLSKE 66 >gi|303327846|ref|ZP_07358286.1| iojap-like protein [Desulfovibrio sp. 3_1_syn3] gi|302862207|gb|EFL85141.1| iojap-like protein [Desulfovibrio sp. 3_1_syn3] Length = 151 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 +A + L+E KAE I + T + D +++++ S +H S+AD + + ++N Sbjct: 29 EKLAVITAWLEEHKAERIVSLNLTE-QGGFADALLVLTAGSMRHAQSLADGVAALCHERN 87 >gi|302791319|ref|XP_002977426.1| hypothetical protein SELMODRAFT_37609 [Selaginella moellendorffii] gi|300154796|gb|EFJ21430.1| hypothetical protein SELMODRAFT_37609 [Selaginella moellendorffii] Length = 114 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L++L+ D+ + R D MV VSG+ST+H+ +AD++++ +KKK Sbjct: 11 TVREVAKILRKLRGIDLKILNV-QARCQWTDYMVFVSGKSTRHIRGMADSIVARVKKK 67 >gi|120404879|ref|YP_954708.1| iojap-like protein [Mycobacterium vanbaalenii PYR-1] gi|119957697|gb|ABM14702.1| iojap-like protein [Mycobacterium vanbaalenii PYR-1] Length = 121 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ED+ I+ S + +I D VI SG + + V +I D + ++ Sbjct: 15 EDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMR 55 >gi|301108531|ref|XP_002903347.1| conserved hypothetical protein [Phytophthora infestans T30-4] gi|262097719|gb|EEY55771.1| conserved hypothetical protein [Phytophthora infestans T30-4] Length = 314 Score = 53.9 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 1/71 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 N + + I V + L+ KA D+ ++ ++ + D MV +GRS H+ Sbjct: 146 NRHADIIPAISQIYLTIDEVQQALEREKAIDVYTVDLA-GKTSLADFMVFATGRSQAHMR 204 Query: 64 SIADNLISYLK 74 +AD LI +K Sbjct: 205 RMADLLIKSMK 215 >gi|297182543|gb|ADI18704.1| uncharacterized homolog of plant iojap protein [uncultured Chloroflexi bacterium HF4000_28F02] Length = 106 Score = 53.9 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++E E A DI ++ + D V++S ST+ + ++ +++ + LK+ Sbjct: 2 IVEVASEKLAADIVMLDLR-GLASFTDYFVVMSADSTRLIQALEEDIATTLKQ 53 >gi|296209454|ref|XP_002751557.1| PREDICTED: uncharacterized protein C7orf30-like [Callithrix jacchus] Length = 234 Score = 53.9 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 94 IDLMVSLLRQENARDICVIQVPPEMKY-TDYFVIGSGTSTRHLHAMAYYVVKMYK 147 >gi|298346479|ref|YP_003719166.1| iojap family protein [Mobiluncus curtisii ATCC 43063] gi|298236540|gb|ADI67672.1| iojap family protein [Mobiluncus curtisii ATCC 43063] Length = 153 Score = 53.9 bits (129), Expect = 8e-06, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + K KA ++ ++ + ++ D V+ +G S + V +I D + Sbjct: 1 MSADAKSIELAIAAGQAAKSKKATEVIALDVSERL-VLTDMFVLATGNSDRQVRAIVDAV 59 Query: 70 ISYLKK 75 + K Sbjct: 60 DEAMTK 65 >gi|239987563|ref|ZP_04708227.1| hypothetical protein SrosN1_09685 [Streptomyces roseosporus NRRL 11379] gi|291444525|ref|ZP_06583915.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|291347472|gb|EFE74376.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] gi|320010867|gb|ADW05717.1| iojap-like protein [Streptomyces flavogriseus ATCC 33331] Length = 143 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELINAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L+K+ Sbjct: 60 EERLQKE 66 >gi|218460480|ref|ZP_03500571.1| hypothetical protein RetlK5_13681 [Rhizobium etli Kim 5] Length = 118 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 8/61 (13%) Query: 20 IATVMECLKELKAEDICHIENTS--LRSLICDNMVIV--SGRSTKHVASIADNLISYLKK 75 + V+ L++ KAEDI I+ + D + +G HV +I+D+L++ LK Sbjct: 7 LEAVLASLEDSKAEDIVTIDIARKIGAGRLHDRRLPAVRTG----HVMAISDHLLTDLKD 62 Query: 76 K 76 + Sbjct: 63 E 63 >gi|304389782|ref|ZP_07371741.1| Iojap family protein [Mobiluncus curtisii subsp. curtisii ATCC 35241] gi|304326958|gb|EFL94197.1| Iojap family protein [Mobiluncus curtisii subsp. curtisii ATCC 35241] Length = 153 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + K KA ++ ++ + ++ D V+ +G S + V +I D + Sbjct: 1 MSADAKSIELAIAAGQAAKSKKATEVIALDVSERL-VLTDMFVLATGNSDRQVRAIVDAV 59 Query: 70 ISYLKK 75 + K Sbjct: 60 DEAMTK 65 >gi|163782372|ref|ZP_02177370.1| hypothetical protein HG1285_06280 [Hydrogenivirga sp. 128-5-R1-1] gi|159882405|gb|EDP75911.1| hypothetical protein HG1285_06280 [Hydrogenivirga sp. 128-5-R1-1] Length = 109 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Query: 32 AEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 AED+ ++ ++ + I D VI + ST H ++AD L+ ++K Sbjct: 16 AEDVVVLDVSN-LTNIADFFVIATANSTIHAKALADYLVDEMEK 58 >gi|149641321|ref|XP_001513706.1| PREDICTED: similar to Chromosome 7 open reading frame 30 [Ornithorhynchus anatinus] Length = 176 Score = 53.6 bits (128), Expect = 8e-06, Method: Composition-based stats. Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I V+ L++ A+DIC I+ D ++VSG ST+H+ ++A+ L+ K+ Sbjct: 36 IDMVVSLLRQENAKDICVIQVPPEMKY-TDYFLVVSGSSTRHLHAMANYLVKVYKQ 90 >gi|114612368|ref|XP_001157652.1| PREDICTED: uncharacterized protein C7orf30-like [Pan troglodytes] Length = 235 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VIVSG ST+H+ ++A ++ K Sbjct: 94 IDMMVSLLRQENARDICVIQVPPEMRY-TDYFVIVSGTSTRHLHAMAFYVVKMYK 147 >gi|19923977|ref|NP_612455.1| hypothetical protein LOC115416 [Homo sapiens] gi|74731563|sp|Q96EH3|CG030_HUMAN RecName: Full=Uncharacterized protein C7orf30 gi|15147387|gb|AAH12331.1| Chromosome 7 open reading frame 30 [Homo sapiens] gi|51095014|gb|EAL24258.1| chromosome 7 open reading frame 30 [Homo sapiens] gi|119614191|gb|EAW93785.1| chromosome 7 open reading frame 30 [Homo sapiens] gi|189055161|dbj|BAG38148.1| unnamed protein product [Homo sapiens] gi|193785409|dbj|BAG54562.1| unnamed protein product [Homo sapiens] Length = 234 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VIVSG ST+H+ ++A ++ K Sbjct: 94 IDMMVSLLRQENARDICVIQVPPEMRY-TDYFVIVSGTSTRHLHAMAFYVVKMYK 147 >gi|15642921|ref|NP_227962.1| hypothetical protein TM0147 [Thermotoga maritima MSB8] gi|170288598|ref|YP_001738836.1| iojap-like protein [Thermotoga sp. RQ2] gi|4980640|gb|AAD35240.1|AE001700_4 conserved hypothetical protein [Thermotoga maritima MSB8] gi|61657496|emb|CAI44407.1| hypothetical protein [Thermotoga sp. RQ2] gi|170176101|gb|ACB09153.1| iojap-like protein [Thermotoga sp. RQ2] Length = 110 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +++ + E E+ ++ D VI + S H+ ++ D LI +K+ Sbjct: 5 LRKILKKISEKGGENPVVLDMRKTPVP-TDYFVIFTANSYTHMRAMRDELIDLIKE 59 >gi|218960697|ref|YP_001740472.1| hypothetical protein CLOAM0360 [Candidatus Cloacamonas acidaminovorans] gi|167729354|emb|CAO80265.1| conserved hypothetical protein [Candidatus Cloacamonas acidaminovorans] Length = 118 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + ++ LKE KAE+I + + D +V+ G + H +IA+ ++ KK N Sbjct: 8 LEVIIGWLKEKKAENIRIYDVQE-KCDYTDIVVVCEGSADVHNKAIANYIVEMAKKNN 64 >gi|282855687|ref|ZP_06264996.1| iojap-like protein [Pyramidobacter piscolens W5455] gi|282586487|gb|EFB91746.1| iojap-like protein [Pyramidobacter piscolens W5455] Length = 117 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +++ ++ L + KA D+ +E + + + D ++ SG S H++++ + + L Sbjct: 3 ENIYKVQEEIVNALLDKKALDVLTMEVGA-VTPLADGFIVASGNSDVHMSALVNAVTDCL 61 >gi|118469765|ref|YP_888849.1| hypothetical protein MSMEG_4580 [Mycobacterium smegmatis str. MC2 155] gi|118171052|gb|ABK71948.1| conserved domain protein [Mycobacterium smegmatis str. MC2 155] Length = 133 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + A+D+ I+ S + +I D VI S + + V +I D + Sbjct: 1 MTATDEAVQMATVAAQAAASKLADDVVVIDV-SGQLVITDCFVIASASNERQVNAIVDEV 59 Query: 70 ISYLK 74 ++ Sbjct: 60 EEKMR 64 >gi|297181692|gb|ADI17874.1| uncharacterized homolog of plant iojap protein [uncultured Chloroflexi bacterium HF0200_06I16] Length = 106 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++E E A DI ++ D VI+S S++ + ++ D++ + LK N Sbjct: 2 IVEVASEKLASDIIMLDLR-GLVSFTDYFVIMSADSSRLIQALEDDISATLKNSN 55 >gi|21221036|ref|NP_626815.1| hypothetical protein SCO2577 [Streptomyces coelicolor A3(2)] gi|256787801|ref|ZP_05526232.1| hypothetical protein SlivT_25212 [Streptomyces lividans TK24] gi|289771686|ref|ZP_06531064.1| iojap protein 155 [Streptomyces lividans TK24] gi|6714683|emb|CAB66255.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)] gi|289701885|gb|EFD69314.1| iojap protein 155 [Streptomyces lividans TK24] Length = 148 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELINAAAQAAADKLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLNKE 66 >gi|300088216|ref|YP_003758738.1| Iojap-like protein [Dehalogenimonas lykanthroporepellens BL-DC-9] gi|299527949|gb|ADJ26417.1| Iojap-related protein [Dehalogenimonas lykanthroporepellens BL-DC-9] Length = 118 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + E +A++I + S I D V +S + + ++ D +I LK Sbjct: 5 ESIDLARRIADLALEKQADNIIITDVR-GLSSITDYQVTLSADNHRLARAVFDEVIDRLK 63 Query: 75 KK 76 K+ Sbjct: 64 KE 65 >gi|315655048|ref|ZP_07907952.1| Iojap family protein [Mobiluncus curtisii ATCC 51333] gi|315490704|gb|EFU80325.1| Iojap family protein [Mobiluncus curtisii ATCC 51333] Length = 153 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + K KA ++ ++ + ++ D V+ +G S + V +I D + Sbjct: 1 MSADAKSIELAIAAGQAAKSKKATEVIALDVSERL-VLTDMFVLATGNSDRQVRAIVDAV 59 Query: 70 ISYLKK 75 + K Sbjct: 60 DEAMTK 65 >gi|148269913|ref|YP_001244373.1| iojap-like protein [Thermotoga petrophila RKU-1] gi|281412206|ref|YP_003346285.1| iojap-like protein [Thermotoga naphthophila RKU-10] gi|61657346|emb|CAI44264.1| hypothetical protein [Thermotoga naphthophila RKU-10] gi|147735457|gb|ABQ46797.1| iojap-like protein [Thermotoga petrophila RKU-1] gi|281373309|gb|ADA66871.1| iojap-like protein [Thermotoga naphthophila RKU-10] Length = 110 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 11/56 (19%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +++ + E E+ ++ D VI + S H+ ++ D LI +K+ Sbjct: 5 LKKILKKISEKGGENPVVLDMRKTPVP-TDYFVIFTANSYTHMRAMRDELIDLIKE 59 >gi|145223241|ref|YP_001133919.1| iojap-like protein [Mycobacterium gilvum PYR-GCK] gi|315443699|ref|YP_004076578.1| iojap-related protein [Mycobacterium sp. Spyr1] gi|145215727|gb|ABP45131.1| iojap-like protein [Mycobacterium gilvum PYR-GCK] gi|315262002|gb|ADT98743.1| iojap-related protein [Mycobacterium sp. Spyr1] Length = 120 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ I+ + +I D VI SG + + V +I D + +++ Sbjct: 15 EDVVVIDVSEQL-VITDCFVIASGSNDRQVNAIVDEVEEKMRR 56 >gi|282861838|ref|ZP_06270902.1| iojap-like protein [Streptomyces sp. ACTE] gi|282563654|gb|EFB69192.1| iojap-like protein [Streptomyces sp. ACTE] Length = 142 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELINAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L+K+ Sbjct: 60 EERLQKE 66 >gi|309811041|ref|ZP_07704839.1| iojap-like protein [Dermacoccus sp. Ellin185] gi|308435005|gb|EFP58839.1| iojap-like protein [Dermacoccus sp. Ellin185] Length = 124 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + A I I+ + I D VI S S + V +I D + Sbjct: 1 MSATDRSLELTRAAAQAAADKLATSITAIDVSDQL-AITDTFVIASAESERQVNAIVDAV 59 Query: 70 ISYL 73 L Sbjct: 60 EEAL 63 >gi|78185987|ref|YP_374030.1| Iojap-related protein [Chlorobium luteolum DSM 273] gi|78165889|gb|ABB22987.1| Iojap-related protein [Chlorobium luteolum DSM 273] Length = 131 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + E E K E++ ++ + + + D VI + S + + AD+++ L+ Sbjct: 22 ELLARRAAELTLEKKCEEVKILDLRA-LTTMTDFFVIATADSDRKAKAAADHVVDELR 78 >gi|222099515|ref|YP_002534083.1| Iojap-like protein [Thermotoga neapolitana DSM 4359] gi|221571905|gb|ACM22717.1| Iojap-like protein [Thermotoga neapolitana DSM 4359] Length = 110 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++E + E E+ ++ + VIV+ S H+ ++ D L+ +K+ Sbjct: 3 EILRRLIEKISEKGGENPVVLDMRKTPVP-TEYFVIVTANSYTHMKALRDELVDLIKE 59 >gi|328882406|emb|CCA55645.1| Iojap protein [Streptomyces venezuelae ATCC 10712] Length = 177 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/70 (21%), Positives = 27/70 (38%), Gaps = 1/70 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 E + D + + + A DI + + + S I D ++ S + + V SI Sbjct: 19 ESLLVTATDRSIELVNAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSI 77 Query: 66 ADNLISYLKK 75 D + L K Sbjct: 78 VDEIEERLNK 87 >gi|315657088|ref|ZP_07909972.1| Iojap family protein [Mobiluncus curtisii subsp. holmesii ATCC 35242] gi|315492191|gb|EFU81798.1| Iojap family protein [Mobiluncus curtisii subsp. holmesii ATCC 35242] Length = 153 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + K KA ++ ++ + ++ D V+ +G S + V +I D + Sbjct: 1 MSADVKSIELAIAAGQAAKSKKATEVIALDVSERL-VLTDMFVLATGNSDRQVRAIVDAV 59 Query: 70 ISYLKK 75 + K Sbjct: 60 DEAMTK 65 >gi|71892091|ref|YP_277821.1| hypothetical protein BPEN_318 [Candidatus Blochmannia pennsylvanicus str. BPEN] gi|71796197|gb|AAZ40948.1| conserved hypothetical protein [Candidatus Blochmannia pennsylvanicus str. BPEN] Length = 105 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D ++ + ++ +DI + S ++ I D M+I +G S +HV SI+ ++ Sbjct: 2 QSDVLKEFIVNVIYNIQGQDIACFDI-SGKTNITDIMIICTGMSRRHVISISQEILRK 58 >gi|163841966|ref|YP_001626371.1| iojap superfamily protein [Renibacterium salmoninarum ATCC 33209] gi|162955442|gb|ABY24957.1| iojap protein family [Renibacterium salmoninarum ATCC 33209] Length = 124 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 E A DI ++ + I D +I S S + V +I D + + K+N Sbjct: 24 EKLALDIVALDVSDQL-AITDIFLIASAPSERQVNAIVDGIEEEMLKQN 71 >gi|269215925|ref|ZP_06159779.1| iojap-like protein [Slackia exigua ATCC 700122] gi|269130184|gb|EEZ61262.1| iojap-like protein [Slackia exigua ATCC 700122] Length = 152 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 28/66 (42%), Gaps = 3/66 (4%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL- 69 + LD + KA DI + L + D VIV+ ++ + ++++ + + Sbjct: 18 KGLSSLDKAL-IAARAADGKKATDIIIQDVRDLV-DVTDYFVIVTAQNNRQISAVLNAIE 75 Query: 70 ISYLKK 75 LK+ Sbjct: 76 EEELKQ 81 >gi|313681414|ref|YP_004059152.1| iojap-like protein [Sulfuricurvum kujiense DSM 16994] gi|313154274|gb|ADR32952.1| iojap-like protein [Sulfuricurvum kujiense DSM 16994] Length = 109 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ I + L + KAE I + D +VI S +H ++ D+L LK Sbjct: 1 MNPRIEKISAILDQNKAEAIEVFDL-QGGDYFADYVVIASSLGERHTLALLDHLKKGLKP 59 Query: 76 K 76 + Sbjct: 60 E 60 >gi|290960407|ref|YP_003491589.1| hypothetical protein SCAB_60301 [Streptomyces scabiei 87.22] gi|260649933|emb|CBG73049.1| conserved hypothetical protein [Streptomyces scabiei 87.22] Length = 148 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I T + + A D+ + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSLELITTAAQAAADKLAHDVIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLNKE 66 >gi|320160276|ref|YP_004173500.1| hypothetical protein ANT_08660 [Anaerolinea thermophila UNI-1] gi|319994129|dbj|BAJ62900.1| hypothetical protein ANT_08660 [Anaerolinea thermophila UNI-1] Length = 105 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + L+E K E I ++ + + D + +G S + + S+ +++ K Sbjct: 2 VHALEEKKGEQIVLMDIHEIA-VFADYFIFCNGTSNRMIESLVESVSEAAHK 52 >gi|325282381|ref|YP_004254922.1| iojap-like protein [Deinococcus proteolyticus MRP] gi|324314190|gb|ADY25305.1| iojap-like protein [Deinococcus proteolyticus MRP] Length = 122 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 9/65 (13%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 Q L ++E +E +AE++ ++ T + + + D +I + + + ++ ++ Sbjct: 4 QKTQDLRQL-QALVEAARERRAENVRVLDLTDVSTSL-DYFIICTATAGLQLNAVQQSIR 61 Query: 71 SYLKK 75 ++ Sbjct: 62 ERAEE 66 >gi|121638301|ref|YP_978525.1| hypothetical protein BCG_2436c [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224990795|ref|YP_002645482.1| hypothetical protein JTY_2430 [Mycobacterium bovis BCG str. Tokyo 172] gi|121493949|emb|CAL72424.1| Conserved hypothetical protein [Mycobacterium bovis BCG str. Pasteur 1173P2] gi|224773908|dbj|BAH26714.1| hypothetical protein JTY_2430 [Mycobacterium bovis BCG str. Tokyo 172] Length = 127 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI SG + + V +I D + +++ Sbjct: 24 DDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQ 65 >gi|298491360|ref|YP_003721537.1| iojap-like protein ['Nostoc azollae' 0708] gi|298233278|gb|ADI64414.1| iojap-like protein ['Nostoc azollae' 0708] Length = 152 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 15/74 (20%), Positives = 31/74 (41%), Gaps = 2/74 (2%) Query: 1 MLANTEKQALQTADHLD-SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRST 59 + T K + + + T+ E E KA +I + + + D V+++G S Sbjct: 16 LTITTVKSPMAGTEDVSGKLAITIAEAGSERKAGEILLLRVADI-CYLSDYFVMMTGYSR 74 Query: 60 KHVASIADNLISYL 73 V +IA + + + Sbjct: 75 IQVRAIASAIEAKV 88 >gi|161507850|ref|YP_001577814.1| hypothetical protein lhv_1591 [Lactobacillus helveticus DPC 4571] gi|260103143|ref|ZP_05753380.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075] gi|160348839|gb|ABX27513.1| hypothetical protein lhv_1591 [Lactobacillus helveticus DPC 4571] gi|260083053|gb|EEW67173.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075] gi|323466115|gb|ADX69802.1| Iojap-like protein [Lactobacillus helveticus H10] gi|328464792|gb|EGF36107.1| hypothetical protein AAULH_09198 [Lactobacillus helveticus MTCC 5463] Length = 115 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 9/62 (14%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ED + S++ D VI S S + + +I ++++ Sbjct: 2 TSKEILDFTTKAISDRHGEDTEAYDMR-GISILADYYVITSAGSNRQLHAIVNSIVEAAH 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|109067162|ref|XP_001098609.1| PREDICTED: uncharacterized protein C7orf30 [Macaca mulatta] Length = 235 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 94 IDIMVSLLRQENARDICVIQVPPEMRY-TDYFVIGSGTSTRHLHAMAFYIVKMYK 147 >gi|73976494|ref|XP_853850.1| PREDICTED: similar to CG9166-PA [Canis familiaris] Length = 258 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 119 IDMLVSLLRQENARDICVIKIPPELKY-TDYFVIGSGTSTRHLHAMAYYIVKMYK 172 >gi|326779409|ref|ZP_08238674.1| iojap-like protein [Streptomyces cf. griseus XylebKG-1] gi|326659742|gb|EGE44588.1| iojap-like protein [Streptomyces cf. griseus XylebKG-1] Length = 153 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 E + D I + + A DI + + + S I D ++ S + + V SI Sbjct: 7 ESLHVTATDRSIELINAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSI 65 Query: 66 ADNLISYLKKK 76 D + L+K+ Sbjct: 66 VDEIEERLQKE 76 >gi|50732684|ref|XP_418715.1| PREDICTED: hypothetical protein [Gallus gallus] Length = 190 Score = 53.2 bits (127), Expect = 1e-05, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I V+ L++ A+DIC I+ C ++VSG ST+H+ ++A ++ K + Sbjct: 60 IDFVVNLLRQENAKDICVIQVPPEIKY-CHYFIVVSGSSTRHLHAMAQYMLKMYKHQ 115 >gi|42525169|ref|NP_970549.1| nicotinate-nucleotide adenylyltransferase [Bdellovibrio bacteriovorus HD100] gi|39577380|emb|CAE81203.1| probable nicotinate-nucleotide adenylyltransferase [Bdellovibrio bacteriovorus HD100] Length = 342 Score = 52.8 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L K ++ + T S + +I SG ST+H A++A+N++ +K Sbjct: 221 DYTKFTEFCANVLFAKKGINVRGFDLTQ-MSAPSEYTLIASGTSTRHAAAMAENIVMAVK 279 Query: 75 KK 76 ++ Sbjct: 280 EE 281 >gi|89256428|ref|YP_513790.1| hypothetical protein FTL_1100 [Francisella tularensis subsp. holarctica LVS] gi|115314865|ref|YP_763588.1| hypothetical protein FTH_1074 [Francisella tularensis subsp. holarctica OSU18] gi|134302308|ref|YP_001122277.1| iojap-like protein [Francisella tularensis subsp. tularensis WY96-3418] gi|167010693|ref|ZP_02275624.1| iojap-like protein [Francisella tularensis subsp. holarctica FSC200] gi|169656615|ref|YP_001428592.2| putative iojap-like protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|224457286|ref|ZP_03665759.1| putative iojap-like protein [Francisella tularensis subsp. tularensis MA00-2987] gi|254367766|ref|ZP_04983787.1| hypothetical protein FTHG_01042 [Francisella tularensis subsp. holarctica 257] gi|254369397|ref|ZP_04985409.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FSC022] gi|254370668|ref|ZP_04986673.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|254372733|ref|ZP_04988222.1| conserved hypothetical protein [Francisella tularensis subsp. novicida GA99-3549] gi|254874990|ref|ZP_05247700.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis MA00-2987] gi|290953867|ref|ZP_06558488.1| iojap homolog [Francisella tularensis subsp. holarctica URFT1] gi|295312770|ref|ZP_06803507.1| iojap homolog [Francisella tularensis subsp. holarctica URFT1] gi|89144259|emb|CAJ79539.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica LVS] gi|115129764|gb|ABI82951.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica OSU18] gi|134050085|gb|ABO47156.1| iojap-like protein [Francisella tularensis subsp. tularensis WY96-3418] gi|134253577|gb|EBA52671.1| hypothetical protein FTHG_01042 [Francisella tularensis subsp. holarctica 257] gi|151568911|gb|EDN34565.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC033] gi|151570460|gb|EDN36114.1| conserved hypothetical protein [Francisella novicida GA99-3549] gi|157122347|gb|EDO66487.1| conserved hypothetical protein [Francisella tularensis subsp. holarctica FSC022] gi|164551683|gb|ABU61636.2| putative iojap-like protein [Francisella tularensis subsp. holarctica FTNF002-00] gi|254840989|gb|EET19425.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis MA00-2987] gi|282159397|gb|ADA78788.1| putative iojap-like protein [Francisella tularensis subsp. tularensis NE061598] Length = 135 Score = 52.8 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K + D + V+E L +LK +I I+ + + D +VI + ST H ++A Sbjct: 18 KTLIFNFMTTDQRLEIVLEALDDLKGINIQTIDV-EHLTDMMDKIVISTASSTTHAKALA 76 Query: 67 DNLISYLK 74 NL LK Sbjct: 77 KNLEQELK 84 >gi|311743029|ref|ZP_07716837.1| iojap-like protein [Aeromicrobium marinum DSM 15272] gi|311313709|gb|EFQ83618.1| iojap-like protein [Aeromicrobium marinum DSM 15272] Length = 117 Score = 52.8 bits (126), Expect = 1e-05, Method: Composition-based stats. Identities = 9/64 (14%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +D + A I + + I D V+ + S ++ D + Sbjct: 1 MTASDRAVELTRAAAAAADDKSATGIVAFDVSEQI-YITDVFVLCTTTSPTQARAVQDAV 59 Query: 70 ISYL 73 L Sbjct: 60 EERL 63 >gi|297584667|ref|YP_003700447.1| iojap-like protein [Bacillus selenitireducens MLS10] gi|297143124|gb|ADH99881.1| iojap-like protein [Bacillus selenitireducens MLS10] Length = 120 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 9/62 (14%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ + + ++ SL+ D V+ G S V +IA + + + Sbjct: 2 DTKELLTLAVKAIDDKNGHQTIAMDM-QGISLVADYFVVTHGNSETQVEAIAREVKNAAQ 60 Query: 75 KK 76 ++ Sbjct: 61 EQ 62 >gi|295394989|ref|ZP_06805201.1| Iojap superfamily protein [Brevibacterium mcbrellneri ATCC 49030] gi|294972148|gb|EFG48011.1| Iojap superfamily protein [Brevibacterium mcbrellneri ATCC 49030] Length = 136 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + + + A D+ ++ + +I D VI S + + V +I D + Sbjct: 1 MPATDETIAYARSAAKGALQKFATDVVIVDVSEQL-VITDAFVIASASNARQVDAIVDGV 59 Query: 70 ISYLKKKN 77 L K++ Sbjct: 60 EETLLKEH 67 >gi|323697712|ref|ZP_08109624.1| iojap-like protein [Desulfovibrio sp. ND132] gi|323457644|gb|EGB13509.1| iojap-like protein [Desulfovibrio desulfuricans ND132] Length = 124 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 17/72 (23%), Positives = 29/72 (40%), Gaps = 1/72 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 K+ V L + + E I I S S + D +V+VS R KH ++ Sbjct: 3 NKEKKFADMTSLEKARNVAGWLDDKQGERITVINV-SGLSSVTDMIVVVSARGVKHAQAL 61 Query: 66 ADNLISYLKKKN 77 A +++ + N Sbjct: 62 ATHILDKAAENN 73 >gi|15609557|ref|NP_216936.1| hypothetical protein Rv2420c [Mycobacterium tuberculosis H37Rv] gi|15841939|ref|NP_336976.1| iojap-related protein [Mycobacterium tuberculosis CDC1551] gi|31793599|ref|NP_856092.1| hypothetical protein Mb2443c [Mycobacterium bovis AF2122/97] gi|148662254|ref|YP_001283777.1| iojap-related protein [Mycobacterium tuberculosis H37Ra] gi|148823623|ref|YP_001288377.1| hypothetical protein TBFG_12448 [Mycobacterium tuberculosis F11] gi|167969737|ref|ZP_02552014.1| hypothetical protein MtubH3_17620 [Mycobacterium tuberculosis H37Ra] gi|215404355|ref|ZP_03416536.1| hypothetical protein Mtub0_11865 [Mycobacterium tuberculosis 02_1987] gi|215412173|ref|ZP_03420937.1| hypothetical protein Mtub9_12602 [Mycobacterium tuberculosis 94_M4241A] gi|215427803|ref|ZP_03425722.1| hypothetical protein MtubT9_16017 [Mycobacterium tuberculosis T92] gi|215431365|ref|ZP_03429284.1| hypothetical protein MtubE_11923 [Mycobacterium tuberculosis EAS054] gi|218754149|ref|ZP_03532945.1| hypothetical protein MtubG1_12284 [Mycobacterium tuberculosis GM 1503] gi|219558416|ref|ZP_03537492.1| hypothetical protein MtubT1_14372 [Mycobacterium tuberculosis T17] gi|253798502|ref|YP_003031503.1| hypothetical protein TBMG_01554 [Mycobacterium tuberculosis KZN 1435] gi|254232558|ref|ZP_04925885.1| conserved hypothetical protein [Mycobacterium tuberculosis C] gi|254365195|ref|ZP_04981241.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] gi|254551468|ref|ZP_05141915.1| hypothetical protein Mtube_13579 [Mycobacterium tuberculosis '98-R604 INH-RIF-EM'] gi|260201546|ref|ZP_05769037.1| hypothetical protein MtubT4_15872 [Mycobacterium tuberculosis T46] gi|260205724|ref|ZP_05773215.1| hypothetical protein MtubK8_15634 [Mycobacterium tuberculosis K85] gi|289443943|ref|ZP_06433687.1| iojap protein 155 [Mycobacterium tuberculosis T46] gi|289553790|ref|ZP_06443000.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605] gi|289570569|ref|ZP_06450796.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289575113|ref|ZP_06455340.1| iojap protein 155 [Mycobacterium tuberculosis K85] gi|289746201|ref|ZP_06505579.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] gi|289751025|ref|ZP_06510403.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289754528|ref|ZP_06513906.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] gi|289762587|ref|ZP_06521965.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503] gi|294994471|ref|ZP_06800162.1| iojap-related protein [Mycobacterium tuberculosis 210] gi|297635025|ref|ZP_06952805.1| iojap-related protein [Mycobacterium tuberculosis KZN 4207] gi|297732017|ref|ZP_06961135.1| iojap-related protein [Mycobacterium tuberculosis KZN R506] gi|298525902|ref|ZP_07013311.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|306780462|ref|ZP_07418799.1| hypothetical protein TMBG_00963 [Mycobacterium tuberculosis SUMu002] gi|306785212|ref|ZP_07423534.1| hypothetical protein TMCG_00519 [Mycobacterium tuberculosis SUMu003] gi|306789573|ref|ZP_07427895.1| hypothetical protein TMDG_00899 [Mycobacterium tuberculosis SUMu004] gi|306793899|ref|ZP_07432201.1| hypothetical protein TMEG_02786 [Mycobacterium tuberculosis SUMu005] gi|306798295|ref|ZP_07436597.1| hypothetical protein TMFG_01384 [Mycobacterium tuberculosis SUMu006] gi|306804170|ref|ZP_07440838.1| hypothetical protein TMHG_01614 [Mycobacterium tuberculosis SUMu008] gi|306808740|ref|ZP_07445408.1| hypothetical protein TMGG_00982 [Mycobacterium tuberculosis SUMu007] gi|306968571|ref|ZP_07481232.1| hypothetical protein TMIG_01098 [Mycobacterium tuberculosis SUMu009] gi|307085103|ref|ZP_07494216.1| hypothetical protein TMLG_02172 [Mycobacterium tuberculosis SUMu012] gi|313659352|ref|ZP_07816232.1| hypothetical protein MtubKV_13069 [Mycobacterium tuberculosis KZN V2475] gi|3261660|emb|CAB03752.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium tuberculosis H37Rv] gi|13882210|gb|AAK46790.1| IojAP-related protein [Mycobacterium tuberculosis CDC1551] gi|31619192|emb|CAD97304.1| CONSERVED HYPOTHETICAL PROTEIN [Mycobacterium bovis AF2122/97] gi|124601617|gb|EAY60627.1| conserved hypothetical protein [Mycobacterium tuberculosis C] gi|134150709|gb|EBA42754.1| conserved hypothetical protein [Mycobacterium tuberculosis str. Haarlem] gi|148506406|gb|ABQ74215.1| IojAP-related protein [Mycobacterium tuberculosis H37Ra] gi|148722150|gb|ABR06775.1| conserved hypothetical protein [Mycobacterium tuberculosis F11] gi|253320005|gb|ACT24608.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 1435] gi|289416862|gb|EFD14102.1| iojap protein 155 [Mycobacterium tuberculosis T46] gi|289438422|gb|EFD20915.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 605] gi|289539544|gb|EFD44122.1| iojap protein 155 [Mycobacterium tuberculosis K85] gi|289544323|gb|EFD47971.1| conserved hypothetical protein [Mycobacterium tuberculosis T17] gi|289686729|gb|EFD54217.1| conserved hypothetical protein [Mycobacterium tuberculosis 02_1987] gi|289691612|gb|EFD59041.1| conserved hypothetical protein [Mycobacterium tuberculosis T92] gi|289695115|gb|EFD62544.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054] gi|289710093|gb|EFD74109.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503] gi|298495696|gb|EFI30990.1| conserved hypothetical protein [Mycobacterium tuberculosis 94_M4241A] gi|308326697|gb|EFP15548.1| hypothetical protein TMBG_00963 [Mycobacterium tuberculosis SUMu002] gi|308330125|gb|EFP18976.1| hypothetical protein TMCG_00519 [Mycobacterium tuberculosis SUMu003] gi|308333965|gb|EFP22816.1| hypothetical protein TMDG_00899 [Mycobacterium tuberculosis SUMu004] gi|308337751|gb|EFP26602.1| hypothetical protein TMEG_02786 [Mycobacterium tuberculosis SUMu005] gi|308341439|gb|EFP30290.1| hypothetical protein TMFG_01384 [Mycobacterium tuberculosis SUMu006] gi|308344935|gb|EFP33786.1| hypothetical protein TMGG_00982 [Mycobacterium tuberculosis SUMu007] gi|308349246|gb|EFP38097.1| hypothetical protein TMHG_01614 [Mycobacterium tuberculosis SUMu008] gi|308353865|gb|EFP42716.1| hypothetical protein TMIG_01098 [Mycobacterium tuberculosis SUMu009] gi|308365366|gb|EFP54217.1| hypothetical protein TMLG_02172 [Mycobacterium tuberculosis SUMu012] gi|323719017|gb|EGB28166.1| hypothetical protein TMMG_01712 [Mycobacterium tuberculosis CDC1551A] gi|326904037|gb|EGE50970.1| hypothetical protein TBPG_01926 [Mycobacterium tuberculosis W-148] gi|328458270|gb|AEB03693.1| conserved hypothetical protein [Mycobacterium tuberculosis KZN 4207] Length = 126 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI SG + + V +I D + +++ Sbjct: 24 DDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQ 65 >gi|258405264|ref|YP_003198006.1| iojap-like protein [Desulfohalobium retbaense DSM 5692] gi|257797491|gb|ACV68428.1| iojap-like protein [Desulfohalobium retbaense DSM 5692] Length = 130 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 36/71 (50%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 +KQ +++ L+E +A+D+ ++ + + + +V+VS S +H ++ Sbjct: 4 KKQTDSYKGDYLRKTRDLLQWLEEKQAKDMVALDVSK-VCNVTEALVVVSAGSARHAQAL 62 Query: 66 ADNLISYLKKK 76 AD L++ L + Sbjct: 63 ADGLLAKLAEH 73 >gi|297194418|ref|ZP_06911816.1| iojap superfamily protein [Streptomyces pristinaespiralis ATCC 25486] gi|297152263|gb|EDY62680.2| iojap superfamily protein [Streptomyces pristinaespiralis ATCC 25486] Length = 163 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + + A DI + + + S I D ++ S + + V SI D + Sbjct: 20 VTATDRSIELVNAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 78 Query: 70 ISYLKKK 76 L K+ Sbjct: 79 EERLNKQ 85 >gi|328676855|gb|AEB27725.1| Iojap-related protein [Francisella cf. novicida Fx1] Length = 135 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K + D + V+E L +LK +I I+ + + D +VI + ST H ++A Sbjct: 18 KTLIFNFMTTDQRLEIVLEALDDLKGINIQSIDV-EHLTDMMDKIVISTASSTTHAKALA 76 Query: 67 DNLISYLK 74 NL LK Sbjct: 77 KNLEQELK 84 >gi|239941084|ref|ZP_04693021.1| hypothetical protein SrosN15_08821 [Streptomyces roseosporus NRRL 15998] Length = 153 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 E + D I + + A DI + + + S I D ++ S + + V SI Sbjct: 7 ESLHVTATDRSIELINAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSI 65 Query: 66 ADNLISYLKKK 76 D + L+K+ Sbjct: 66 VDEIEERLQKE 76 >gi|118618959|ref|YP_907291.1| bifunctional nicotinate-nucleotide adenylyltransferase NadD/hypothetical protein [Mycobacterium ulcerans Agy99] gi|118571069|gb|ABL05820.1| nicotinate-nucleotide adenylyltransferase NadD fused with d/s conserved hypothetical protein [Mycobacterium ulcerans Agy99] Length = 344 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI S + + V +I D + +++ Sbjct: 239 DDVLVIDV-SGQLVITDCFVIASASNERQVNAIVDEVEEKMRR 280 >gi|189345658|ref|YP_001942187.1| iojap-like protein [Chlorobium limicola DSM 245] gi|189339805|gb|ACD89208.1| iojap-like protein [Chlorobium limicola DSM 245] Length = 131 Score = 52.8 bits (126), Expect = 2e-05, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 E K E + ++ + I D VI++ S + + A+++I LK Sbjct: 34 EKKCEQVKILDL-KGLTSITDYFVIITADSERKAKAAAEHIIDELK 78 >gi|208779162|ref|ZP_03246508.1| putative iojap-like protein [Francisella novicida FTG] gi|254374190|ref|ZP_04989672.1| conserved hypothetical protein [Francisella novicida GA99-3548] gi|151571910|gb|EDN37564.1| conserved hypothetical protein [Francisella novicida GA99-3548] gi|208744962|gb|EDZ91260.1| putative iojap-like protein [Francisella novicida FTG] Length = 135 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K + D + V+E L +LK +I I+ + + D +VI + ST H ++A Sbjct: 18 KTLIFNFMTTDQRLEIVLEALDDLKGINIQSIDV-EHLTDMMDKIVISTASSTTHAKALA 76 Query: 67 DNLISYLK 74 NL LK Sbjct: 77 KNLEQELK 84 >gi|306776688|ref|ZP_07415025.1| hypothetical protein TMAG_02979 [Mycobacterium tuberculosis SUMu001] gi|306972800|ref|ZP_07485461.1| hypothetical protein TMJG_00688 [Mycobacterium tuberculosis SUMu010] gi|307080505|ref|ZP_07489675.1| hypothetical protein TMKG_00682 [Mycobacterium tuberculosis SUMu011] gi|308214936|gb|EFO74335.1| hypothetical protein TMAG_02979 [Mycobacterium tuberculosis SUMu001] gi|308357811|gb|EFP46662.1| hypothetical protein TMJG_00688 [Mycobacterium tuberculosis SUMu010] gi|308361756|gb|EFP50607.1| hypothetical protein TMKG_00682 [Mycobacterium tuberculosis SUMu011] Length = 126 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI SG + + V +I D + +++ Sbjct: 24 DDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQ 65 >gi|297680866|ref|XP_002818193.1| PREDICTED: uncharacterized protein C7orf30-like [Pongo abelii] Length = 234 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 94 IDMMVSLLRQENARDICVIQVPPEMRY-TDYFVIGSGTSTRHLHAMAFYIVKMYK 147 >gi|224101567|ref|XP_002312333.1| predicted protein [Populus trichocarpa] gi|222852153|gb|EEE89700.1| predicted protein [Populus trichocarpa] Length = 186 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + + L +++A+D+ I + D MVI +GRST HV +IA LI K+K Sbjct: 49 LNEIEKVLTDVRADDVKVIP-AKKHAEWADYMVIATGRSTWHVKNIAQALIYKAKQK 104 >gi|238854463|ref|ZP_04644802.1| iojap family protein [Lactobacillus jensenii 269-3] gi|260665489|ref|ZP_05866336.1| iojap family protein [Lactobacillus jensenii SJ-7A-US] gi|282934533|ref|ZP_06339785.1| iojap family protein [Lactobacillus jensenii 208-1] gi|313471827|ref|ZP_07812319.1| iojap-like protein [Lactobacillus jensenii 1153] gi|238832890|gb|EEQ25188.1| iojap family protein [Lactobacillus jensenii 269-3] gi|239530129|gb|EEQ69130.1| iojap-like protein [Lactobacillus jensenii 1153] gi|260560757|gb|EEX26734.1| iojap family protein [Lactobacillus jensenii SJ-7A-US] gi|281301371|gb|EFA93663.1| iojap family protein [Lactobacillus jensenii 208-1] Length = 115 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 5/61 (8%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + ++ + + E + S++ D ++ S S + + ++ ++++ ++ Sbjct: 2 NSEKLLDITLDAISDRHGEATEAYDMR-GISILADFYIVTSASSNRQLHALVNSILDKVR 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|255084980|ref|XP_002504921.1| predicted protein [Micromonas sp. RCC299] gi|226520190|gb|ACO66179.1| predicted protein [Micromonas sp. RCC299] Length = 727 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 10/62 (16%), Positives = 28/62 (45%), Gaps = 5/62 (8%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + +++ K D+ I + D+ V+ + +S +H+ +A ++ +K Sbjct: 524 DPEELVRILLKA----KGADVVVIPVKE-KCNWTDHFVVGTAKSPRHIRMLAGAVLHAVK 578 Query: 75 KK 76 K+ Sbjct: 579 KR 580 >gi|296170511|ref|ZP_06852097.1| Iojap family protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295894823|gb|EFG74546.1| Iojap family protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length = 128 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 26/66 (39%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + A+D+ I+ S + +I D VI S + + V +I D + Sbjct: 1 MTATQEAIDMASVAAGAAASKLADDVVVIDV-SGQLVITDCFVIASASNERQVNAIVDEV 59 Query: 70 ISYLKK 75 +++ Sbjct: 60 EEKMRR 65 >gi|255547874|ref|XP_002514994.1| conserved hypothetical protein [Ricinus communis] gi|223546045|gb|EEF47548.1| conserved hypothetical protein [Ricinus communis] Length = 200 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + V + L ++KA+D+ I + D MVI +GRST HV +IA LI Sbjct: 55 LNEVEKVLTDVKADDVKVIPVQK-QCDWVDYMVIATGRSTWHVKNIAQALIYKA 107 >gi|187931904|ref|YP_001891889.1| hypothetical protein FTM_1244 [Francisella tularensis subsp. mediasiatica FSC147] gi|187712813|gb|ACD31110.1| conserved hypothetical protein [Francisella tularensis subsp. mediasiatica FSC147] Length = 135 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 K + D + V+E L +LK +I I+ + + D +VI + ST H ++A Sbjct: 18 KTLIFNFMTTDQRLDIVLEALDDLKGINIQTIDV-EHLTDMMDKIVISTASSTTHTKALA 76 Query: 67 DNLISYLK 74 NL LK Sbjct: 77 KNLEQELK 84 >gi|157819391|ref|NP_001100063.1| hypothetical protein LOC297082 [Rattus norvegicus] gi|149033414|gb|EDL88215.1| similar to chromosome 7 open reading frame 30 (predicted) [Rattus norvegicus] Length = 229 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ LK+ A DIC I+ D VI SG ST+H+ ++ ++ K Sbjct: 89 IDMLVSLLKQENARDICVIKVPPEMRY-TDYFVIGSGTSTRHLHAMVHYIVKTYK 142 >gi|222053714|ref|YP_002536076.1| iojap-like protein [Geobacter sp. FRC-32] gi|221563003|gb|ACM18975.1| iojap-like protein [Geobacter sp. FRC-32] Length = 128 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + + + KA D+ E + S I D +V+ +GRS K +IAD++ Sbjct: 4 KNVLNSRERAIQCAALALDKKALDVRIYEISRH-SSIADYLVLANGRSDKQTQAIADSVR 62 Query: 71 SYLKK 75 LKK Sbjct: 63 QGLKK 67 >gi|319937332|ref|ZP_08011739.1| hypothetical protein HMPREF9488_02574 [Coprobacillus sp. 29_1] gi|319807698|gb|EFW04291.1| hypothetical protein HMPREF9488_02574 [Coprobacillus sp. 29_1] Length = 87 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + V++ + + A I I+ S I D V+ + + + + +I N+ +K N Sbjct: 4 LECVVKAMDDKLATHIVAIDMQE-ASPIFDTFVLCTASNERLMQAIMQNIKDECEKNN 60 >gi|218885544|ref|YP_002434865.1| iojap-like protein [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218756498|gb|ACL07397.1| iojap-like protein [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 195 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/70 (17%), Positives = 34/70 (48%), Gaps = 2/70 (2%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 ++ + + +AT + L+E K D+ ++ + ++++IV+ S +H +A Sbjct: 5 EKKFKDIPTAEK-VATFVGWLEEKKGRDVLALDLA-GMNAFAESIIIVTAGSVRHAQGLA 62 Query: 67 DNLISYLKKK 76 D+++ + Sbjct: 63 DHVLGMCDDE 72 >gi|215446666|ref|ZP_03433418.1| hypothetical protein MtubT_12249 [Mycobacterium tuberculosis T85] Length = 109 Score = 52.4 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI SG + + V +I D + +++ Sbjct: 24 DDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQ 65 >gi|86739940|ref|YP_480340.1| Iojap-related protein [Frankia sp. CcI3] gi|86566802|gb|ABD10611.1| Iojap-related protein [Frankia sp. CcI3] Length = 196 Score = 52.0 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 10/74 (13%), Positives = 27/74 (36%), Gaps = 1/74 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + E ++ + + + D+ ++ + I D V+ S + + Sbjct: 36 VTTLENPSVTASPRAVELALAAAQAAADKLGHDLLILDVSDRL-AITDCFVLASAGNERQ 94 Query: 62 VASIADNLISYLKK 75 V I D + +L++ Sbjct: 95 VKGIVDEIEEHLRR 108 >gi|256850840|ref|ZP_05556229.1| iojap family protein [Lactobacillus jensenii 27-2-CHN] gi|260661051|ref|ZP_05861965.1| iojap family protein [Lactobacillus jensenii 115-3-CHN] gi|282934489|ref|ZP_06339744.1| iojap family protein [Lactobacillus jensenii 208-1] gi|297205714|ref|ZP_06923109.1| iojap-like protein [Lactobacillus jensenii JV-V16] gi|256615902|gb|EEU21090.1| iojap family protein [Lactobacillus jensenii 27-2-CHN] gi|260547988|gb|EEX23964.1| iojap family protein [Lactobacillus jensenii 115-3-CHN] gi|281301436|gb|EFA93725.1| iojap family protein [Lactobacillus jensenii 208-1] gi|297148840|gb|EFH29138.1| iojap-like protein [Lactobacillus jensenii JV-V16] Length = 115 Score = 52.0 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 5/61 (8%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + ++ + + E + S++ D ++ S S + + ++ ++++ ++ Sbjct: 2 NSEKLLDITLDAISDRHGEATEAYDMR-GISILADFYIVTSASSNRQLHALVNSILDKVR 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|332975673|gb|EGK12559.1| Iojap family protein [Desmospora sp. 8437] Length = 113 Score = 52.0 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I ++ S+I D VI G S V +IA+++ +++ Sbjct: 20 QHISILDIR-GLSVIADYFVICHGNSQTQVQAIAESIKKKMEQ 61 >gi|225166055|ref|ZP_03727797.1| Iojap protein-like protein [Opitutaceae bacterium TAV2] gi|224799703|gb|EEG18190.1| Iojap protein-like protein [Opitutaceae bacterium TAV2] Length = 193 Score = 52.0 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 5/64 (7%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI---ADNLI 70 D+ + ++ L + KA+++ + T S I D +V+ +G S H+ ++ + ++ Sbjct: 12 DNTLELVRKIVVALSDKKADELAILHVTQ--SDITDYLVLATGNSEPHLRALRIETERIL 69 Query: 71 SYLK 74 +K Sbjct: 70 DDVK 73 >gi|260187427|ref|ZP_05764901.1| hypothetical protein MtubCP_15541 [Mycobacterium tuberculosis CPHL_A] gi|289448062|ref|ZP_06437806.1| iojap protein 155 [Mycobacterium tuberculosis CPHL_A] gi|289421020|gb|EFD18221.1| iojap protein 155 [Mycobacterium tuberculosis CPHL_A] Length = 126 Score = 52.0 bits (124), Expect = 2e-05, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI SG + + V +I D + +++ Sbjct: 24 DDVVVIDV-SGQLVITDCFVIASGSNERQVNAIVDEVEEKMRQ 65 >gi|72382064|ref|YP_291419.1| Iojap-related protein [Prochlorococcus marinus str. NATL2A] gi|72001914|gb|AAZ57716.1| Iojap-related protein [Prochlorococcus marinus str. NATL2A] Length = 124 Score = 52.0 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + KA DI ++ S I D ++I G S V +I +N+ ++ Sbjct: 2 DSIRLVELAAVACDDRKAGDIKLLKV-DKVSSIADWILITEGLSDVQVRAIVNNVEKTIR 60 Query: 75 KK 76 ++ Sbjct: 61 EE 62 >gi|149706033|ref|XP_001497879.1| PREDICTED: similar to Uncharacterized protein C7orf30 homolog [Equus caballus] Length = 178 Score = 52.0 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 38 IDMLVSLLRQENARDICVIKVPPEMKY-TDYFVIGSGTSTRHLHAMAYYIVKMYK 91 >gi|242310517|ref|ZP_04809672.1| gerC2 protein [Helicobacter pullorum MIT 98-5489] gi|239522915|gb|EEQ62781.1| gerC2 protein [Helicobacter pullorum MIT 98-5489] Length = 116 Score = 52.0 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ I + + L++ K E+I + D ++I + KH ++ D L Sbjct: 2 QNNRQEIIHFIQQLLEDKKGENIEIFDLKDT-DYFVDYVMIATAFVDKHALALLDTLKKE 60 Query: 73 LKKK 76 LK+K Sbjct: 61 LKQK 64 >gi|262047384|ref|ZP_06020341.1| iojap protein [Lactobacillus crispatus MV-3A-US] gi|260572358|gb|EEX28921.1| iojap protein [Lactobacillus crispatus MV-3A-US] Length = 115 Score = 52.0 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 10/63 (15%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + + ED + S++ D VI S S + + I ++++ Sbjct: 2 TSQEILDFTTQAISDRHGEDTEAYDMR-GISILADYYVITSAGSNRQLHVIVNSIVDAAH 60 Query: 75 KKN 77 + N Sbjct: 61 ENN 63 >gi|332242555|ref|XP_003270450.1| PREDICTED: uncharacterized protein C7orf30-like [Nomascus leucogenys] Length = 235 Score = 52.0 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A L+ K Sbjct: 94 IDMMVSLLRQENARDICVIQVPPEMRY-TDYFVIGSGTSTRHLHAMAFYLVKMYK 147 >gi|254939620|ref|NP_083629.1| hypothetical protein LOC75593 [Mus musculus] gi|81904250|sp|Q9CWV0|CG030_MOUSE RecName: Full=Uncharacterized protein C7orf30 homolog gi|12845758|dbj|BAB26886.1| unnamed protein product [Mus musculus] gi|26327691|dbj|BAC27589.1| unnamed protein product [Mus musculus] gi|148666181|gb|EDK98597.1| mCG131733 [Mus musculus] Length = 228 Score = 52.0 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++ L+ K Sbjct: 88 IDMLVSLLRQENARDICVIQVPPEMRY-TDYFVIGSGTSTRHLHAMVHYLVKMYK 141 >gi|152967392|ref|YP_001363176.1| iojap-like protein [Kineococcus radiotolerans SRS30216] gi|151361909|gb|ABS04912.1| iojap-like protein [Kineococcus radiotolerans SRS30216] Length = 138 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 7 KQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 + ++ + + T + A D+ ++ + I D ++ S + + V +IA Sbjct: 4 RSSVPATERALELVTTAAAAAVDKLATDVIALDVSDQL-FITDAFLLASAPNERQVRAIA 62 Query: 67 DNLISYL 73 + + L Sbjct: 63 EAIEEKL 69 >gi|307701837|ref|ZP_07638851.1| iojap-like protein [Mobiluncus mulieris FB024-16] gi|307613095|gb|EFN92350.1| iojap-like protein [Mobiluncus mulieris FB024-16] Length = 161 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 8/64 (12%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + K KA ++ ++ ++ + D ++ SG + + V +I + + Sbjct: 1 MSADSQAIQLAILAGLAAKSKKATEVIALDVSARL-ALTDIFILASGNNERQVRAIVEAV 59 Query: 70 ISYL 73 + Sbjct: 60 DETM 63 >gi|307720450|ref|YP_003891590.1| iojap-like protein [Sulfurimonas autotrophica DSM 16294] gi|306978543|gb|ADN08578.1| iojap-like protein [Sulfurimonas autotrophica DSM 16294] Length = 105 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + I + + L + KAE I + ++ D +I S KH ++ D+L + LK Sbjct: 1 MQNRIQKIADTLDKNKAESIEVFDLRD-KNYFVDYAIIASSLGQKHTTALLDHLKNDLKP 59 Query: 76 K 76 + Sbjct: 60 E 60 >gi|294787554|ref|ZP_06752807.1| iojap-like protein [Parascardovia denticolens F0305] gi|315226860|ref|ZP_07868648.1| Iojap family protein [Parascardovia denticolens DSM 10105] gi|294484910|gb|EFG32545.1| iojap-like protein [Parascardovia denticolens F0305] gi|315120992|gb|EFT84124.1| Iojap family protein [Parascardovia denticolens DSM 10105] Length = 140 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +K EDI + T I D ++V+G + + V +IA+ + + Sbjct: 21 MKGEDIVAFDVTEPL-AITDIFLLVTGDNPRQVLAIAEEIEKDM 63 >gi|220932175|ref|YP_002509083.1| iojap-like protein [Halothermothrix orenii H 168] gi|219993485|gb|ACL70088.1| iojap-like protein [Halothermothrix orenii H 168] Length = 121 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 D+ ++ ++I D VI SG S V +IA ++ L ++ Sbjct: 27 DVQVLDVKE-LTIIADYFVICSGNSEPQVKAIARSVEDKLGEE 68 >gi|302534365|ref|ZP_07286707.1| iojap superfamily protein [Streptomyces sp. C] gi|302443260|gb|EFL15076.1| iojap superfamily protein [Streptomyces sp. C] Length = 147 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 28/67 (41%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I T + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELITTAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLLKE 66 >gi|255630200|gb|ACU15455.1| unknown [Glycine max] Length = 177 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + L + KA+ + I D MV+ +GRST HV +IA LI K+K Sbjct: 41 LQEIETVLTDAKADGVKVIPVPKH-CDWADFMVLATGRSTWHVKNIAQALIYKAKQK 96 >gi|167950674|ref|ZP_02537748.1| iojap-related protein [Endoriftia persephone 'Hot96_1+Hot96_2'] Length = 148 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 12/36 (33%), Positives = 19/36 (52%) Query: 40 NTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ I D M++ SG S +HV SIA + K+ Sbjct: 1 MLRGKTSITDIMIVASGTSDRHVKSIAQTVAFKAKQ 36 >gi|296130114|ref|YP_003637364.1| iojap-like protein [Cellulomonas flavigena DSM 20109] gi|296021929|gb|ADG75165.1| iojap-like protein [Cellulomonas flavigena DSM 20109] Length = 127 Score = 51.6 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + +LKA+++ ++ + ++ D +I SG + + V I D + Sbjct: 1 MPASTRAIELAHAAARAASDLKAQEVIALDVSEQL-VLTDVFLIASGTNERQVGGIVDAV 59 Query: 70 ISYL 73 L Sbjct: 60 EEAL 63 >gi|152976760|ref|YP_001376277.1| iojap-like protein [Bacillus cereus subsp. cytotoxis NVH 391-98] gi|152025512|gb|ABS23282.1| iojap-like protein [Bacillus cytotoxicus NVH 391-98] Length = 118 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 EDI + S I D +I G S K V +IA + + + Sbjct: 20 EDIVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 61 >gi|328947782|ref|YP_004365119.1| iojap-like protein [Treponema succinifaciens DSM 2489] gi|328448106|gb|AEB13822.1| iojap-like protein [Treponema succinifaciens DSM 2489] Length = 115 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 10/65 (15%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + +++ K D+C ++ + + D VI + S H + + Y Sbjct: 2 EKTVKEMALEIAKLMEDGKGTDVCVLDVSE-LNSWTDYFVIATVSSGPHWQGLYKEIKDY 60 Query: 73 LKKKN 77 +K + Sbjct: 61 IKDTD 65 >gi|296284791|ref|ZP_06862789.1| hypothetical protein CbatJ_14281 [Citromicrobium bathyomarinum JL354] Length = 121 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I I+ +S + D+MV+ SGRST+ VASIA L +K+ Sbjct: 25 IVSIDLA-GKSSMADHMVVASGRSTRQVASIAQKLAEKIKQ 64 >gi|315453018|ref|YP_004073288.1| hypothetical protein HFELIS_06140 [Helicobacter felis ATCC 49179] gi|315132070|emb|CBY82698.1| Putative hypothetical protein [Helicobacter felis ATCC 49179] Length = 108 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D I ++E L++ KA D+ + S R+ + +VI + + KH ++ D+L S LK Sbjct: 2 SDPRIDRIVELLEDKKAADVVVFDL-SGRAYVTQKVVIATTLAPKHALALLDHLKSTLK 59 >gi|119385245|ref|YP_916301.1| iojap-like protein [Paracoccus denitrificans PD1222] gi|119375012|gb|ABL70605.1| iojap-like protein [Paracoccus denitrificans PD1222] Length = 110 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 1/40 (2%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I+ RS + D+MVI SGR+ + VASIA+ L+ LK++ Sbjct: 2 TIDLR-GRSAMADHMVIASGRNARQVASIAEKLVERLKEQ 40 >gi|157164140|ref|YP_001467355.1| gerC2 protein [Campylobacter concisus 13826] gi|112801939|gb|EAT99283.1| putative nicotinate (nicotinamide) nucleotide adenylyltransferase [Campylobacter concisus 13826] Length = 293 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++++ L KAE+I + S +VI + +H S+A++L LK Sbjct: 184 SMQERTESIVKVLDAKKAEEIQVFDM-SGDDYFVKAVVIATTLGERHAYSLAEDLKEELK 242 >gi|315604376|ref|ZP_07879442.1| Iojap family protein [Actinomyces sp. oral taxon 180 str. F0310] gi|315314082|gb|EFU62133.1| Iojap family protein [Actinomyces sp. oral taxon 180 str. F0310] Length = 141 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 10/66 (15%), Positives = 27/66 (40%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + + + ++ TS + D V+VS + + V +IA+++ Sbjct: 1 MTLPDATSQLASLASRAADDRGGLNPVLVDVTSKL-ALADAFVVVSAPTQRQVRAIAEDI 59 Query: 70 ISYLKK 75 + + + Sbjct: 60 MDRVWE 65 >gi|227872373|ref|ZP_03990723.1| conserved hypothetical protein [Oribacterium sinus F0268] gi|227841782|gb|EEJ52062.1| conserved hypothetical protein [Oribacterium sinus F0268] Length = 109 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L E K DI ++ + + S++ D V+VS + + + ++ D L + Sbjct: 2 ESLDLCKKIVSVLDEKKGSDIIVLDISEI-SVLSDYFVLVSADNVRQLDALKDALEEAVH 60 Query: 75 KKN 77 N Sbjct: 61 LDN 63 >gi|293374273|ref|ZP_06620601.1| iojap-like protein [Turicibacter sanguinis PC909] gi|325844832|ref|ZP_08168284.1| iojap-like protein [Turicibacter sp. HGF1] gi|292647106|gb|EFF65088.1| iojap-like protein [Turicibacter sanguinis PC909] gi|325489019|gb|EGC91407.1| iojap-like protein [Turicibacter sp. HGF1] Length = 114 Score = 51.6 bits (123), Expect = 4e-05, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + T+++ L AEDI ++ S I D MVI + ++ + +A ++ LK Sbjct: 2 ENLTTIVKALDAKHAEDIVVLDMQQ-FSPIYDYMVITTAKNDR----LAAGILRELKD 54 >gi|255323516|ref|ZP_05364647.1| iojap homolog [Campylobacter showae RM3277] gi|255299553|gb|EET78839.1| iojap homolog [Campylobacter showae RM3277] Length = 108 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L KAE I I+ R I ++I + +H S+ D+L LK Sbjct: 1 MQERIERIIKILDAKKAEAIEAIDMG-GREYIAKYVIIATTMGERHAYSLTDDLKEGLKD 59 Query: 76 K 76 + Sbjct: 60 E 60 >gi|283457953|ref|YP_003362557.1| hypothetical protein RMDY18_09050 [Rothia mucilaginosa DY-18] gi|283133972|dbj|BAI64737.1| uncharacterized protein [Rothia mucilaginosa DY-18] Length = 166 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 12/71 (16%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 K+ + A + +E + ++ ++ + LI D ++VS + + V ++ Sbjct: 18 RKENMTAAQSSIEALRIAARAAEEKQGTNLFAVDASDAMGLI-DGFLVVSAHNERLVNAV 76 Query: 66 ADNLISYLKKK 76 AD + L+++ Sbjct: 77 ADEVEDALREQ 87 >gi|254457631|ref|ZP_05071059.1| iojap family protein [Campylobacterales bacterium GD 1] gi|207086423|gb|EDZ63707.1| iojap family protein [Campylobacterales bacterium GD 1] Length = 114 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 13/59 (22%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + I + L + KAE I + + ++ + +I S +H A++ ++L LK Sbjct: 1 MQNRIDNITNSLDKNKAEGIEVFDLRA-KNYFVEYAIIASSLGPRHTAALLNHLKDDLK 58 >gi|188585175|ref|YP_001916720.1| iojap-like protein [Natranaerobius thermophilus JW/NM-WN-LF] gi|179349862|gb|ACB84132.1| iojap-like protein [Natranaerobius thermophilus JW/NM-WN-LF] Length = 114 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + L + K +DI ++ + +LI D VIV+G ST H+ S+A+NLIS Sbjct: 1 MQDSLQLAKNIAKKLDDKKGKDIVLLKVKDI-TLIADYFVIVTGTSTTHIQSLAENLISS 59 Query: 73 LKKKN 77 LK+++ Sbjct: 60 LKEED 64 >gi|119025888|ref|YP_909733.1| hypothetical protein BAD_0870 [Bifidobacterium adolescentis ATCC 15703] gi|118765472|dbj|BAF39651.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703] Length = 135 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + I +KA DI + T I D M+I S + + V ++A+ + Sbjct: 1 MPALQDSIDAIRIAAAAADRMKATDIVAFDVTEPL-AITDAMLIASASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|86150069|ref|ZP_01068297.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni CF93-6] gi|86151912|ref|ZP_01070125.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 260.94] gi|86152525|ref|ZP_01070730.1| putative iojap homolog [Campylobacter jejuni subsp. jejuni HB93-13] gi|157415638|ref|YP_001482894.1| hypothetical protein C8J_1319 [Campylobacter jejuni subsp. jejuni 81116] gi|315124840|ref|YP_004066844.1| hypothetical protein ICDCCJ07001_1336 [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|85839515|gb|EAQ56776.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni CF93-6] gi|85841020|gb|EAQ58269.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 260.94] gi|85843410|gb|EAQ60620.1| putative iojap homolog [Campylobacter jejuni subsp. jejuni HB93-13] gi|157386602|gb|ABV52917.1| hypothetical protein C8J_1319 [Campylobacter jejuni subsp. jejuni 81116] gi|284926620|gb|ADC28972.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni IA3902] gi|307748282|gb|ADN91552.1| Putative uncharacterized protein [Campylobacter jejuni subsp. jejuni M1] gi|315018562|gb|ADT66655.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni ICDCCJ07001] gi|315928054|gb|EFV07373.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni DFVF1099] gi|315931444|gb|EFV10411.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 327] Length = 108 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAEDI I+ + ++I + +H S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAEDIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTQLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|153952443|ref|YP_001398707.1| hypothetical protein JJD26997_1739 [Campylobacter jejuni subsp. doylei 269.97] gi|152939889|gb|ABS44630.1| conserved hypothetical protein [Campylobacter jejuni subsp. doylei 269.97] Length = 108 Score = 51.2 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAEDI I+ + ++I + +H S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAEDIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTQLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|88596439|ref|ZP_01099676.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 84-25] gi|218563009|ref|YP_002344788.1| hypothetical protein Cj1405 [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|88191280|gb|EAQ95252.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 84-25] gi|112360715|emb|CAL35514.1| conserved hypothetical protein Cj1405 [Campylobacter jejuni subsp. jejuni NCTC 11168] gi|315929536|gb|EFV08728.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 305] Length = 108 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAE+I I+ + ++I + +H S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAENIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTRLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|225706248|gb|ACO08970.1| C7orf30 [Osmerus mordax] Length = 240 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 21/76 (27%), Positives = 40/76 (52%), Gaps = 5/76 (6%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T++++++ D I ++ L++ A DIC I+ D+ ++VSG ST+H+ + Sbjct: 97 TQEESVKKTVR-DFNIDVMVSLLRQENAVDICVIKVPEEVKY-TDHFIVVSGSSTRHLRA 154 Query: 65 I---ADNLISYLKKKN 77 + A + LKK N Sbjct: 155 MALYAIKVHKLLKKNN 170 >gi|46201066|ref|ZP_00207952.1| COG0799: Uncharacterized homolog of plant Iojap protein [Magnetospirillum magnetotacticum MS-1] Length = 105 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Query: 36 CHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ R+ I D M+I +G+S + V ++AD++ LK+ Sbjct: 2 IVLDL-KGRTSITDTMIIATGKSQRQVGAMADHVEKALKQ 40 >gi|296270416|ref|YP_003653048.1| iojap-like protein [Thermobispora bispora DSM 43833] gi|296093203|gb|ADG89155.1| iojap-like protein [Thermobispora bispora DSM 43833] Length = 134 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++ I E E A+DI + + +I D ++ S + + V ++ D + Sbjct: 1 MTASERSLQLIRIAAEAAAEKLADDIIAYDVSDRL-VITDAFLLCSASNDRQVRAVVDEI 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EERLR 64 >gi|84498613|ref|ZP_00997376.1| hypothetical protein JNB_20513 [Janibacter sp. HTCC2649] gi|84381146|gb|EAP97031.1| hypothetical protein JNB_20513 [Janibacter sp. HTCC2649] Length = 125 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D E A I I+ + I D VI S S + V +I D + Sbjct: 1 MPATDRSLELARAAAHAASEKLATTIVGIDVSEQL-AITDIFVIASAESERQVGAIVDEV 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EDSLR 64 >gi|260906330|ref|ZP_05914652.1| hypothetical protein BlinB_13461 [Brevibacterium linens BL2] Length = 120 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 9/55 (16%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + T + D ++ ++ I D +I+S + + + SI D + + Sbjct: 1 MLRTAARAADDKLGTDQVALDVSATL-YITDAFLIISAENDRQIGSIVDAVEEAV 54 >gi|241894954|ref|ZP_04782250.1| Iojap family protein [Weissella paramesenteroides ATCC 33313] gi|241871672|gb|EER75423.1| Iojap family protein [Weissella paramesenteroides ATCC 33313] Length = 128 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + +++ +A ++ +AED+ ++ S+I D+ +I+S + + V +IAD +I Sbjct: 5 KMTSNVNDMLAVAVKAADSKRAEDLVALDI-HEMSIITDDYLILSAPTERQVIAIADEII 63 Query: 71 SYLKK 75 + + Sbjct: 64 DKMAE 68 >gi|41408341|ref|NP_961177.1| hypothetical protein MAP2243c [Mycobacterium avium subsp. paratuberculosis K-10] gi|41396697|gb|AAS04560.1| hypothetical protein MAP_2243c [Mycobacterium avium subsp. paratuberculosis K-10] Length = 131 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ ++ I D VI S + + V +I D + ++K Sbjct: 24 DDVVVIDVSAQL-AITDCFVIASASNERQVNAIVDEVEEKMRK 65 >gi|269976514|ref|ZP_06183499.1| iojap-like ribosome-associated protein [Mobiluncus mulieris 28-1] gi|269935315|gb|EEZ91864.1| iojap-like ribosome-associated protein [Mobiluncus mulieris 28-1] Length = 159 Score = 51.2 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 8/64 (12%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + K KA ++ ++ ++ + D ++ SG + + V +I + + Sbjct: 1 MSADSQAIQLAILAGLAAKSKKATEVIALDVSARL-ALTDIFILASGNNERQVRAIVEAV 59 Query: 70 ISYL 73 + Sbjct: 60 DETM 63 >gi|257068973|ref|YP_003155228.1| iojap-related protein [Brachybacterium faecium DSM 4810] gi|256559791|gb|ACU85638.1| iojap-related protein [Brachybacterium faecium DSM 4810] Length = 125 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + A+++ ++ + L +I D ++ SG + + VA+I D + Sbjct: 1 MSAPEESLDLARVAGQAAADKLADEVIGLDVSELV-VITDVFLVCSGETERQVAAIVDGI 59 Query: 70 ISYL 73 L Sbjct: 60 EEAL 63 >gi|297587663|ref|ZP_06946307.1| iojap-like protein [Finegoldia magna ATCC 53516] gi|302381100|ref|ZP_07269560.1| iojap-like protein [Finegoldia magna ACS-171-V-Col3] gi|303235263|ref|ZP_07321881.1| iojap-like protein [Finegoldia magna BVS033A4] gi|297574352|gb|EFH93072.1| iojap-like protein [Finegoldia magna ATCC 53516] gi|302311147|gb|EFK93168.1| iojap-like protein [Finegoldia magna ACS-171-V-Col3] gi|302493577|gb|EFL53365.1| iojap-like protein [Finegoldia magna BVS033A4] Length = 100 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 23/57 (40%), Gaps = 3/57 (5%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + + + +DI + L S + D VI + + H SI D + + Sbjct: 4 LELVQKAIDDKIGKDIVTL---KLDSAVADYFVIATANAPNHAQSIIDEVEKVCDEN 57 >gi|78779361|ref|YP_397473.1| Iojap-related protein [Prochlorococcus marinus str. MIT 9312] gi|78712860|gb|ABB50037.1| Iojap-related protein [Prochlorococcus marinus str. MIT 9312] Length = 116 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + + + KA+DI I+ S I + ++I G S V SI +++ L+ Sbjct: 4 DNKSLVLMAAKACDDKKAKDIKLIKI-DKVSFISEWILIAEGLSDVQVRSITNSVEGELR 62 Query: 75 KK 76 K Sbjct: 63 DK 64 >gi|255326323|ref|ZP_05367408.1| conserved hypothetical protein [Rothia mucilaginosa ATCC 25296] gi|255296617|gb|EET75949.1| conserved hypothetical protein [Rothia mucilaginosa ATCC 25296] Length = 166 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 12/71 (16%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 K+ + A + +E + ++ ++ + LI D ++VS + + V ++ Sbjct: 18 RKENMTAAQSSVEALRIAARAAEEKQGTNLFAVDASDAMGLI-DGFLVVSAHNERLVNAV 76 Query: 66 ADNLISYLKKK 76 AD + L+++ Sbjct: 77 ADEVEDALREQ 87 >gi|326921876|ref|XP_003207180.1| PREDICTED: uncharacterized protein C7orf30-like [Meleagris gallopavo] Length = 156 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKH 61 + N + + I V+ L++ A+DIC I+ C+ ++VSG ST+H Sbjct: 1 MTNLQLPERRDTSLPKFNIDFVVNLLRQENAKDICVIQVPPEIKY-CNYFIVVSGSSTRH 59 Query: 62 VASIADNLISYLKKK 76 + ++A ++ K + Sbjct: 60 LHAMAHYMLKMYKHQ 74 >gi|281353860|gb|EFB29444.1| hypothetical protein PANDA_010267 [Ailuropoda melanoleuca] Length = 147 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 10 IDMLVSLLRQENARDICVIKVPPELKY-TDYFVIGSGTSTRHLHAMAYYIVKMYK 63 >gi|118463750|ref|YP_880976.1| hypothetical protein MAV_1751 [Mycobacterium avium 104] gi|118165037|gb|ABK65934.1| conserved domain protein [Mycobacterium avium 104] Length = 131 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ ++ I D VI S + + V +I D + ++K Sbjct: 24 DDVVVIDVSAQL-AITDCFVIASASNERQVNAIVDEVEEKMRK 65 >gi|163814062|ref|ZP_02205454.1| hypothetical protein COPEUT_00215 [Coprococcus eutactus ATCC 27759] gi|158450511|gb|EDP27506.1| hypothetical protein COPEUT_00215 [Coprococcus eutactus ATCC 27759] Length = 129 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 16/75 (21%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M + + + + + L++ KA DI I+ + + + +CD +VI G + K Sbjct: 1 MTDSKTNLIIDSKKDSKTMLKITCAALEDKKAFDIKIIDISKIST-LCDYIVIADGTNKK 59 Query: 61 HVASIADNLISYLKK 75 V ++ DN+ +++ Sbjct: 60 QVQALCDNVEDEMRE 74 >gi|224370257|ref|YP_002604421.1| putative iojap-related protein [Desulfobacterium autotrophicum HRM2] gi|223692974|gb|ACN16257.1| putative iojap-related protein [Desulfobacterium autotrophicum HRM2] Length = 129 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 2/66 (3%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 T D LDS ++E KAE+I ++ + D ++I++ +S + V++IA+++ Sbjct: 8 TKDLLDSLDKYLVEAFL-RKAEEITVLDVRK-LTSYADAIMIITAKSQRQVSAIAEHINI 65 Query: 72 YLKKKN 77 +KK N Sbjct: 66 AMKKIN 71 >gi|254526446|ref|ZP_05138498.1| iojap family protein [Prochlorococcus marinus str. MIT 9202] gi|221537870|gb|EEE40323.1| iojap family protein [Prochlorococcus marinus str. MIT 9202] Length = 116 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + E KA DI I+ S I + ++I G S V SI +++ L+ Sbjct: 4 DNKNLVLMAAKACDEKKARDIKLIKI-DKVSFISEWILIAEGLSDVQVRSITNSVEGELR 62 Query: 75 KK 76 +K Sbjct: 63 EK 64 >gi|157738330|ref|YP_001491014.1| hypothetical protein Abu_2130 [Arcobacter butzleri RM4018] gi|315636617|ref|ZP_07891851.1| Iojap family protein [Arcobacter butzleri JV22] gi|157700184|gb|ABV68344.1| conserved hypothetical protein (DUF143 domain protein) [Arcobacter butzleri RM4018] gi|315479126|gb|EFU69825.1| Iojap family protein [Arcobacter butzleri JV22] Length = 108 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +++ + + L + KAE+I + TS ++ + D +VI + ++KH ++ D L LK Sbjct: 1 MNTRLEDIKTILSDKKAENIEIFDLTS-KNYLVDYVVIATTLNSKHAFALLDYLKIGLKP 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|283955022|ref|ZP_06372529.1| hypothetical protein C414_000350063 [Campylobacter jejuni subsp. jejuni 414] gi|283793520|gb|EFC32282.1| hypothetical protein C414_000350063 [Campylobacter jejuni subsp. jejuni 414] Length = 108 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAEDI I+ + ++I + +H S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAEDIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTKLKT 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|121612776|ref|YP_001001060.1| hypothetical protein CJJ81176_1404 [Campylobacter jejuni subsp. jejuni 81-176] gi|167005961|ref|ZP_02271719.1| hypothetical protein Cjejjejuni_07380 [Campylobacter jejuni subsp. jejuni 81-176] gi|205356154|ref|ZP_03222921.1| hypothetical protein Cj8421_1454 [Campylobacter jejuni subsp. jejuni CG8421] gi|87249796|gb|EAQ72755.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni 81-176] gi|205345997|gb|EDZ32633.1| hypothetical protein Cj8421_1454 [Campylobacter jejuni subsp. jejuni CG8421] Length = 108 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAE+I I+ + ++I + +H S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAENIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTQLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|254382724|ref|ZP_04998081.1| conserved hypothetical protein [Streptomyces sp. Mg1] gi|194341626|gb|EDX22592.1| conserved hypothetical protein [Streptomyces sp. Mg1] Length = 148 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 27/67 (40%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D I + + A DI + + + S I D ++ S + + V SI D + Sbjct: 1 MTATDRSIELITAAAQAAADRLAHDIIAYDVSDVLS-ITDAFLLASAPNDRQVKSIVDEI 59 Query: 70 ISYLKKK 76 L K+ Sbjct: 60 EERLLKE 66 >gi|154486281|ref|ZP_02027688.1| hypothetical protein BIFADO_00086 [Bifidobacterium adolescentis L2-32] gi|154084144|gb|EDN83189.1| hypothetical protein BIFADO_00086 [Bifidobacterium adolescentis L2-32] Length = 140 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 24/65 (36%), Gaps = 1/65 (1%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + I +KA DI + T I D M+I S + + V ++A+ Sbjct: 5 NMPALQDSIDAIRIAAAAADRMKATDIVAFDVTEPL-AITDAMLIASASNERQVLAVAEE 63 Query: 69 LISYL 73 + L Sbjct: 64 IEKDL 68 >gi|309803124|ref|ZP_07697221.1| putative iojap-like protein [Lactobacillus iners LactinV 11V1-d] gi|309805238|ref|ZP_07699290.1| putative iojap-like protein [Lactobacillus iners LactinV 09V1-c] gi|308164632|gb|EFO66882.1| putative iojap-like protein [Lactobacillus iners LactinV 11V1-d] gi|308165472|gb|EFO67703.1| putative iojap-like protein [Lactobacillus iners LactinV 09V1-c] Length = 68 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + +E + E E+ + S++ D VI + S + + +IA+++I + +K Sbjct: 5 ELLDLTLEAISERHGEETKAYDMR-GISILADYYVITTAGSNRQLHAIANSIIEKVHEK 62 >gi|117927972|ref|YP_872523.1| iojap-like protein [Acidothermus cellulolyticus 11B] gi|117648435|gb|ABK52537.1| iojap-like protein [Acidothermus cellulolyticus 11B] Length = 132 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 DI + + I D V+ S + + V ++ D + L+K + Sbjct: 24 RDIVAFDVSDRL-PITDAFVLASASNDRQVRAVVDAIEERLQKFH 67 >gi|258591129|emb|CBE67424.1| conserved protein of unknown function [NC10 bacterium 'Dutch sediment'] Length = 144 Score = 50.9 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 E+K + H++ D+ +IVS S + V +IA+ + L++ + Sbjct: 38 EVKPTSLVHLDLR-GLCSFTDHFLIVSAPSARQVRAIAERIEEQLREVH 85 >gi|228941497|ref|ZP_04104047.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar berliner ATCC 10792] gi|228974427|ref|ZP_04134995.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228981022|ref|ZP_04141324.1| YqeL (Iojap-related protein) [Bacillus thuringiensis Bt407] gi|228778682|gb|EEM26947.1| YqeL (Iojap-related protein) [Bacillus thuringiensis Bt407] gi|228785263|gb|EEM33274.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar thuringiensis str. T01001] gi|228818147|gb|EEM64222.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar berliner ATCC 10792] Length = 111 Score = 50.9 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ + S I D +I G S K V +IA + S + Sbjct: 13 EDMVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKSKAHE 54 >gi|306818179|ref|ZP_07451910.1| Iojap family protein [Mobiluncus mulieris ATCC 35239] gi|304649143|gb|EFM46437.1| Iojap family protein [Mobiluncus mulieris ATCC 35239] Length = 159 Score = 50.9 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 8/64 (12%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + K KA ++ ++ ++ + D ++ SG + + V +I + + Sbjct: 1 MSADSQAIQLAILAGLAAKSKKATEVIALDVSARL-ALTDIFILASGNNERQVRAIVEAV 59 Query: 70 ISYL 73 + Sbjct: 60 DETM 63 >gi|227874883|ref|ZP_03993036.1| iojap family protein [Mobiluncus mulieris ATCC 35243] gi|227844658|gb|EEJ54814.1| iojap family protein [Mobiluncus mulieris ATCC 35243] Length = 159 Score = 50.9 bits (121), Expect = 7e-05, Method: Composition-based stats. Identities = 8/64 (12%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + K KA ++ ++ ++ + D ++ SG + + V +I + + Sbjct: 1 MSADSQAIQLAILAGLAAKSKKATEVIALDVSARL-ALTDIFILASGNNERQVRAIVEAV 59 Query: 70 ISYL 73 + Sbjct: 60 DETM 63 >gi|157413414|ref|YP_001484280.1| hypothetical protein P9215_10791 [Prochlorococcus marinus str. MIT 9215] gi|157387989|gb|ABV50694.1| Domain of unknown function DUF143 [Prochlorococcus marinus str. MIT 9215] Length = 116 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + E KA DI I+ S I + ++I G S V SI +++ L+ Sbjct: 4 DNKNLVLMAAKACDEKKARDIKLIKI-DKVSFISEWILIAEGLSDVQVRSITNSVEGELR 62 Query: 75 KK 76 +K Sbjct: 63 EK 64 >gi|123966131|ref|YP_001011212.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9515] gi|123200497|gb|ABM72105.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9515] Length = 114 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + E KA++I I + S I + ++I G S V SI +++ L+ Sbjct: 2 DSKFLVLMAAKACDEKKAKEIRLINI-NKVSYISEWILIAEGLSDVQVRSITNSVEMELR 60 Query: 75 KK 76 + Sbjct: 61 EN 62 >gi|220912885|ref|YP_002488194.1| iojap-like protein [Arthrobacter chlorophenolicus A6] gi|219859763|gb|ACL40105.1| iojap-like protein [Arthrobacter chlorophenolicus A6] Length = 129 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 +DI ++ + + D +I S S + V +I D + L K++ Sbjct: 24 QDIVALDVSERL-ALADVFLIASAPSERQVNAIVDGIEEELAKQD 67 >gi|308276940|gb|ADO26839.1| Putative protein yqeL [Corynebacterium pseudotuberculosis I19] Length = 146 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + E +A +I I+ + + I + V+ S + + V +I + + L Sbjct: 1 MASLAARAADEKQATNIAVIDVSDVM-AISEIFVLASADNERQVRAIVEEIEDVL 54 >gi|227499154|ref|ZP_03929289.1| conserved hypothetical protein [Acidaminococcus sp. D21] gi|226904601|gb|EEH90519.1| conserved hypothetical protein [Acidaminococcus sp. D21] Length = 120 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 43 LRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S + D +I S +S V +IAD++ L + Sbjct: 29 GLSPVTDYFMICSAQSATQVRAIADSIEDKLAE 61 >gi|328773883|gb|EGF83920.1| hypothetical protein BATDEDRAFT_85536 [Batrachochytrium dendrobatidis JAM81] Length = 401 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Query: 2 LANTEKQALQTAD---HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRS 58 + +E + D ++ V++ + + + ++ I+ S + D MVIV GRS Sbjct: 254 IIESEDEIAMAMDGSVESSVLLSHVLKVIADERGFNLTVIDVRS-KCDHTDYMVIVEGRS 312 Query: 59 TKHVASIADNLISYLK 74 TK + SIAD + +K Sbjct: 313 TKQIYSIADAVRRKVK 328 >gi|134098018|ref|YP_001103679.1| hypothetical protein SACE_1432 [Saccharopolyspora erythraea NRRL 2338] gi|291007217|ref|ZP_06565190.1| hypothetical protein SeryN2_22072 [Saccharopolyspora erythraea NRRL 2338] gi|133910641|emb|CAM00754.1| hypothetical protein SACE_1432 [Saccharopolyspora erythraea NRRL 2338] Length = 133 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D+ ++ + +I D +I S + + V +I D++ ++ Sbjct: 25 DVVVLDVSEQL-VITDCFLIASAPNERQVEAIVDSVEEKMR 64 >gi|21536608|gb|AAM60940.1| unknown [Arabidopsis thaliana] Length = 184 Score = 50.5 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L ++KA+++ I T D VI +GRS H+ +IA L+ K+K Sbjct: 46 TLPEVEKILADVKADNVTVIP-THNHCFWADFTVIATGRSDWHLRNIAQALVYRAKQK 102 >gi|332184151|gb|AEE26405.1| Iojap-related protein [Francisella cf. novicida 3523] Length = 111 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D + V+E L +LK +I I+ + + D +VI + ST H ++A NL LK Sbjct: 2 TTDQRLEIVLEALDDLKGINIQTIDV-EHLTDMMDKIVISTASSTTHAKALAKNLEQELK 60 >gi|283956786|ref|ZP_06374262.1| hypothetical protein C1336_000290062 [Campylobacter jejuni subsp. jejuni 1336] gi|283791761|gb|EFC30554.1| hypothetical protein C1336_000290062 [Campylobacter jejuni subsp. jejuni 1336] Length = 108 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAEDI I+ + ++I + +H S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAEDIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTQLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|56708182|ref|YP_170078.1| hypothetical protein FTT_1100 [Francisella tularensis subsp. tularensis SCHU S4] gi|110670653|ref|YP_667210.1| hypothetical protein FTF1100 [Francisella tularensis subsp. tularensis FSC198] gi|56604674|emb|CAG45733.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis SCHU S4] gi|110320986|emb|CAL09116.1| conserved hypothetical protein [Francisella tularensis subsp. tularensis FSC198] Length = 111 Score = 50.5 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D + V+E L +LK +I I+ + + D +VI + ST H ++A NL LK Sbjct: 2 TTDQRLEIVLEALDDLKGINIQTIDV-EHLTDMMDKIVISTASSTTHAKALAKNLEQELK 60 >gi|269118815|ref|YP_003306992.1| Iojap-related protein [Sebaldella termitidis ATCC 33386] gi|268612693|gb|ACZ07061.1| Iojap-related protein [Sebaldella termitidis ATCC 33386] Length = 101 Score = 50.5 bits (120), Expect = 9e-05, Method: Composition-based stats. Identities = 11/58 (18%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +++ + +E ++ K ++I + +S D +V+ G S+ + +IA L + Sbjct: 1 MENSVKKAIEIIESKKGDNIKVYDV-QGKSPFMDYVVVCDGSSSVKMEAIATELKKEI 57 >gi|328955461|ref|YP_004372794.1| iojap-like protein [Coriobacterium glomerans PW2] gi|328455785|gb|AEB06979.1| iojap-like protein [Coriobacterium glomerans PW2] Length = 155 Score = 50.1 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + KAED+ ++ + RS + D VI + + + ++ D + + + Sbjct: 55 DKKAEDVIALDLSE-RSDVTDYFVIATASNNRLADTVVDEVELRVAQ 100 >gi|325474300|gb|EGC77488.1| hypothetical protein HMPREF9353_01838 [Treponema denticola F0402] Length = 119 Score = 50.1 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + L++ K E++ ++ +++ D VI + S H A + + +L + N Sbjct: 16 KLLRDFKGENVVVLDLRD-KNIWTDFFVICTVTSAAHSAGLEKRVYEFLPEHN 67 >gi|319440887|ref|ZP_07990043.1| hypothetical protein CvarD4_03878 [Corynebacterium variabile DSM 44702] Length = 166 Score = 50.1 bits (119), Expect = 9e-05, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 E EDI ++ T R + D VI++G + + V SI D + + L +K Sbjct: 20 EKFGEDIAVLDVT-GRMPLADIFVIITGDNERMVDSIVDEIEAELSEK 66 >gi|118497369|ref|YP_898419.1| hypothetical protein FTN_0774 [Francisella tularensis subsp. novicida U112] gi|195536058|ref|ZP_03079065.1| putative iojap-like protein [Francisella tularensis subsp. novicida FTE] gi|118423275|gb|ABK89665.1| conserved protein of unknown function [Francisella novicida U112] gi|194372535|gb|EDX27246.1| putative iojap-like protein [Francisella tularensis subsp. novicida FTE] Length = 111 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D + V+E L +LK +I I+ + + D +VI + ST H ++A NL LK Sbjct: 2 TTDQRLEIVLEALDDLKGINIQSIDV-EHLTDMMDKIVISTASSTTHAKALAKNLEQELK 60 >gi|18408812|ref|NP_564901.1| unknown protein [Arabidopsis thaliana] gi|12324678|gb|AAG52301.1|AC011020_8 unknown protein [Arabidopsis thaliana] gi|51969494|dbj|BAD43439.1| unknown protein [Arabidopsis thaliana] gi|51970210|dbj|BAD43797.1| unknown protein [Arabidopsis thaliana] gi|107738091|gb|ABF83633.1| At1g67620 [Arabidopsis thaliana] gi|110739585|dbj|BAF01701.1| hypothetical protein [Arabidopsis thaliana] gi|110739752|dbj|BAF01783.1| hypothetical protein [Arabidopsis thaliana] gi|332196550|gb|AEE34671.1| Lojap-related protein [Arabidopsis thaliana] Length = 184 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L ++KA+++ I T D VI +GRS H+ +IA L+ K+K Sbjct: 46 TLPEVEKILADVKADNVTVIP-THNHCFWADFTVIATGRSDWHLRNIAQALVYRAKQK 102 >gi|126696385|ref|YP_001091271.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9301] gi|126543428|gb|ABO17670.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. MIT 9301] Length = 114 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + + E KA DI I+ S I + ++I G S V SI +++ L+ Sbjct: 2 DNKSLVLMAAKACDEKKARDIKLIKI-DKVSFISEWILIAEGLSDVQVRSITNSVEGELR 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|301771914|ref|XP_002921379.1| PREDICTED: uncharacterized protein C7orf30-like [Ailuropoda melanoleuca] Length = 94 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + L++ A DIC I+ D VI SG ST+H+ ++A ++ K Sbjct: 3 VSLLRQENARDICVIKVPPELKY-TDYFVIGSGTSTRHLHAMAYYIVKMYK 52 >gi|125840839|ref|XP_001333189.1| PREDICTED: uncharacterized protein C7orf30 [Danio rerio] Length = 220 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L++ A DIC I D M+IVSG S +H++++A LI K Sbjct: 83 LLVSALRQENATDICVIRVAPELKY-TDYMIIVSGASPRHLSAMAAFLIKVFK 134 >gi|229086901|ref|ZP_04219060.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-44] gi|228696411|gb|EEL49237.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-44] Length = 111 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ + S I D +I G S K V +IA + + + Sbjct: 13 EDMVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 54 >gi|167627897|ref|YP_001678397.1| hypothetical protein Fphi_1671 [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|241668450|ref|ZP_04756028.1| hypothetical protein FphipA2_06766 [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254876983|ref|ZP_05249693.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|167597898|gb|ABZ87896.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|254843004|gb|EET21418.1| conserved hypothetical protein [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 111 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D + V+E L LK +DI I + + DN+VI + ST H S+A NL LK Sbjct: 2 TTDQRLQIVLEALDNLKGQDIQSINV-EHLTDMMDNIVITTASSTTHAKSLARNLEQELK 60 Query: 75 KK 76 Sbjct: 61 DN 62 >gi|229817807|ref|ZP_04448089.1| hypothetical protein BIFANG_03086 [Bifidobacterium angulatum DSM 20098] gi|229785596|gb|EEP21710.1| hypothetical protein BIFANG_03086 [Bifidobacterium angulatum DSM 20098] Length = 138 Score = 50.1 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + I +KA DI + T I D M++ + + + V ++A+ + Sbjct: 1 MPALQSSIDDIRVAAAAADRMKATDIVAFDVTVPLG-ITDIMMVATASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 ERDL 63 >gi|254819849|ref|ZP_05224850.1| hypothetical protein MintA_07989 [Mycobacterium intracellulare ATCC 13950] Length = 131 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ ++ I D VI S + + V +I D + ++K Sbjct: 24 DDVVVIDVSAQL-AITDCFVIASASNERQVNAIVDEVEEKMRK 65 >gi|299472221|emb|CBN77191.1| conserved unknown protein [Ectocarpus siliculosus] Length = 244 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 9/68 (13%), Positives = 30/68 (44%) Query: 9 ALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADN 68 + ++ + V++ ++ D+ I+ + + D MV + + + +A+ Sbjct: 83 EIAVIPRVNLTVDEVVKAVEAQGGTDVRAIDLRGKGAGMGDFMVFCTAATPLQMRRLANM 142 Query: 69 LISYLKKK 76 ++ LK++ Sbjct: 143 VVQALKQR 150 >gi|213513728|ref|NP_001134987.1| CG030 protein [Salmo salar] gi|209737772|gb|ACI69755.1| C7orf30 [Salmo salar] Length = 243 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/73 (24%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + + Q D + ++ L++ A DIC I+ D ++VSG S++H+ ++ Sbjct: 98 QSDSSQRNPQEDFNMDVLVSLLRQENAADICVIKVPEDIKY-TDYFIVVSGSSSRHLRAM 156 Query: 66 ---ADNLISYLKK 75 A + Y+KK Sbjct: 157 ALYAIKVYKYMKK 169 >gi|297838501|ref|XP_002887132.1| hypothetical protein ARALYDRAFT_475863 [Arabidopsis lyrata subsp. lyrata] gi|297332973|gb|EFH63391.1| hypothetical protein ARALYDRAFT_475863 [Arabidopsis lyrata subsp. lyrata] Length = 184 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L ++KA+++ I T D VI +GRS H+ +IA L+ K+K Sbjct: 46 TLPEVEKILADVKADNVTVIP-THNHCFWADFTVIATGRSDWHLRNIAQALVYRAKQK 102 >gi|262039463|ref|ZP_06012767.1| iojap-like ribosome-associated protein [Leptotrichia goodfellowii F0264] gi|261746530|gb|EEY34065.1| iojap-like ribosome-associated protein [Leptotrichia goodfellowii F0264] Length = 114 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 ++ L I +++ +++ K +DI + RS D ++ +G ST+++ +IA+++ Sbjct: 1 MEENKELKKEIDSIISIIEDKKGQDIKVFDM-KGRSPFFDYSILCTGSSTRNIEAIANDI 59 Query: 70 IS 71 Sbjct: 60 KK 61 >gi|91202945|emb|CAJ72584.1| conserved hypothetical protein [Candidatus Kuenenia stuttgartiensis] Length = 92 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D VI SG +++ + IAD + +K+ Sbjct: 4 KEVSFIADFFVICSGLNSRQLQGIADEVELKMKE 37 >gi|240170832|ref|ZP_04749491.1| hypothetical protein MkanA1_16082 [Mycobacterium kansasii ATCC 12478] Length = 126 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI S + + V +I D + +++ Sbjct: 24 DDVVVIDV-SGQLVITDCFVIASASNERQVNAIVDEVEEKMRR 65 >gi|30022408|ref|NP_834039.1| iojap superfamily protein [Bacillus cereus ATCC 14579] gi|206969911|ref|ZP_03230865.1| iojap-related protein [Bacillus cereus AH1134] gi|218235342|ref|YP_002369140.1| iojap-related protein [Bacillus cereus B4264] gi|218899498|ref|YP_002447909.1| iojap-related protein [Bacillus cereus G9842] gi|296504823|ref|YP_003666523.1| iojap superfamily protein [Bacillus thuringiensis BMB171] gi|29897966|gb|AAP11240.1| iojap protein family [Bacillus cereus ATCC 14579] gi|206735599|gb|EDZ52767.1| iojap-related protein [Bacillus cereus AH1134] gi|218163299|gb|ACK63291.1| iojap-like ribosome-associated protein [Bacillus cereus B4264] gi|218543425|gb|ACK95819.1| iojap-related protein [Bacillus cereus G9842] gi|296325875|gb|ADH08803.1| iojap superfamily protein [Bacillus thuringiensis BMB171] gi|326942113|gb|AEA18009.1| iojap superfamily protein [Bacillus thuringiensis serovar chinensis CT-43] Length = 118 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ + S I D +I G S K V +IA + S + Sbjct: 20 EDMVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKSKAHE 61 >gi|224543256|ref|ZP_03683795.1| hypothetical protein CATMIT_02456 [Catenibacterium mitsuokai DSM 15897] gi|224523789|gb|EEF92894.1| hypothetical protein CATMIT_02456 [Catenibacterium mitsuokai DSM 15897] Length = 114 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 9/54 (16%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + +++ + + A+DI I S + D ++ + + + + +I DN++ Sbjct: 4 VECIVKAMDDKLAQDIVAINM-ENASPLYDTFILCTASNKRLLNAIQDNVVDQC 56 >gi|30264401|ref|NP_846778.1| iojap-related protein [Bacillus anthracis str. Ames] gi|47529853|ref|YP_021202.1| iojap-related protein [Bacillus anthracis str. 'Ames Ancestor'] gi|49187224|ref|YP_030476.1| iojap-related protein [Bacillus anthracis str. Sterne] gi|65321702|ref|ZP_00394661.1| COG0799: Uncharacterized homolog of plant Iojap protein [Bacillus anthracis str. A2012] gi|167634540|ref|ZP_02392860.1| iojap-related protein [Bacillus anthracis str. A0442] gi|167638490|ref|ZP_02396766.1| iojap-related protein [Bacillus anthracis str. A0193] gi|170687340|ref|ZP_02878557.1| iojap-related protein [Bacillus anthracis str. A0465] gi|170707410|ref|ZP_02897864.1| iojap-related protein [Bacillus anthracis str. A0389] gi|177653291|ref|ZP_02935543.1| iojap-related protein [Bacillus anthracis str. A0174] gi|190567006|ref|ZP_03019922.1| iojap-related protein [Bacillus anthracis Tsiankovskii-I] gi|227817107|ref|YP_002817116.1| iojap-related protein [Bacillus anthracis str. CDC 684] gi|229600981|ref|YP_002868620.1| iojap-related protein [Bacillus anthracis str. A0248] gi|254684087|ref|ZP_05147947.1| iojap-related protein [Bacillus anthracis str. CNEVA-9066] gi|254736435|ref|ZP_05194141.1| iojap-related protein [Bacillus anthracis str. Western North America USA6153] gi|254741472|ref|ZP_05199159.1| iojap-related protein [Bacillus anthracis str. Kruger B] gi|254750911|ref|ZP_05202950.1| iojap-related protein [Bacillus anthracis str. Vollum] gi|254757761|ref|ZP_05209788.1| iojap-related protein [Bacillus anthracis str. Australia 94] gi|30259059|gb|AAP28264.1| iojap-like ribosome-associated protein [Bacillus anthracis str. Ames] gi|47505001|gb|AAT33677.1| iojap-related protein [Bacillus anthracis str. 'Ames Ancestor'] gi|49181151|gb|AAT56527.1| iojap-related protein [Bacillus anthracis str. Sterne] gi|167513338|gb|EDR88708.1| iojap-related protein [Bacillus anthracis str. A0193] gi|167529992|gb|EDR92727.1| iojap-related protein [Bacillus anthracis str. A0442] gi|170127654|gb|EDS96527.1| iojap-related protein [Bacillus anthracis str. A0389] gi|170668535|gb|EDT19281.1| iojap-related protein [Bacillus anthracis str. A0465] gi|172081573|gb|EDT66645.1| iojap-related protein [Bacillus anthracis str. A0174] gi|190561997|gb|EDV15966.1| iojap-related protein [Bacillus anthracis Tsiankovskii-I] gi|227004726|gb|ACP14469.1| iojap-like ribosome-associated protein [Bacillus anthracis str. CDC 684] gi|229265389|gb|ACQ47026.1| iojap-related protein [Bacillus anthracis str. A0248] Length = 118 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ + S I D +I G S K V +IA + + + Sbjct: 20 EDMVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 61 >gi|123968580|ref|YP_001009438.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. AS9601] gi|123198690|gb|ABM70331.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus str. AS9601] Length = 114 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 S + + E KA+DI I+ S I + ++I G S V SI ++ L+ Sbjct: 2 DNKSLVLMAAKACDEKKAKDIKLIKI-DKVSFISEWILIAEGLSDVQVRSITSSVEGELR 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|225717184|gb|ACO14438.1| C7orf30 [Esox lucius] Length = 244 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI---ADNLISYLKK 75 I ++ L++ A DIC I+ D ++VSG ST+H+ ++ A + Y+KK Sbjct: 113 IDVLVSLLRQENAADICVIKVPEDIQY-ADYFIVVSGSSTRHLRAMALYAIKVYKYMKK 170 >gi|219124266|ref|XP_002182429.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] gi|217406390|gb|EEC46330.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] Length = 97 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + KA+DI + + S + +V++SG S +IA ++ ++++ Sbjct: 1 QAADGRKADDIVVLHVGN-VSTLTSFLVLLSGNSRPQNQAIAAAIVKDVQER 51 >gi|332298405|ref|YP_004440327.1| iojap-like protein [Treponema brennaborense DSM 12168] gi|332181508|gb|AEE17196.1| iojap-like protein [Treponema brennaborense DSM 12168] Length = 114 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 8/65 (12%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + +++ K +++ ++ + + D VIV+ S+ H + + Y Sbjct: 1 MKTVQEKALEIAQLMEDGKGQNVTVLDVSK-LNSWTDYFVIVTVTSSVHWKGLYKLVKDY 59 Query: 73 LKKKN 77 ++ + Sbjct: 60 VRDND 64 >gi|302528898|ref|ZP_07281240.1| conserved hypothetical protein [Streptomyces sp. AA4] gi|302437793|gb|EFL09609.1| conserved hypothetical protein [Streptomyces sp. AA4] Length = 135 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D+ ++ + +I D VI S + + V +I DN+ L+ Sbjct: 25 DVVVLDVSEQL-VITDAFVIASAANERQVGAIVDNVEEKLR 64 >gi|229824889|ref|ZP_04450958.1| hypothetical protein GCWU000182_00238 [Abiotrophia defectiva ATCC 49176] gi|229790892|gb|EEP27006.1| hypothetical protein GCWU000182_00238 [Abiotrophia defectiva ATCC 49176] Length = 118 Score = 49.7 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 26/63 (41%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 D++ + + L E A DI I+ + I + VI ++ + ++ + + Sbjct: 1 MDNILDAVRITCKALDEHLANDIKVIDIGH-LTTISEYFVIADAKNDNQMKALQEAVEES 59 Query: 73 LKK 75 L K Sbjct: 60 LGK 62 >gi|300788531|ref|YP_003768822.1| hypothetical protein AMED_6694 [Amycolatopsis mediterranei U32] gi|299798045|gb|ADJ48420.1| conserved hypothetical protein [Amycolatopsis mediterranei U32] Length = 131 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D+ ++ + +I D VI S + + V +I DN+ L++ Sbjct: 25 DVVVLDVSEQL-VITDAFVIASASNERLVGAIVDNVEEKLRE 65 >gi|169628712|ref|YP_001702361.1| hypothetical protein MAB_1622 [Mycobacterium abscessus ATCC 19977] gi|169240679|emb|CAM61707.1| Conserved hypothetical protein [Mycobacterium abscessus] Length = 137 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 11/42 (26%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D+ I+ + +I D VI S + + V +I D + L++ Sbjct: 25 DVVVIDVSEQL-VITDCFVIASASNERQVNAIVDQVEEVLRR 65 >gi|42783457|ref|NP_980704.1| iojap-related protein [Bacillus cereus ATCC 10987] gi|47569326|ref|ZP_00240010.1| iojap protein family [Bacillus cereus G9241] gi|49481389|ref|YP_038384.1| iojap-related protein [Bacillus thuringiensis serovar konkukian str. 97-27] gi|52141173|ref|YP_085655.1| iojap-related protein [Bacillus cereus E33L] gi|118479496|ref|YP_896647.1| iojap-related protein [Bacillus thuringiensis str. Al Hakam] gi|196034378|ref|ZP_03101787.1| iojap-related protein [Bacillus cereus W] gi|196039370|ref|ZP_03106676.1| iojap-like ribosome-associated protein [Bacillus cereus NVH0597-99] gi|196044909|ref|ZP_03112143.1| iojap-related protein [Bacillus cereus 03BB108] gi|206976090|ref|ZP_03237000.1| iojap-related protein [Bacillus cereus H3081.97] gi|217961820|ref|YP_002340390.1| iojap-related protein [Bacillus cereus AH187] gi|218905467|ref|YP_002453301.1| iojap-related protein [Bacillus cereus AH820] gi|222097775|ref|YP_002531832.1| iojap-related protein [Bacillus cereus Q1] gi|225866311|ref|YP_002751689.1| iojap-related protein [Bacillus cereus 03BB102] gi|254721921|ref|ZP_05183710.1| iojap-related protein [Bacillus anthracis str. A1055] gi|300118677|ref|ZP_07056405.1| iojap-related protein [Bacillus cereus SJ1] gi|301055822|ref|YP_003794033.1| iojap-related protein [Bacillus anthracis CI] gi|42739386|gb|AAS43312.1| iojap-related protein [Bacillus cereus ATCC 10987] gi|47553997|gb|EAL12364.1| iojap protein family [Bacillus cereus G9241] gi|49332945|gb|AAT63591.1| iojap-related protein [Bacillus thuringiensis serovar konkukian str. 97-27] gi|51974642|gb|AAU16192.1| iojap-related protein [Bacillus cereus E33L] gi|118418721|gb|ABK87140.1| iojap-related protein [Bacillus thuringiensis str. Al Hakam] gi|195992920|gb|EDX56879.1| iojap-related protein [Bacillus cereus W] gi|196024397|gb|EDX63070.1| iojap-related protein [Bacillus cereus 03BB108] gi|196029997|gb|EDX68598.1| iojap-like ribosome-associated protein [Bacillus cereus NVH0597-99] gi|206745842|gb|EDZ57239.1| iojap-related protein [Bacillus cereus H3081.97] gi|217063810|gb|ACJ78060.1| iojap-like ribosome-associated protein [Bacillus cereus AH187] gi|218539233|gb|ACK91631.1| iojap-related protein [Bacillus cereus AH820] gi|221241833|gb|ACM14543.1| iojap-related protein [Bacillus cereus Q1] gi|225788052|gb|ACO28269.1| iojap-like ribosome-associated protein [Bacillus cereus 03BB102] gi|298723926|gb|EFI64640.1| iojap-related protein [Bacillus cereus SJ1] gi|300377991|gb|ADK06895.1| iojap-related protein [Bacillus cereus biovar anthracis str. CI] gi|324328234|gb|ADY23494.1| iojap-related protein [Bacillus thuringiensis serovar finitimus YBT-020] Length = 118 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ + S I D +I G S K V +IA + + + Sbjct: 20 EDMVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 61 >gi|42527251|ref|NP_972349.1| hypothetical protein TDE1745 [Treponema denticola ATCC 35405] gi|41817675|gb|AAS12260.1| conserved hypothetical protein [Treponema denticola ATCC 35405] Length = 119 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + L++ K E++ ++ +++ D V+ + S H A + + +L + N Sbjct: 16 KLLRDFKGENVVVLDLRD-KNIWTDFFVVCTVTSAAHSAGLEKRVYEFLPEHN 67 >gi|325963627|ref|YP_004241533.1| iojap-related protein [Arthrobacter phenanthrenivorans Sphe3] gi|323469714|gb|ADX73399.1| iojap-related protein [Arthrobacter phenanthrenivorans Sphe3] Length = 133 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 +D+ ++ + + D +I S S + V +I D + L K++ Sbjct: 24 QDVVALDVSERL-ALADVFLIASAPSERQVNAIVDGIEEELAKQD 67 >gi|290992394|ref|XP_002678819.1| predicted protein [Naegleria gruberi] gi|284092433|gb|EFC46075.1| predicted protein [Naegleria gruberi] Length = 239 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 33/70 (47%), Gaps = 3/70 (4%) Query: 6 EKQALQTADHLDSCI--ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 + L T + + + V + L + D+ ++ T + + +V V+G S +H+ Sbjct: 95 DSFKLLTEEEVKRLLTIEEVCDLLDKNFGLDLVVMDLTE-KCSFAEYLVFVTGSSHRHMK 153 Query: 64 SIADNLISYL 73 ++A ++I L Sbjct: 154 TLAKSVIKEL 163 >gi|293192379|ref|ZP_06609490.1| iojap-like protein [Actinomyces odontolyticus F0309] gi|292820294|gb|EFF79288.1| iojap-like protein [Actinomyces odontolyticus F0309] Length = 141 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + V + + ++ TS + D V+VS + + V +IA+++ Sbjct: 1 MSLPDATAELASLVARAAHDRGGINPVLVDVTSKL-ALADAFVVVSAPTDRQVRAIAEDI 59 Query: 70 ISYL 73 + + Sbjct: 60 MDRI 63 >gi|147773104|emb|CAN71690.1| hypothetical protein VITISV_039292 [Vitis vinifera] Length = 200 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 + + + L ++KA+DI I CD MVI +GRST H Sbjct: 77 LQEIEQILSDVKADDIRVIPVRQH----CDFMVIATGRSTWHAK 116 >gi|327398453|ref|YP_004339322.1| iojap-like protein [Hippea maritima DSM 10411] gi|327181082|gb|AEA33263.1| iojap-like protein [Hippea maritima DSM 10411] Length = 106 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/53 (24%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 +++ L++ K EDI + ++S + D +I + S K V +I D + Sbjct: 1 MKEKLLKILEDKKVEDITVYDLR-MKSALFDFFIIGTVSSNKQVYAIFDEIKK 52 >gi|148926756|ref|ZP_01810436.1| hypothetical protein Cj8486_1447 [Campylobacter jejuni subsp. jejuni CG8486] gi|145845120|gb|EDK22216.1| hypothetical protein Cj8486_1447 [Campylobacter jejuni subsp. jejuni CG8486] Length = 125 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAE+I I+ + ++I + +H S+ D L + LK Sbjct: 18 MQERIDLIVKILDEKKAENIKTIDMSEQE-YFVKYVIIAATLGERHALSLIDELKTQLKA 76 Query: 76 K 76 K Sbjct: 77 K 77 >gi|257055299|ref|YP_003133131.1| iojap-like protein [Saccharomonospora viridis DSM 43017] gi|256585171|gb|ACU96304.1| iojap-related protein [Saccharomonospora viridis DSM 43017] Length = 135 Score = 49.3 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D+ I+ + +I D VI S + + V +I DN+ L+K Sbjct: 25 DVVLIDVSERL-VITDVFVIASAPNERQVGAIVDNIEEKLRK 65 >gi|325000182|ref|ZP_08121294.1| hypothetical protein PseP1_15508 [Pseudonocardia sp. P1] Length = 134 Score = 48.9 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 8/42 (19%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++ + +I D V+ S ++ + V +I + + L+++ Sbjct: 26 IVALDVSDQL-VITDCFVLASAQNERQVQAIVEAVEEKLRER 66 >gi|309789875|ref|ZP_07684453.1| iojap-like protein [Oscillochloris trichoides DG6] gi|308228082|gb|EFO81732.1| iojap-like protein [Oscillochloris trichoides DG6] Length = 92 Score = 48.9 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Query: 38 IENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ S +S I D VI SG + + + +I D++ + ++++ Sbjct: 3 LDIRS-QSTIADYFVICSGDNERQLRAIVDHVDAQIQRQ 40 >gi|47225503|emb|CAG11986.1| unnamed protein product [Tetraodon nigroviridis] Length = 107 Score = 48.9 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI---ADNLISYLKKK 76 + ++ L++ A DIC I+ D V+VSG ST+H+ ++ A + YLKK+ Sbjct: 3 LDVLVSLLRQENAVDICVIKIPENIQY-ADYFVVVSGISTRHLRAMALYATKVYKYLKKE 61 >gi|167535093|ref|XP_001749221.1| hypothetical protein [Monosiga brevicollis MX1] gi|163772374|gb|EDQ86027.1| predicted protein [Monosiga brevicollis MX1] Length = 290 Score = 48.9 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 26/48 (54%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIAD 67 + V+ ++K +DI +E R D +VIVS RS +H+ ++A Sbjct: 154 VEDVVRSALDMKGDDIFVLEVGGRRREDYDFLVIVSARSKRHLRALAQ 201 >gi|118474789|ref|YP_892570.1| putative iojap-like protein [Campylobacter fetus subsp. fetus 82-40] gi|118414015|gb|ABK82435.1| putative iojap homolog [Campylobacter fetus subsp. fetus 82-40] Length = 105 Score = 48.9 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I + L E KAE+I I+ + + + ++I + + +H ++ D+L + LK Sbjct: 1 MQDRIEKITRLLDEKKAENIEIIDMQN-KDYLAKFVIIATTLTGRHTYALLDDLKTELK 58 >gi|196001103|ref|XP_002110419.1| hypothetical protein TRIADDRAFT_54395 [Trichoplax adhaerens] gi|190586370|gb|EDV26423.1| hypothetical protein TRIADDRAFT_54395 [Trichoplax adhaerens] Length = 216 Score = 48.9 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 +A V + L++ + +D+C I + + D++VI SG ST+H+ +A +L S + K+ Sbjct: 90 VAQVTDLLRQERGKDVCAINISPEYCYV-DHIVICSGSSTRHLRGMATSLKSQFRGKH 146 >gi|297571623|ref|YP_003697397.1| iojap-like protein [Arcanobacterium haemolyticum DSM 20595] gi|296931970|gb|ADH92778.1| iojap-like protein [Arcanobacterium haemolyticum DSM 20595] Length = 155 Score = 48.9 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 12/66 (18%), Positives = 25/66 (37%), Gaps = 1/66 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + ++KA I I+ + D ++VSG + + V +I D++ Sbjct: 1 MSATQEAIDLTIIAARAAADVKATSITAIDVAERL-ALTDTFLVVSGSTERQVRAIVDSV 59 Query: 70 ISYLKK 75 + K Sbjct: 60 EESMYK 65 >gi|57238442|ref|YP_179573.1| hypothetical protein CJE1592 [Campylobacter jejuni RM1221] gi|57167246|gb|AAW36025.1| conserved hypothetical protein [Campylobacter jejuni RM1221] gi|315058874|gb|ADT73203.1| Iojap-related protein [Campylobacter jejuni subsp. jejuni S3] Length = 108 Score = 48.9 bits (116), Expect = 3e-04, Method: Composition-based stats. Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L E KAE+I I+ + ++I + KH S+ D L + LK Sbjct: 1 MQERIDLIVKILDEKKAENIKTIDMSEQE-YFVKYVIIAATLGEKHALSLIDELKTRLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|163942086|ref|YP_001646970.1| iojap-like protein [Bacillus weihenstephanensis KBAB4] gi|163864283|gb|ABY45342.1| iojap-like protein [Bacillus weihenstephanensis KBAB4] Length = 118 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ED+ + S I D +I G S K V +IA + + + Sbjct: 20 EDMVVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 61 >gi|212715906|ref|ZP_03324034.1| hypothetical protein BIFCAT_00815 [Bifidobacterium catenulatum DSM 16992] gi|212661273|gb|EEB21848.1| hypothetical protein BIFCAT_00815 [Bifidobacterium catenulatum DSM 16992] Length = 140 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA D+ + T I D M+I + + + V S+A+ + L Sbjct: 26 MKATDLVAFDVTEPL-AITDAMLIATASNERQVLSVAEEIEKDL 68 >gi|261885391|ref|ZP_06009430.1| putative iojap-like protein [Campylobacter fetus subsp. venerealis str. Azul-94] Length = 105 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I + L E KAE+I I+ + + + ++I + + +H ++ D+L + LK Sbjct: 5 IEKITRLLDEKKAENIEIIDMQN-KDYLAKFVIIATTLTGRHAYALLDDLKTELK 58 >gi|284990143|ref|YP_003408697.1| iojap-like protein [Geodermatophilus obscurus DSM 43160] gi|284063388|gb|ADB74326.1| iojap-like protein [Geodermatophilus obscurus DSM 43160] Length = 191 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ ++ + I D V+ S + + V +I D + L++ Sbjct: 25 NVAIVDVSERL-AITDAFVLASAPNERQVQAIVDEVEERLRQH 66 >gi|332638517|ref|ZP_08417380.1| Iojap family protein [Weissella cibaria KACC 11862] Length = 123 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 9/63 (14%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++ + ++ + +AE++ ++ SL+ D +I+ + + V +I D + Sbjct: 2 ENKVNEMLEVAVKAADQKRAENLMALDI-HEISLVADAYLILDAPTQRQVLAIVDEIEDK 60 Query: 73 LKK 75 + + Sbjct: 61 MAE 63 >gi|296140501|ref|YP_003647744.1| iojap-like protein [Tsukamurella paurometabola DSM 20162] gi|296028635|gb|ADG79405.1| iojap-like protein [Tsukamurella paurometabola DSM 20162] Length = 135 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 7/42 (16%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 D+ ++ + ++ + VI S + + V +I + + L++ Sbjct: 25 DVVVLDVSEQL-VLTEAFVIASASNERQVNAIVEEVEDKLRE 65 >gi|315639233|ref|ZP_07894395.1| Iojap family protein [Campylobacter upsaliensis JV21] gi|315480559|gb|EFU71201.1| Iojap family protein [Campylobacter upsaliensis JV21] Length = 106 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I + + L E KAEDI + ++I + KH S+ D L + LK Sbjct: 1 MQERITAITQILDEKKAEDIEIFDMRGGE-YFVSFVIIATTLGEKHALSLIDELKTKLK 58 >gi|291243297|ref|XP_002741539.1| PREDICTED: 312-like [Saccoglossus kowalevskii] Length = 307 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++E L+E +DIC IE + + D VIVS +S +H+ + + K+K Sbjct: 155 IDELVEILREENTQDICVIEVPKHKQYV-DYFVIVSCQSVRHLQATTQYINQMYKQK 210 >gi|152993782|ref|YP_001359503.1| hypothetical protein SUN_2206 [Sulfurovum sp. NBC37-1] gi|151425643|dbj|BAF73146.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1] Length = 115 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I +++ L E KAE+I I + ++I + + KH ++ ++L LK Sbjct: 2 TTEERIDNIVKVLDEKKAEEIEVFNL-EDADYIANYVIIANSLNPKHTIALFEHLKKDLK 60 >gi|306822673|ref|ZP_07456051.1| iojap-like protein [Bifidobacterium dentium ATCC 27679] gi|309800853|ref|ZP_07694985.1| iojap-like protein [Bifidobacterium dentium JCVIHMP022] gi|304554218|gb|EFM42127.1| iojap-like protein [Bifidobacterium dentium ATCC 27679] gi|308222389|gb|EFO78669.1| iojap-like protein [Bifidobacterium dentium JCVIHMP022] Length = 139 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA DI + T I D M+I + + V ++A+ + L Sbjct: 26 MKATDIVAFDVTEPL-AITDLMMIAGASNERQVLAVAEEIEKDL 68 >gi|221632936|ref|YP_002522159.1| hypothetical protein trd_0942 [Thermomicrobium roseum DSM 5159] gi|221156303|gb|ACM05430.1| Domain of unknown function DUF143 superfamily [Thermomicrobium roseum DSM 5159] Length = 123 Score = 48.5 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 8/42 (19%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 DI ++ T + D V+ + +T+ + ++ +L L + Sbjct: 30 DIQVLDLTR-FTPFFDLFVVCTADNTRQLRALVTHLSEALDE 70 >gi|57505270|ref|ZP_00371199.1| iojap-related protein [Campylobacter upsaliensis RM3195] gi|57016406|gb|EAL53191.1| iojap-related protein [Campylobacter upsaliensis RM3195] Length = 106 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + I + + L E KAEDI + ++I + KH S+ D L + LK Sbjct: 1 MQERITAITQILDEKKAEDIEIFDMRGGE-YFVSFVIIATTLGEKHALSLIDELKTKLK 58 >gi|68535640|ref|YP_250345.1| hypothetical protein jk0568 [Corynebacterium jeikeium K411] gi|260578290|ref|ZP_05846206.1| iojap-related protein [Corynebacterium jeikeium ATCC 43734] gi|68263239|emb|CAI36727.1| hypothetical protein jk0568 [Corynebacterium jeikeium K411] gi|258603592|gb|EEW16853.1| iojap-related protein [Corynebacterium jeikeium ATCC 43734] Length = 157 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 E EDI ++ + I D VIVSG + + V SI D + + Sbjct: 20 EKLGEDILVLDVSDRL-AITDVFVIVSGDNERMVNSIVDEVEYEV 63 >gi|239917529|ref|YP_002957087.1| iojap-related protein [Micrococcus luteus NCTC 2665] gi|281413986|ref|ZP_06245728.1| iojap-related protein [Micrococcus luteus NCTC 2665] gi|289704619|ref|ZP_06501049.1| iojap-like ribosome-associated protein [Micrococcus luteus SK58] gi|239838736|gb|ACS30533.1| iojap-related protein [Micrococcus luteus NCTC 2665] gi|289558652|gb|EFD51913.1| iojap-like ribosome-associated protein [Micrococcus luteus SK58] Length = 141 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 18/48 (37%), Gaps = 2/48 (4%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY-LKKK 76 I + + D +I SG S + V +I D + LK + Sbjct: 21 KLGTHIVAFDVAERLG-LTDAFLIASGASERQVNAIVDGVEEALLKDE 67 >gi|154482895|ref|ZP_02025343.1| hypothetical protein EUBVEN_00592 [Eubacterium ventriosum ATCC 27560] gi|149736179|gb|EDM52065.1| hypothetical protein EUBVEN_00592 [Eubacterium ventriosum ATCC 27560] Length = 115 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 13/61 (21%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L + K + I + S S+I D +I G + V ++A N+ Sbjct: 2 TSKELAKIAYNALDDKKGVN-ITIIDISEISIIADYFIIAGGTNENQVKALAGNVEDEFA 60 Query: 75 K 75 K Sbjct: 61 K 61 >gi|223038892|ref|ZP_03609184.1| putative iojap homolog [Campylobacter rectus RM3267] gi|222879865|gb|EEF14954.1| putative iojap homolog [Campylobacter rectus RM3267] Length = 108 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L KAE I I+ S R I ++I + +H S+ D+L LK Sbjct: 1 MQERIERIIKILDAKKAEAIEAIDM-SGREYIAKCVIIATTMGERHAYSLTDDLKEGLKD 59 >gi|154508992|ref|ZP_02044634.1| hypothetical protein ACTODO_01509 [Actinomyces odontolyticus ATCC 17982] gi|153798626|gb|EDN81046.1| hypothetical protein ACTODO_01509 [Actinomyces odontolyticus ATCC 17982] Length = 141 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + V + + ++ TS + D V+VS + + V +IA+++ Sbjct: 1 MSLPDATAELASLVARTAHDRGGINPVLVDVTSKL-ALADAFVVVSAPTDRQVRAIAEDI 59 Query: 70 ISYL 73 + + Sbjct: 60 MDRI 63 >gi|227494692|ref|ZP_03925008.1| Iojap family protein [Actinomyces coleocanis DSM 15436] gi|226831874|gb|EEH64257.1| Iojap family protein [Actinomyces coleocanis DSM 15436] Length = 121 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 10/64 (15%), Positives = 24/64 (37%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + + + + +E T D ++VS S + V +IA+ + Sbjct: 1 MAISAQAREILDIAVAASEAKLGINPVALEVTDRM-PFTDVFLVVSAESPRQVNAIANEI 59 Query: 70 ISYL 73 + L Sbjct: 60 VDEL 63 >gi|300859000|ref|YP_003783983.1| hypothetical protein cpfrc_01583 [Corynebacterium pseudotuberculosis FRC41] gi|300686454|gb|ADK29376.1| hypothetical protein cpfrc_01583 [Corynebacterium pseudotuberculosis FRC41] gi|302206698|gb|ADL11040.1| Putative iojap-like protein [Corynebacterium pseudotuberculosis C231] gi|302331251|gb|ADL21445.1| Putative protein yqeL [Corynebacterium pseudotuberculosis 1002] Length = 155 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 10/64 (15%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + E +A +I I+ + + I + V+ S + + V +I + + Sbjct: 1 MTATQDIIRLASLAARAADEKQATNIAVIDVSDVM-AISEIFVLASADNERQVRAIVEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EDVL 63 >gi|319955943|ref|YP_004167206.1| iojap-like protein [Nitratifractor salsuginis DSM 16511] gi|319418347|gb|ADV45457.1| iojap-like protein [Nitratifractor salsuginis DSM 16511] Length = 113 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 13/62 (20%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L + ++ L KAE+I + + I +++ + KH ++ DN+ LK Sbjct: 2 TLQERVDRIVNLLDSKKAEEIEVFDLGN-VDYIAKQVILANSLGGKHTQALFDNMKEELK 60 Query: 75 KK 76 + Sbjct: 61 PQ 62 >gi|254774567|ref|ZP_05216083.1| hypothetical protein MaviaA2_07838 [Mycobacterium avium subsp. avium ATCC 25291] Length = 131 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ ++ I VI S + + V +I D + ++K Sbjct: 24 DDVVVIDVSAQL-AITGCFVIASASNERQVNAIVDEVEEKMRK 65 >gi|256825004|ref|YP_003148964.1| iojap-related protein [Kytococcus sedentarius DSM 20547] gi|256688397|gb|ACV06199.1| iojap-related protein [Kytococcus sedentarius DSM 20547] Length = 151 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 9/64 (14%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + T + A+DI ++ + + D +I S + + V ++ D + Sbjct: 1 MTATPEAIDLARTAARAADDKFADDIVALDVSQHL-ALTDIFLIASAPTERQVHAVVDAV 59 Query: 70 ISYL 73 Sbjct: 60 TDAC 63 >gi|57168945|ref|ZP_00368074.1| iojap-related protein [Campylobacter coli RM2228] gi|57019611|gb|EAL56300.1| iojap-related protein [Campylobacter coli RM2228] Length = 108 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +++ L E KAEDI + + + ++I + KH S+ D L + LK Sbjct: 1 MQERVDLIVKILDEKKAEDIKTFDMSE-QDYFVKYVIIAATLGEKHALSLIDELKTKLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|317013180|gb|ADU83788.1| iojap-related protein [Helicobacter pylori Lithuania75] Length = 113 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + + ++I + + KH S+ + L + LK Sbjct: 1 MNQRIETITALLDEKKAFDITHIDLSKTP-YLVEYVIIATTLANKHALSLLNALKNTLK 58 >gi|227503082|ref|ZP_03933131.1| iojap family protein [Corynebacterium accolens ATCC 49725] gi|227076143|gb|EEI14106.1| iojap family protein [Corynebacterium accolens ATCC 49725] Length = 147 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ A +I I+ + + I + V+ S + + V SI D + + Sbjct: 10 QDKLASNIAAIDVSDVL-AITEVFVLASADNERQVGSIVDEVEDQM 54 >gi|189485383|ref|YP_001956324.1| hypothetical protein TGRD_380 [uncultured Termite group 1 bacterium phylotype Rs-D17] gi|170287342|dbj|BAG13863.1| conserved hypothetical protein [uncultured Termite group 1 bacterium phylotype Rs-D17] Length = 150 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 11/59 (18%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 E KA D ++ + I + VI + ST + +I+ + K+++ Sbjct: 9 LAEKAAEIADNKKAIDTIILDIR-GVTAIANYFVITTALSTPQINAISIGIEKIFKEQD 66 >gi|37520356|ref|NP_923733.1| hypothetical protein gsl0787 [Gloeobacter violaceus PCC 7421] gi|35211349|dbj|BAC88728.1| gsl0787 [Gloeobacter violaceus PCC 7421] Length = 93 Score = 47.8 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 8/33 (24%), Positives = 17/33 (51%) Query: 44 RSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +++ D VI +G S V +I + + +K + Sbjct: 1 MTILADYFVIATGNSRAQVRAIGNAVEEKIKTE 33 >gi|327274867|ref|XP_003222197.1| PREDICTED: uncharacterized protein C7orf30-like [Anolis carolinensis] Length = 145 Score = 47.8 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L++ A+DIC I+ + VIVSG S +H+ ++A L+ K Sbjct: 11 EDIVSFLRQENAKDICAIQLPPEMKY-SNYFVIVSGSSPRHLHAMAHYLMKMYK 63 >gi|257865896|ref|ZP_05645549.1| conserved hypothetical protein [Enterococcus casseliflavus EC30] gi|257872229|ref|ZP_05651882.1| conserved hypothetical protein [Enterococcus casseliflavus EC10] gi|257875523|ref|ZP_05655176.1| conserved hypothetical protein [Enterococcus casseliflavus EC20] gi|257799830|gb|EEV28882.1| conserved hypothetical protein [Enterococcus casseliflavus EC30] gi|257806393|gb|EEV35215.1| conserved hypothetical protein [Enterococcus casseliflavus EC10] gi|257809689|gb|EEV38509.1| conserved hypothetical protein [Enterococcus casseliflavus EC20] Length = 96 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++ + SL+ D VI SG S + + +I D +I +++N Sbjct: 2 ALDVREI-SLLADYFVICSGNSERQINAIIDEVIDK-EEEN 40 >gi|296271960|ref|YP_003654591.1| iojap-like protein [Arcobacter nitrofigilis DSM 7299] gi|296096135|gb|ADG92085.1| iojap-like protein [Arcobacter nitrofigilis DSM 7299] Length = 108 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 T+++ L++ KA ++ I + I D +VI + + KH ++ + L LK Sbjct: 5 ETIVKVLEDKKAVNVEVINLQD-KDYIVDFVVIATTLNAKHGFALLNYLKEELK 57 >gi|331695847|ref|YP_004332086.1| iojap-like protein [Pseudonocardia dioxanivorans CB1190] gi|326950536|gb|AEA24233.1| iojap-like protein [Pseudonocardia dioxanivorans CB1190] Length = 140 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 9/42 (21%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++ + +I D V+ S + + V++I D + L++ Sbjct: 26 ILVLDVSEQL-VITDCFVLASAPNERQVSAIVDGIEEKLREH 66 >gi|311064500|ref|YP_003971225.1| Iojap protein family [Bifidobacterium bifidum PRL2010] gi|313140372|ref|ZP_07802565.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] gi|310866819|gb|ADP36188.1| Iojap protein family [Bifidobacterium bifidum PRL2010] gi|313132882|gb|EFR50499.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] Length = 135 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA DI + ++L I D M++ + + + V +A+ + + Sbjct: 2 RVAAVAADRMKAADIEAFDVSNLL-AITDIMMVATAMNERQVIGVAEEVEKDV 53 >gi|257869180|ref|ZP_05648833.1| conserved hypothetical protein [Enterococcus gallinarum EG2] gi|257803344|gb|EEV32166.1| conserved hypothetical protein [Enterococcus gallinarum EG2] Length = 96 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 11/41 (26%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 ++ + SL+ D VI SG S + + +I D ++ +++N Sbjct: 2 ALDVREI-SLLADYFVICSGNSDRQINAIIDEVLDK-EEEN 40 >gi|283456116|ref|YP_003360680.1| iojap protein family [Bifidobacterium dentium Bd1] gi|283102750|gb|ADB09856.1| iojap protein family [Bifidobacterium dentium Bd1] Length = 134 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA DI + T I D M+I + + V ++A+ + L Sbjct: 21 MKATDIVAFDVTEPL-AITDLMMIAGASNERQVLAVAEEIEKDL 63 >gi|171742854|ref|ZP_02918661.1| hypothetical protein BIFDEN_01969 [Bifidobacterium dentium ATCC 27678] gi|171278468|gb|EDT46129.1| hypothetical protein BIFDEN_01969 [Bifidobacterium dentium ATCC 27678] Length = 139 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA DI + T I D M+I + + V ++A+ + L Sbjct: 26 MKATDIVAFDVTEPL-AITDLMMIAGASNERQVLAVAEEIEKDL 68 >gi|154149188|ref|YP_001406350.1| putative nicotinate (nicotinamide) nucleotide adenylyltransferase [Campylobacter hominis ATCC BAA-381] gi|153805197|gb|ABS52204.1| putative nicotinate (nicotinamide) nucleotide adenylyltransferase [Campylobacter hominis ATCC BAA-381] Length = 295 Score = 47.4 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + + L++ KAE++ I+ ++ R I +VI + + KH ++ + L + LK N Sbjct: 187 ERAERIAKILEDKKAENVEIIDMSN-RDYIAKFVVIATTLAAKHGETLIEELKTELKPFN 245 >gi|302338323|ref|YP_003803529.1| Iojap-related protein [Spirochaeta smaragdinae DSM 11293] gi|301635508|gb|ADK80935.1| Iojap-related protein [Spirochaeta smaragdinae DSM 11293] Length = 112 Score = 47.4 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Query: 19 CIATVMECLKEL---KAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + +E+ K E+ I+ T +S D +I + S H+ + N+ L + Sbjct: 1 MKRAALALAEEISSHKGENTVLIDLT-GKSSWTDYFLISTVNSLGHLKGMVRNVKERLAE 59 >gi|225352029|ref|ZP_03743052.1| hypothetical protein BIFPSEUDO_03636 [Bifidobacterium pseudocatenulatum DSM 20438] gi|225157276|gb|EEG70615.1| hypothetical protein BIFPSEUDO_03636 [Bifidobacterium pseudocatenulatum DSM 20438] Length = 140 Score = 47.4 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA D+ + T I D M++ + + + V ++A+ + L Sbjct: 26 MKATDLVAFDVTEPL-AITDAMLVATASNERQVLAVAEEIEKDL 68 >gi|261414872|ref|YP_003248555.1| Iojap-related protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|261371328|gb|ACX74073.1| Iojap-related protein [Fibrobacter succinogenes subsp. succinogenes S85] gi|302326440|gb|ADL25641.1| iojap-like protein [Fibrobacter succinogenes subsp. succinogenes S85] Length = 139 Score = 47.4 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLI 70 + L EL+A+++ I+ +++ D +I + S + +I + L Sbjct: 4 TNNQDFSETVKLGAGILFELRAQNVQLIDLRGVKNE-ADYFLIATCESEAQMQAILNELT 62 Query: 71 SYLK 74 K Sbjct: 63 KEFK 66 >gi|306836683|ref|ZP_07469647.1| Iojap family protein [Corynebacterium accolens ATCC 49726] gi|304567422|gb|EFM43023.1| Iojap family protein [Corynebacterium accolens ATCC 49726] Length = 156 Score = 47.4 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 10/46 (21%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Query: 28 KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ++ A +I I+ + + I + V+ S + + V SI D + + Sbjct: 19 QDKLASNIAAIDVSDVL-AITEVFVLASADNERQVGSIVDEVEDQM 63 >gi|255627563|gb|ACU14126.1| unknown [Glycine max] Length = 240 Score = 47.4 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 15/74 (20%), Positives = 27/74 (36%), Gaps = 4/74 (5%) Query: 6 EKQALQTADHLDSCIATVMECL---KELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 +K A D ++ +E E+KA DI + L +I + S + Sbjct: 108 KKPASAEIDDDAESLSFAVELATVASEVKAGDIKVLFVKPLV-YWTRFFIIATAFSRPQI 166 Query: 63 ASIADNLISYLKKK 76 +I + +KK Sbjct: 167 DAIGSRIRDRAEKK 180 >gi|269794471|ref|YP_003313926.1| iojap-like protein [Sanguibacter keddieii DSM 10542] gi|269096656|gb|ACZ21092.1| iojap-related protein [Sanguibacter keddieii DSM 10542] Length = 148 Score = 47.0 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +I ++ + ++ D +I SG + + V++I D + L Sbjct: 25 EIIALDVSEQL-VLTDVFLIASGNNERQVSAIVDAVEEAL 63 >gi|183983728|ref|YP_001852019.1| hypothetical protein MMAR_3748 [Mycobacterium marinum M] gi|183177054|gb|ACC42164.1| conserved hypothetical protein [Mycobacterium marinum M] Length = 129 Score = 47.0 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 11/43 (25%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 +D+ I+ S + +I D VI S + + V +I D + +++ Sbjct: 24 DDVLVIDV-SGQLVITDCFVIASASNERQVNAIVDEVEEKMRR 65 >gi|108804358|ref|YP_644295.1| Iojap-like protein [Rubrobacter xylanophilus DSM 9941] gi|108765601|gb|ABG04483.1| Iojap-related protein [Rubrobacter xylanophilus DSM 9941] Length = 131 Score = 47.0 bits (111), Expect = 9e-04, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Query: 32 AEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + I+ L S D V+ S + + IA+ +I + +K Sbjct: 36 GRETTLIDLRGLVSY-ADYFVVTSAETDRQTRRIAEEVIDRMAEK 79 >gi|325569906|ref|ZP_08145900.1| Iojap protein [Enterococcus casseliflavus ATCC 12755] gi|325157029|gb|EGC69197.1| Iojap protein [Enterococcus casseliflavus ATCC 12755] Length = 96 Score = 47.0 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 ++ + SL+ D VI SG S + + +I D +I Sbjct: 2 ALDVREI-SLLADYFVICSGNSERQINAIIDEVIDK 36 >gi|255544700|ref|XP_002513411.1| Protein Iojap, putative [Ricinus communis] gi|223547319|gb|EEF48814.1| Protein Iojap, putative [Ricinus communis] Length = 222 Score = 47.0 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 11/53 (20%), Positives = 21/53 (39%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++KA DI + L +I + S + +IA + +KK Sbjct: 124 AKVASDVKAGDIRVLFVKPLV-YWTRFFIIATAFSRPQIDAIASRIRDLAEKK 175 >gi|317124541|ref|YP_004098653.1| iojap-like protein [Intrasporangium calvum DSM 43043] gi|315588629|gb|ADU47926.1| iojap-like protein [Intrasporangium calvum DSM 43043] Length = 147 Score = 47.0 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I+ + + D VI S S + + +I D + L++ Sbjct: 26 VTAIDVSDQM-PLTDVFVIASAPSERQIGAIVDEVEDRLRE 65 >gi|228993073|ref|ZP_04152996.1| YqeL (Iojap-related protein) [Bacillus pseudomycoides DSM 12442] gi|228766721|gb|EEM15361.1| YqeL (Iojap-related protein) [Bacillus pseudomycoides DSM 12442] Length = 96 Score = 47.0 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Query: 36 CHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + S I D +I G S K V +IA + + + Sbjct: 2 VVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 40 >gi|229013551|ref|ZP_04170684.1| YqeL (Iojap-related protein) [Bacillus mycoides DSM 2048] gi|229019555|ref|ZP_04176371.1| YqeL (Iojap-related protein) [Bacillus cereus AH1273] gi|229025796|ref|ZP_04182195.1| YqeL (Iojap-related protein) [Bacillus cereus AH1272] gi|229062029|ref|ZP_04199354.1| YqeL (Iojap-related protein) [Bacillus cereus AH603] gi|229135156|ref|ZP_04263956.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-ST196] gi|228648284|gb|EEL04319.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-ST196] gi|228717181|gb|EEL68856.1| YqeL (Iojap-related protein) [Bacillus cereus AH603] gi|228735504|gb|EEL86100.1| YqeL (Iojap-related protein) [Bacillus cereus AH1272] gi|228741721|gb|EEL91905.1| YqeL (Iojap-related protein) [Bacillus cereus AH1273] gi|228747711|gb|EEL97581.1| YqeL (Iojap-related protein) [Bacillus mycoides DSM 2048] Length = 97 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Query: 36 CHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + S I D +I G S K V +IA + + + Sbjct: 2 VVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 40 >gi|228902856|ref|ZP_04066999.1| YqeL (Iojap-related protein) [Bacillus thuringiensis IBL 4222] gi|228910167|ref|ZP_04073986.1| YqeL (Iojap-related protein) [Bacillus thuringiensis IBL 200] gi|228923083|ref|ZP_04086375.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228954617|ref|ZP_04116641.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228960600|ref|ZP_04122247.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar pakistani str. T13001] gi|228967397|ref|ZP_04128430.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar sotto str. T04001] gi|229048037|ref|ZP_04193612.1| YqeL (Iojap-related protein) [Bacillus cereus AH676] gi|229071837|ref|ZP_04205050.1| YqeL (Iojap-related protein) [Bacillus cereus F65185] gi|229081594|ref|ZP_04214090.1| YqeL (Iojap-related protein) [Bacillus cereus Rock4-2] gi|229111804|ref|ZP_04241350.1| YqeL (Iojap-related protein) [Bacillus cereus Rock1-15] gi|229129611|ref|ZP_04258579.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-Cer4] gi|229146902|ref|ZP_04275266.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-ST24] gi|229152534|ref|ZP_04280724.1| YqeL (Iojap-related protein) [Bacillus cereus m1550] gi|229180608|ref|ZP_04307949.1| YqeL (Iojap-related protein) [Bacillus cereus 172560W] gi|229192543|ref|ZP_04319504.1| YqeL (Iojap-related protein) [Bacillus cereus ATCC 10876] gi|228590850|gb|EEK48708.1| YqeL (Iojap-related protein) [Bacillus cereus ATCC 10876] gi|228602851|gb|EEK60331.1| YqeL (Iojap-related protein) [Bacillus cereus 172560W] gi|228630900|gb|EEK87539.1| YqeL (Iojap-related protein) [Bacillus cereus m1550] gi|228636501|gb|EEK92967.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-ST24] gi|228653728|gb|EEL09598.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-Cer4] gi|228671560|gb|EEL26858.1| YqeL (Iojap-related protein) [Bacillus cereus Rock1-15] gi|228701700|gb|EEL54190.1| YqeL (Iojap-related protein) [Bacillus cereus Rock4-2] gi|228711267|gb|EEL63229.1| YqeL (Iojap-related protein) [Bacillus cereus F65185] gi|228723281|gb|EEL74651.1| YqeL (Iojap-related protein) [Bacillus cereus AH676] gi|228792285|gb|EEM39854.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar sotto str. T04001] gi|228799079|gb|EEM46049.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar pakistani str. T13001] gi|228805063|gb|EEM51658.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar kurstaki str. T03a001] gi|228836581|gb|EEM81930.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar huazhongensis BGSC 4BD1] gi|228849450|gb|EEM94285.1| YqeL (Iojap-related protein) [Bacillus thuringiensis IBL 200] gi|228856780|gb|EEN01297.1| YqeL (Iojap-related protein) [Bacillus thuringiensis IBL 4222] Length = 92 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D +I G S K V +IA + S + Sbjct: 2 QGISPIADYFIICHGNSDKQVQAIAREIKSKAHE 35 >gi|228916962|ref|ZP_04080523.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] gi|228929375|ref|ZP_04092398.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228935651|ref|ZP_04098465.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228948044|ref|ZP_04110329.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228987583|ref|ZP_04147699.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|229093400|ref|ZP_04224505.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-42] gi|229123869|ref|ZP_04253062.1| YqeL (Iojap-related protein) [Bacillus cereus 95/8201] gi|229141068|ref|ZP_04269610.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-ST26] gi|229157945|ref|ZP_04286017.1| YqeL (Iojap-related protein) [Bacillus cereus ATCC 4342] gi|229186570|ref|ZP_04313731.1| YqeL (Iojap-related protein) [Bacillus cereus BGSC 6E1] gi|229198458|ref|ZP_04325162.1| YqeL (Iojap-related protein) [Bacillus cereus m1293] gi|228584961|gb|EEK43075.1| YqeL (Iojap-related protein) [Bacillus cereus m1293] gi|228596829|gb|EEK54488.1| YqeL (Iojap-related protein) [Bacillus cereus BGSC 6E1] gi|228625505|gb|EEK82260.1| YqeL (Iojap-related protein) [Bacillus cereus ATCC 4342] gi|228642346|gb|EEK98635.1| YqeL (Iojap-related protein) [Bacillus cereus BDRD-ST26] gi|228659583|gb|EEL15230.1| YqeL (Iojap-related protein) [Bacillus cereus 95/8201] gi|228689994|gb|EEL43797.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-42] gi|228772124|gb|EEM20574.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1] gi|228811630|gb|EEM57966.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar monterrey BGSC 4AJ1] gi|228824011|gb|EEM69829.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar andalousiensis BGSC 4AW1] gi|228830281|gb|EEM75895.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar pondicheriensis BGSC 4BA1] gi|228842683|gb|EEM87770.1| YqeL (Iojap-related protein) [Bacillus thuringiensis serovar pulsiensis BGSC 4CC1] Length = 92 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D +I G S K V +IA + + + Sbjct: 2 QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 35 >gi|305431540|ref|ZP_07400714.1| iojap-like protein [Campylobacter coli JV20] gi|304445347|gb|EFM37986.1| iojap-like protein [Campylobacter coli JV20] Length = 108 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + +++ L E KAEDI + + + ++I + KH S+ D L LK Sbjct: 1 MQERVDLIVKILDEKKAEDIKTFDMSE-QDYFVKYVIIAATLGEKHALSLIDELKIKLKA 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|229076005|ref|ZP_04208978.1| YqeL (Iojap-related protein) [Bacillus cereus Rock4-18] gi|229098802|ref|ZP_04229740.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-29] gi|229104962|ref|ZP_04235618.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-28] gi|229117828|ref|ZP_04247192.1| YqeL (Iojap-related protein) [Bacillus cereus Rock1-3] gi|228665625|gb|EEL21103.1| YqeL (Iojap-related protein) [Bacillus cereus Rock1-3] gi|228678456|gb|EEL32677.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-28] gi|228684646|gb|EEL38586.1| YqeL (Iojap-related protein) [Bacillus cereus Rock3-29] gi|228707117|gb|EEL59317.1| YqeL (Iojap-related protein) [Bacillus cereus Rock4-18] Length = 97 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Query: 36 CHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + S I D +I G S K V +IA + + + Sbjct: 2 VVLNM-QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 40 >gi|32265849|ref|NP_859881.1| hypothetical protein HH0350 [Helicobacter hepaticus ATCC 51449] gi|32261898|gb|AAP76947.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449] Length = 113 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query: 14 DHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 H++ I + L + K EDI + + I D ++IVS KH ++ D L S L Sbjct: 4 KHINERIERITTLLADKKGEDIEVFDLCD-KDYIVDKVIIVSAMIGKHSFALLDYLKSEL 62 Query: 74 KKK 76 K + Sbjct: 63 KPQ 65 >gi|289522888|ref|ZP_06439742.1| iojap-like protein [Anaerobaculum hydrogeniformans ATCC BAA-1850] gi|289503912|gb|EFD25076.1| iojap-like protein [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length = 130 Score = 46.6 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Query: 23 VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + + L KA+DI I+ + S D I + S H+ ++ D + L ++ Sbjct: 17 IAKVLASKKAQDIISIDISE-VSGFADIFFISNSNSESHMKALLDVITDALDER 69 >gi|255018281|ref|ZP_05290407.1| iojap-related protein [Listeria monocytogenes FSL F2-515] Length = 97 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 10/40 (25%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ S D VI G S K V +IA + + Sbjct: 3 ALDM-KGLSSFADYFVICHGNSDKQVQAIAREIKEKALEN 41 >gi|154249042|ref|YP_001409867.1| iojap-like protein [Fervidobacterium nodosum Rt17-B1] gi|154152978|gb|ABS60210.1| iojap-like protein [Fervidobacterium nodosum Rt17-B1] Length = 103 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 11/52 (21%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ L++ +A + ++ + R L+ D VI + S H+ S+ D ++ + + Sbjct: 2 IKLLEKKEAIEPVVLDMSKTR-LLTDYFVICTANSNIHMKSLRDEIVDFFNE 52 >gi|149182752|ref|ZP_01861216.1| YqeL [Bacillus sp. SG-1] gi|148849518|gb|EDL63704.1| YqeL [Bacillus sp. SG-1] Length = 90 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%) Query: 43 LRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 SLI D +I G S K V +IA L ++ Sbjct: 1 GISLIADYFIICHGNSDKQVQAIARELKEKAEEN 34 >gi|317153506|ref|YP_004121554.1| iojap-like protein [Desulfovibrio aespoeensis Aspo-2] gi|316943757|gb|ADU62808.1| iojap-like protein [Desulfovibrio aespoeensis Aspo-2] Length = 123 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E L E + D+ ++ S + D VIVS R KH ++AD +++ + Sbjct: 18 ILAEWLDEKQGMDVVIMDVAR-MSSVTDVTVIVSARGMKHAQALADAVLARAAE 70 >gi|229829083|ref|ZP_04455152.1| hypothetical protein GCWU000342_01168 [Shuttleworthia satelles DSM 14600] gi|229792246|gb|EEP28360.1| hypothetical protein GCWU000342_01168 [Shuttleworthia satelles DSM 14600] Length = 115 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ + + L+ KAED I + S I D ++ SG + + ++ D++ ++ Sbjct: 2 TIEEQVKVAFQALEAKKAED-IRIIDIRGISTIADYFIVASGSNQSQLQAMEDSVGQKMR 60 Query: 75 K 75 + Sbjct: 61 E 61 >gi|118602360|ref|YP_903575.1| iojap-like protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] gi|118567299|gb|ABL02104.1| iojap-like protein [Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)] Length = 110 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +L + TV + +++LK EDI ++ + I + +VI +GRS +HV I++NL K Sbjct: 2 NLKQQLKTVTDTIEKLKGEDIVTLKILEQSADI-EAIVIATGRSIQHVRGISNNLKIEAK 60 Query: 75 KKN 77 + N Sbjct: 61 RLN 63 >gi|300741639|ref|ZP_07071660.1| iojap-like protein [Rothia dentocariosa M567] gi|300380824|gb|EFJ77386.1| iojap-like protein [Rothia dentocariosa M567] Length = 143 Score = 46.2 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 11/67 (16%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + A + +E + + ++ + LI D ++VS + + V ++AD + Sbjct: 1 MTAAQSSCEALRIAARAAEEKQGTQLFAVDASDAMGLI-DGFLVVSAHNERLVNAVADEI 59 Query: 70 ISYLKKK 76 L+++ Sbjct: 60 EDALREQ 66 >gi|311113733|ref|YP_003984955.1| iojap-like protein [Rothia dentocariosa ATCC 17931] gi|310945227|gb|ADP41521.1| iojap-like protein [Rothia dentocariosa ATCC 17931] Length = 143 Score = 46.2 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 11/67 (16%), Positives = 29/67 (43%), Gaps = 1/67 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + A + +E + + ++ + LI D ++VS + + V ++AD + Sbjct: 1 MTAAQSSCEALRIAARAAEEKQGTQLFAVDASDAMGLI-DGFLVVSAHNERLVNAVADEI 59 Query: 70 ISYLKKK 76 L+++ Sbjct: 60 EDALREQ 66 >gi|228999123|ref|ZP_04158705.1| YqeL (Iojap-related protein) [Bacillus mycoides Rock3-17] gi|229006671|ref|ZP_04164305.1| YqeL (Iojap-related protein) [Bacillus mycoides Rock1-4] gi|228754532|gb|EEM03943.1| YqeL (Iojap-related protein) [Bacillus mycoides Rock1-4] gi|228760740|gb|EEM09704.1| YqeL (Iojap-related protein) [Bacillus mycoides Rock3-17] Length = 91 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D +I G S K V +IA + + + Sbjct: 2 QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 35 >gi|162451948|ref|YP_001614315.1| hypothetical protein sce3675 [Sorangium cellulosum 'So ce 56'] gi|161162530|emb|CAN93835.1| hypothetical protein predicted by Glimmer/Critica [Sorangium cellulosum 'So ce 56'] Length = 103 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%) Query: 43 LRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 R D +VI++GRS +HV +IA L ++K+ Sbjct: 2 GRVDYADYLVIMTGRSDRHVHAIATGLEEAVRKQ 35 >gi|225462172|ref|XP_002267512.1| PREDICTED: similar to putative iojap protein [Vitis vinifera] gi|296082765|emb|CBI21770.3| unnamed protein product [Vitis vinifera] Length = 219 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 14 DHLDSCIATVM--ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D +S V + ++KA DI + L +I + S + +I + Sbjct: 103 DDAESLAFAVALAKVASDVKAADIRVLFVKPLV-YWTRFFIIATAFSRPQIDAIGSRIRD 161 Query: 72 YLKKK 76 +K+ Sbjct: 162 LAEKQ 166 >gi|229169078|ref|ZP_04296793.1| YqeL (Iojap-related protein) [Bacillus cereus AH621] gi|228614306|gb|EEK71416.1| YqeL (Iojap-related protein) [Bacillus cereus AH621] Length = 92 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 10/34 (29%), Positives = 15/34 (44%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D +I G S K V +IA + + + Sbjct: 2 QGISPIADYFIICHGNSDKQVQAIAREIKAKAHE 35 >gi|229031981|ref|ZP_04187966.1| YqeL (Iojap-related protein) [Bacillus cereus AH1271] gi|228729336|gb|EEL80328.1| YqeL (Iojap-related protein) [Bacillus cereus AH1271] Length = 92 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D +I G S K V +IA + S + Sbjct: 2 QGISPIADYFIICHGNSDKQVQAIAREIKSKAHE 35 >gi|309355085|emb|CAP39455.2| hypothetical protein CBG_22981 [Caenorhabditis briggsae AF16] Length = 187 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVAS 64 T++ +D +D + T++ L E KA D+ +++ + ++ S +++ A+ Sbjct: 44 TKRFRRPESDDVD-FVETIVGALGEQKARDVFVVKSDDKEMTPYSHRIVCSVFNSRQAAA 102 Query: 65 IADNLISYLKKKN 77 I++NL LK +N Sbjct: 103 ISENLREILKMEN 115 >gi|116786013|gb|ABK23940.1| unknown [Picea sitchensis] Length = 227 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/70 (15%), Positives = 26/70 (37%), Gaps = 3/70 (4%) Query: 9 ALQTADHLDSCIATVM--ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 + + D +S V + ++KA DI + L +I + S + +I Sbjct: 100 SAEANDDAESLSLAVALAKAANDVKAVDIQVLCVKPLV-YWTRFFIIATAFSRPQIDAIG 158 Query: 67 DNLISYLKKK 76 + +++ Sbjct: 159 SKIRDIAEQQ 168 >gi|224372506|ref|YP_002606878.1| iojap-related protein [Nautilia profundicola AmH] gi|223589568|gb|ACM93304.1| iojap-related protein [Nautilia profundicola AmH] Length = 108 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 IA + E L+E KA D+ + + D +++ + + KH ++ D+L LK Sbjct: 4 IAKIKELLEEKKAIDVMDYDLKD-KDYFVDYVIVATTMADKHAQALLDHLKKTLK 57 >gi|330836961|ref|YP_004411602.1| iojap-like protein [Spirochaeta coccoides DSM 17374] gi|329748864|gb|AEC02220.1| iojap-like protein [Spirochaeta coccoides DSM 17374] Length = 127 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 23/59 (38%), Gaps = 1/59 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 ++ + + K D ++ S R D ++ + S H+ I NL L+K Sbjct: 6 KDVAEKIVSFINDHKGMDTVLLDV-SGRCSFADFFIVTTVSSIGHLNGIVHNLWGELQK 63 >gi|229163279|ref|ZP_04291233.1| YqeL (Iojap-related protein) [Bacillus cereus R309803] gi|229175005|ref|ZP_04302524.1| YqeL (Iojap-related protein) [Bacillus cereus MM3] gi|228608466|gb|EEK65769.1| YqeL (Iojap-related protein) [Bacillus cereus MM3] gi|228620186|gb|EEK77058.1| YqeL (Iojap-related protein) [Bacillus cereus R309803] Length = 92 Score = 45.8 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 15/34 (44%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 S I D +I G S K V +IA + S + Sbjct: 2 QGISPIADYFIICHGNSDKQVQAIAREIKSKAHE 35 >gi|169841590|ref|ZP_02874703.1| hypothetical protein cdivTM_30845 [candidate division TM7 single-cell isolate TM7a] Length = 36 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 8/37 (21%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 +++ KA+DI + +S D ++ +G S++++ Sbjct: 1 MEDKKAQDIKVYDMR-GKSPFFDYSILCTGSSSRNIE 36 >gi|15646024|ref|NP_208205.1| hypothetical protein HP1414 [Helicobacter pylori 26695] gi|2314589|gb|AAD08457.1| conserved hypothetical protein [Helicobacter pylori 26695] Length = 113 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|15612374|ref|NP_224027.1| hypothetical protein jhp1309 [Helicobacter pylori J99] gi|4155927|gb|AAD06895.1| putative [Helicobacter pylori J99] Length = 113 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I + L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIEMITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|294101838|ref|YP_003553696.1| iojap-like protein [Aminobacterium colombiense DSM 12261] gi|293616818|gb|ADE56972.1| iojap-like protein [Aminobacterium colombiense DSM 12261] Length = 119 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/67 (17%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Query: 13 ADHLDSCIAT---VMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + +++ L + + DI ++ +S I D ++V+ S H+ ++ + Sbjct: 1 MSDKKELVNQYMFLLDALADKRGLDITLMDLGE-KSTISDTFILVTANSDIHMGTLLNAT 59 Query: 70 ISYLKKK 76 L KK Sbjct: 60 EEALDKK 66 >gi|311031596|ref|ZP_07709686.1| hypothetical protein Bm3-1_13781 [Bacillus sp. m3-13] Length = 116 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 E++ + SL+ D +I G S K V +IA + + ++N Sbjct: 19 EELVALNM-QGISLVSDYFLICHGNSDKQVQAIARAI-KEVAEEN 61 >gi|288574864|ref|ZP_06393221.1| Iojap-related protein [Dethiosulfovibrio peptidovorans DSM 11002] gi|288570605|gb|EFC92162.1| Iojap-related protein [Dethiosulfovibrio peptidovorans DSM 11002] Length = 115 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 9/61 (14%), Positives = 25/61 (40%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 +V + + + + D+ ++ S I + V+V+ S H+ ++ + L+ Sbjct: 2 EYSKQADSVAKAVSDKRGNDVTIMDVREG-STIAEEFVVVTANSDVHMKTLCEAASDALE 60 Query: 75 K 75 Sbjct: 61 D 61 >gi|33861380|ref|NP_892941.1| domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] gi|33633957|emb|CAE19282.1| Domain of unknown function DUF143:Iojap-related protein [Prochlorococcus marinus subsp. pastoris str. CCMP1986] Length = 114 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 14/62 (22%), Positives = 27/62 (43%), Gaps = 1/62 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + KA++I I+ S I + ++I G S V SI +++ L+ Sbjct: 2 DNKLLVLMAAKACDIKKAQEIKLIKI-DKVSYISEWILIAEGLSDVQVRSITNSVEIELR 60 Query: 75 KK 76 +K Sbjct: 61 EK 62 >gi|258651741|ref|YP_003200897.1| iojap-like protein [Nakamurella multipartita DSM 44233] gi|258554966|gb|ACV77908.1| iojap-like protein [Nakamurella multipartita DSM 44233] Length = 137 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 11/40 (27%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 DI ++ + I D VIV+G + + V +I D + + Sbjct: 25 DILLVDVSDRL-AITDVFVIVTGGNERQVGAIVDEIEEKM 63 >gi|320536003|ref|ZP_08036065.1| ribosome-associated protein, iojap-like family protein [Treponema phagedenis F0421] gi|320147163|gb|EFW38717.1| ribosome-associated protein, iojap-like family protein [Treponema phagedenis F0421] Length = 126 Score = 45.1 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 22/51 (43%), Gaps = 1/51 (1%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + L+E KAED+ I+ + D VI + S A I L + K Sbjct: 12 KLLEERKAEDVVVIDLREYHT-WTDFFVIGTVSSAIQAAGIEKYLHEEIAK 61 >gi|229367414|gb|ACQ58687.1| C7orf30 [Anoplopoma fimbria] Length = 227 Score = 45.1 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI---ADNLISYLKK 75 + ++ L++ A DIC I+ + ++VSG S +H+ ++ A + +LKK Sbjct: 97 TLDVLVSLLRQENAVDICVIKVPEHIKY-AEYFIVVSGVSARHLRAMALYAIKVYKFLKK 155 >gi|312144035|ref|YP_003995481.1| iojap-like protein [Halanaerobium sp. 'sapolanicus'] gi|311904686|gb|ADQ15127.1| iojap-like protein [Halanaerobium sp. 'sapolanicus'] Length = 118 Score = 45.1 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 EDI + ++I D VI S S K V ++A + L KK Sbjct: 23 EDIDILNV-EGLTVIADYFVICSANSDKQVKAVARAIDEELSKK 65 >gi|307638068|gb|ADN80518.1| Iojap like protein [Helicobacter pylori 908] gi|317014786|gb|ADU82222.1| hypothetical protein HPGAM_07225 [Helicobacter pylori Gambia94/24] gi|325996671|gb|ADZ52076.1| Iojap like protein [Helicobacter pylori 2018] gi|325998262|gb|ADZ50470.1| hypothetical protein hp2017_1351 [Helicobacter pylori 2017] Length = 113 Score = 45.1 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I + L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIEMITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|260819650|ref|XP_002605149.1| hypothetical protein BRAFLDRAFT_223674 [Branchiostoma floridae] gi|229290480|gb|EEN61159.1| hypothetical protein BRAFLDRAFT_223674 [Branchiostoma floridae] Length = 120 Score = 45.1 bits (106), Expect = 0.004, Method: Composition-based stats. Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++E L+ A+DIC I+ + D +VIVSG ST+H+ SIA +IS K + Sbjct: 17 TIDELVEELRGENAKDICVIKVPGSLQYV-DFLVIVSGSSTRHLKSIAQYVISLHKDR 73 >gi|328702088|ref|XP_001950025.2| PREDICTED: hypothetical protein LOC100162826 [Acyrthosiphon pisum] Length = 266 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++E L++ A ++ + + + D +VI +GRS KH+ SIAD + KKK Sbjct: 124 VEHLVEVLQKNNASNVFVVSIPANVRYV-DYIVIATGRSQKHLMSIADFVHKLFKKK 179 >gi|229367342|gb|ACQ58651.1| C7orf30 [Anoplopoma fimbria] Length = 227 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI---ADNLISYLKK 75 + ++ L++ A DIC I+ + ++VSG S +H+ ++ A + +LKK Sbjct: 97 TLDVLVSLLRQENAVDICVIKVPEHIKY-AEYFIVVSGVSARHLRAMALYAIKVYKFLKK 155 >gi|217033169|ref|ZP_03438625.1| hypothetical protein HPB128_14g5 [Helicobacter pylori B128] gi|298737062|ref|YP_003729592.1| hypothetical protein HPB8_1571 [Helicobacter pylori B8] gi|216945103|gb|EEC23806.1| hypothetical protein HPB128_14g5 [Helicobacter pylori B128] gi|298356256|emb|CBI67128.1| conserved hypothetical protein [Helicobacter pylori B8] Length = 113 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I + L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIEMITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|208435285|ref|YP_002266951.1| hypothetical protein HPG27_1337 [Helicobacter pylori G27] gi|208433214|gb|ACI28085.1| hypothetical protein HPG27_1337 [Helicobacter pylori G27] Length = 113 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIETITALLDEKKAFDITHIDLSQTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|224061577|ref|XP_002300549.1| predicted protein [Populus trichocarpa] gi|222847807|gb|EEE85354.1| predicted protein [Populus trichocarpa] Length = 150 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++KA DI + L +I + S + +I + +KK Sbjct: 40 AKVASDVKASDIKVLFVKPLV-YWTRFFIIATAFSRPQIDAINSKIRDLAEKK 91 >gi|294085417|ref|YP_003552177.1| Iojap-like protein [Candidatus Puniceispirillum marinum IMCC1322] gi|292664992|gb|ADE40093.1| Iojap-related protein [Candidatus Puniceispirillum marinum IMCC1322] Length = 87 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + D MV+ SG S++ VA++A++L LK+ Sbjct: 1 MADFMVVASGSSSRQVAAMAEHLQFKLKQN 30 >gi|225850548|ref|YP_002730782.1| development gene iojAP superfamily protein [Persephonella marina EX-H1] gi|225645663|gb|ACO03849.1| development gene iojAP superfamily protein [Persephonella marina EX-H1] Length = 94 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + S I D M+I++G H +I D + LKK+ Sbjct: 2 VLNIGK-VSPIADYMIIITGDVPTHTKAICDEITQNLKKE 40 >gi|242024002|ref|XP_002432419.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517852|gb|EEB19681.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 241 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++E L++ KAEDI + D + IV+ RS +H++++ + ++ KKK Sbjct: 106 IEELVEVLRKEKAEDIFVVSVPPEYQY-ADYLTIVTARSARHMSALTEYVLKLYKKK 161 >gi|222823454|ref|YP_002575028.1| conserved hypothetical protein (DUF143 domain protein) [Campylobacter lari RM2100] gi|222538676|gb|ACM63777.1| conserved hypothetical protein (DUF143 domain protein) [Campylobacter lari RM2100] Length = 109 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + I +++ L + KA+ I + + +VI + +H S+ D+L + LK Sbjct: 1 MQERINNIVQILDDKKADLIETFDMQD-KDYFVKFVVIATTMGERHALSLIDDLKTNLKS 59 Query: 76 K 76 K Sbjct: 60 K 60 >gi|239791644|dbj|BAH72261.1| ACYPI003949 [Acyrthosiphon pisum] Length = 185 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + ++E L++ A ++ + + + D +VI +GRS KH+ SIAD + KKK Sbjct: 43 VEHLVEVLQKNNASNVFVVSIPANVRYV-DYIVIATGRSQKHLMSIADFVHKLFKKK 98 >gi|325971798|ref|YP_004247989.1| iojap-like protein [Spirochaeta sp. Buddy] gi|324027036|gb|ADY13795.1| iojap-like protein [Spirochaeta sp. Buddy] Length = 112 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 10/56 (17%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + L++ K +D+ ++ ++ D +I + S H+ +A + S L + Sbjct: 9 AQAIGQFLEDHKCQDVSILDVSA-ECSWADCFIIATVSSIGHLKGVAHEIWSELNE 63 >gi|194211833|ref|XP_001914681.1| PREDICTED: similar to Uncharacterized protein C7orf30 homolog [Equus caballus] Length = 234 Score = 44.7 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + L++ A DIC I+ D VI SG ST+ + ++A ++ K Sbjct: 98 VSLLRQENARDICVIKVPPEMKY-TDXFVIGSGTSTRRLHAMAYYIVKMYK 147 >gi|257456401|ref|ZP_05621597.1| iojap protein [Treponema vincentii ATCC 35580] gi|257446061|gb|EEV21108.1| iojap protein [Treponema vincentii ATCC 35580] Length = 116 Score = 44.7 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 11/49 (22%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 L++LKAE + ++ + D VI + S K + ++ K+ Sbjct: 16 LRDLKAESVVVLDLRPAH-IWTDFFVIATISSGKQAGGLEGKIMEAAKE 63 >gi|256827041|ref|YP_003151000.1| iojap-related protein [Cryptobacterium curtum DSM 15641] gi|256583184|gb|ACU94318.1| iojap-related protein [Cryptobacterium curtum DSM 15641] Length = 137 Score = 44.7 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 8/43 (18%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 DI E + + + D V+V+ + + V +I + + + ++++ Sbjct: 26 DIMIQEVSE-LTSVADYFVVVTAMNNRQVDAIVEAIETAVREQ 67 >gi|302767488|ref|XP_002967164.1| hypothetical protein SELMODRAFT_408614 [Selaginella moellendorffii] gi|300165155|gb|EFJ31763.1| hypothetical protein SELMODRAFT_408614 [Selaginella moellendorffii] Length = 223 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S + E+KA DI L +I S S V +I + +++ Sbjct: 76 SMATALATAANEVKAVDIKLFHVKPLI-YWARYFLIASAFSMPQVNAIVGRIEDIAQEQ 133 >gi|108563765|ref|YP_628081.1| hypothetical protein HPAG1_1340 [Helicobacter pylori HPAG1] gi|107837538|gb|ABF85407.1| hypothetical protein HPAG1_1340 [Helicobacter pylori HPAG1] Length = 113 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHIDLSQTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|229820129|ref|YP_002881655.1| iojap-like protein [Beutenbergia cavernae DSM 12333] gi|229566042|gb|ACQ79893.1| iojap-like protein [Beutenbergia cavernae DSM 12333] Length = 138 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 10/43 (23%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +I ++ + ++ D V+ SG + + VASI D + + ++ Sbjct: 25 EIIALDVSERL-VLTDVFVVASGANERQVASIVDAVEEAMHRE 66 >gi|188528180|ref|YP_001910867.1| hypothetical protein HPSH_07205 [Helicobacter pylori Shi470] gi|188144420|gb|ACD48837.1| hypothetical protein HPSH_07205 [Helicobacter pylori Shi470] Length = 113 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|317182619|dbj|BAJ60403.1| hypothetical protein HPF57_1329 [Helicobacter pylori F57] Length = 113 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|308183505|ref|YP_003927632.1| iojap-related protein [Helicobacter pylori PeCan4] gi|297380573|gb|ADI35460.1| iojap like protein [Helicobacter pylori v225d] gi|308062677|gb|ADO04565.1| iojap-related protein [Helicobacter pylori Cuz20] gi|308064169|gb|ADO06056.1| iojap-related protein [Helicobacter pylori Sat464] gi|308065690|gb|ADO07582.1| iojap-related protein [Helicobacter pylori PeCan4] Length = 113 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|224283225|ref|ZP_03646547.1| iojap-like protein [Bifidobacterium bifidum NCIMB 41171] gi|310287584|ref|YP_003938842.1| iojap-like protein [Bifidobacterium bifidum S17] gi|309251520|gb|ADO53268.1| iojap-like protein [Bifidobacterium bifidum S17] Length = 145 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Query: 30 LKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +KA DI + ++L I D M++ + + + V +A+ + + Sbjct: 21 MKAADIEAFDVSNLL-AITDIMMVATAMNERQVIGVAEEVEKDV 63 >gi|50954537|ref|YP_061825.1| hypothetical protein Lxx08120 [Leifsonia xyli subsp. xyli str. CTCB07] gi|50951019|gb|AAT88720.1| conserved hypothetical protein [Leifsonia xyli subsp. xyli str. CTCB07] Length = 123 Score = 44.3 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Query: 32 AEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 DI ++ S + D ++VSGR + V +IA + L + Sbjct: 23 GTDIVALDV-SGPLPLTDVFLLVSGRVERTVIAIASEVEDRLNE 65 >gi|217034572|ref|ZP_03439981.1| hypothetical protein HP9810_874g29 [Helicobacter pylori 98-10] gi|216942992|gb|EEC22475.1| hypothetical protein HP9810_874g29 [Helicobacter pylori 98-10] gi|315585799|gb|ADU40180.1| iojap-like protein [Helicobacter pylori 35A] gi|317178119|dbj|BAJ55908.1| hypothetical protein HPF16_1311 [Helicobacter pylori F16] gi|317179591|dbj|BAJ57379.1| hypothetical protein HPF30_1282 [Helicobacter pylori F30] Length = 113 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|301168158|emb|CBW27747.1| conserved hypothetical protein [Bacteriovorax marinus SJ] Length = 129 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Query: 31 KAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 K ++ ++ S + D V+ S + S+AD + LK Sbjct: 11 KGINLKVLDVKE-SSSLTDFFVLGSATNPTMAQSMADEITKQLK 53 >gi|291302921|ref|YP_003514199.1| iojap-like protein [Stackebrandtia nassauensis DSM 44728] gi|290572141|gb|ADD45106.1| iojap-like protein [Stackebrandtia nassauensis DSM 44728] Length = 141 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 DI ++ + +I D +I S + + V +I D + L+++ Sbjct: 24 RDIVLLDVSDEV-VITDIFMIASAPNERQVLAIVDAVEDKLRRE 66 >gi|207092600|ref|ZP_03240387.1| hypothetical protein HpylHP_06950 [Helicobacter pylori HPKX_438_AG0C1] gi|207109158|ref|ZP_03243320.1| hypothetical protein HpylH_07596 [Helicobacter pylori HPKX_438_CA4C1] gi|254779928|ref|YP_003058035.1| hypothetical protein HELPY_1382 [Helicobacter pylori B38] gi|254001841|emb|CAX30087.1| Conserved hypothetical protein [Helicobacter pylori B38] gi|317010072|gb|ADU80652.1| iojap-related protein [Helicobacter pylori India7] Length = 113 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|210135575|ref|YP_002302014.1| hypothetical protein HPP12_1386 [Helicobacter pylori P12] gi|308185175|ref|YP_003929308.1| iojap-related protein [Helicobacter pylori SJM180] gi|210133543|gb|ACJ08534.1| hypothetical protein HPP12_1386 [Helicobacter pylori P12] gi|308061095|gb|ADO02991.1| iojap-related protein [Helicobacter pylori SJM180] Length = 113 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I + L E KA DI HI+ + + ++++I + + KH S+ D L + LK Sbjct: 1 MNQRIEMITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|149195100|ref|ZP_01872192.1| Iojap-related protein [Caminibacter mediatlanticus TB-2] gi|149134813|gb|EDM23297.1| Iojap-related protein [Caminibacter mediatlanticus TB-2] Length = 108 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I+ + E L E KA DI D +V+ + + KH ++ D+L LK Sbjct: 4 ISKIKELLDEKKALDIIDYNLKD-TDYFVDYVVVATTMADKHSKALLDHLKKNLK 57 >gi|308809690|ref|XP_003082154.1| 312 protein (ISS) [Ostreococcus tauri] gi|116060622|emb|CAL57100.1| 312 protein (ISS) [Ostreococcus tauri] Length = 472 Score = 44.3 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 13/83 (15%), Positives = 34/83 (40%), Gaps = 16/83 (19%) Query: 3 ANTEKQALQTADHL-----------DSCIATVMECLKELKAEDICHIENTSLRSLICDNM 51 +T+K ++ D D + ++ + D+ I + D++ Sbjct: 313 KDTQKTQIEYEDDPSRMPYAKAFKPDELVHLLVRA----RGIDVMAINVRD-QCAWTDHL 367 Query: 52 VIVSGRSTKHVASIADNLISYLK 74 +I + RS +H+ ++A ++ +K Sbjct: 368 IIATARSAQHLKALAGAVLHAVK 390 >gi|19553550|ref|NP_601552.1| hypothetical protein NCgl2269 [Corynebacterium glutamicum ATCC 13032] gi|62391194|ref|YP_226596.1| hypothetical protein cg2582 [Corynebacterium glutamicum ATCC 13032] gi|145296319|ref|YP_001139140.1| hypothetical protein cgR_2234 [Corynebacterium glutamicum R] gi|21325122|dbj|BAB99744.1| Uncharacterized ACR (homolog of plant Iojap proteins) [Corynebacterium glutamicum ATCC 13032] gi|41326534|emb|CAF21016.1| conserved hypothetical protein [Corynebacterium glutamicum ATCC 13032] gi|140846239|dbj|BAF55238.1| hypothetical protein [Corynebacterium glutamicum R] Length = 157 Score = 43.9 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I I+ + + I D V+ S + + V +I + + + K Sbjct: 26 IAVIDVSDMI-AITDCFVVASADNERQVGAIVEEIEDEMTK 65 >gi|149912297|ref|ZP_01900866.1| iojap domain protein [Moritella sp. PE36] gi|149804619|gb|EDM64681.1| iojap domain protein [Moritella sp. PE36] Length = 82 Score = 43.9 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 11/35 (31%), Positives = 20/35 (57%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +S + D M++ +G S HV SI+++L K+ Sbjct: 1 KGKSPVTDIMIVCTGTSKTHVKSISNHLYLEAKRN 35 >gi|18399794|ref|NP_566439.1| unknown protein [Arabidopsis thaliana] gi|15795122|dbj|BAB02500.1| IojAP protein-like [Arabidopsis thaliana] gi|22655076|gb|AAM98129.1| expressed protein [Arabidopsis thaliana] gi|27311971|gb|AAO00951.1| expressed protein [Arabidopsis thaliana] gi|332641742|gb|AEE75263.1| Lojap-related protein [Arabidopsis thaliana] Length = 238 Score = 43.9 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 14 DHLDSCIATV--MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D +S V + ++KA DI + L +I + S + +I + Sbjct: 116 DDAESLAFAVELAKVASDVKAGDIKVLFVKPLV-YWTRFFIIATAFSRPQIDAIGSRMRD 174 Query: 72 YLKKK 76 +KK Sbjct: 175 LAEKK 179 >gi|145595985|ref|YP_001160282.1| iojap-like protein [Salinispora tropica CNB-440] gi|145305322|gb|ABP55904.1| iojap-like protein [Salinispora tropica CNB-440] Length = 132 Score = 43.9 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +DI I+ I D ++ + + + V +I D + L Sbjct: 24 QDIVIIDVGEQL-AITDAFLLAAAPNERQVLAIVDAIEERL 63 >gi|109946662|ref|YP_663890.1| hypothetical protein Hac_0023 [Helicobacter acinonychis str. Sheeba] gi|109713883|emb|CAJ98891.1| conserved hypothetical protein [Helicobacter acinonychis str. Sheeba] Length = 113 Score = 43.9 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I + L E KA DI HI+ + + ++++I + ++KH S+ D L + LK Sbjct: 1 MNKRIEIITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLASKHALSLLDALKNTLK 58 >gi|21593503|gb|AAM65470.1| putative iojap protein [Arabidopsis thaliana] Length = 238 Score = 43.9 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 14 DHLDSCIATV--MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D +S V + ++KA DI + L +I + S + +I + Sbjct: 116 DDAESLAFAVELAKVASDVKAGDIKVLFVKPLV-YWTRFFIIATAFSRPQIDAIGSRMRD 174 Query: 72 YLKKK 76 +KK Sbjct: 175 LAEKK 179 >gi|150021442|ref|YP_001306796.1| iojap-like protein [Thermosipho melanesiensis BI429] gi|149793963|gb|ABR31411.1| iojap-like protein [Thermosipho melanesiensis BI429] Length = 112 Score = 43.9 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 10/57 (17%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L E +A + ++ + + +I++ S+ H+ S+ ++L+ LK Sbjct: 2 EILKVIWRKLLEKEAIEPVILDMSQTNVP-TEYFIIMTANSSTHMKSLREDLLDLLK 57 >gi|317011549|gb|ADU85296.1| iojap-related protein [Helicobacter pylori SouthAfrica7] Length = 113 Score = 43.9 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I + L E KA DI HI+ + + ++++I + ++KH S+ D L + LK Sbjct: 1 MNKRIEMITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLASKHALSLLDALKNTLK 58 >gi|297829830|ref|XP_002882797.1| hypothetical protein ARALYDRAFT_897503 [Arabidopsis lyrata subsp. lyrata] gi|297328637|gb|EFH59056.1| hypothetical protein ARALYDRAFT_897503 [Arabidopsis lyrata subsp. lyrata] Length = 229 Score = 43.9 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 14 DHLDSCIATV--MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D +S V + ++KA DI + L +I + S + +I + Sbjct: 107 DDAESLAFAVELAKVASDVKAGDIKVLFVKPLV-YWTRFFIIATAFSRPQIDAIGSRMRD 165 Query: 72 YLKKK 76 +KK Sbjct: 166 LAEKK 170 >gi|261838690|gb|ACX98456.1| hypothetical protein KHP_1265 [Helicobacter pylori 51] gi|332674179|gb|AEE70996.1| iojap-like protein [Helicobacter pylori 83] Length = 113 Score = 43.5 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI+ + + ++++I + + KH S+ + L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHIDLSKTP-YLVEDVIIATTLANKHALSLLNALKNTLK 58 >gi|217077948|ref|YP_002335666.1| iojap family protein [Thermosipho africanus TCF52B] gi|217037803|gb|ACJ76325.1| iojap family protein [Thermosipho africanus TCF52B] Length = 110 Score = 43.5 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 9/58 (15%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + + + + E +A + ++ ++ D +I++ S H+ S+ D ++ L + Sbjct: 2 EILELIWKKILEKEAIEPVILDMSNTNVP-TDYFIILTANSNTHMNSLRDTILDLLSE 58 >gi|224115386|ref|XP_002317019.1| predicted protein [Populus trichocarpa] gi|118484473|gb|ABK94112.1| unknown [Populus trichocarpa] gi|222860084|gb|EEE97631.1| predicted protein [Populus trichocarpa] Length = 150 Score = 43.5 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 13/65 (20%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 14 DHLDSCIATV--MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D +S V + ++KA DI + L +I + S + +I + Sbjct: 28 DDAESLSFAVEMAKVASDVKASDIRVLFVKPLV-YWTRFFIIATAFSRPQIDAINSRMRD 86 Query: 72 YLKKK 76 +KK Sbjct: 87 LAEKK 91 >gi|321478562|gb|EFX89519.1| hypothetical protein DAPPUDRAFT_310628 [Daphnia pulex] Length = 188 Score = 43.5 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++ L + K + I I + + D MVI +GRS K + +IA+ + K++ Sbjct: 57 IEEFVDILSQQKLDKIVVIAVPPELNYV-DYMVITTGRSPKQMTAIAEFIRKVFKRR 112 >gi|323140571|ref|ZP_08075496.1| iojap-like protein [Phascolarctobacterium sp. YIT 12067] gi|322414924|gb|EFY05718.1| iojap-like protein [Phascolarctobacterium sp. YIT 12067] Length = 118 Score = 43.5 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I + S + D VI S ++ V +IADN+ L + Sbjct: 22 ILLLNM-EGLSPVTDFYVICSAGNSTLVKAIADNIEDKLAE 61 >gi|308234649|ref|ZP_07665386.1| iojap-like protein [Gardnerella vaginalis ATCC 14018] gi|311114858|ref|YP_003986079.1| iojap-like protein [Gardnerella vaginalis ATCC 14019] gi|310946352|gb|ADP39056.1| iojap-like protein [Gardnerella vaginalis ATCC 14019] Length = 145 Score = 43.5 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + + I LKA +I + ++L I D M++VS + + V ++++ + Sbjct: 1 MAALESSVNAIRIAAAAADRLKATNIQAFDVSNLLG-ITDAMLVVSASNERQVLAVSEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|302754850|ref|XP_002960849.1| hypothetical protein SELMODRAFT_402255 [Selaginella moellendorffii] gi|300171788|gb|EFJ38388.1| hypothetical protein SELMODRAFT_402255 [Selaginella moellendorffii] Length = 215 Score = 43.5 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 12/59 (20%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S + E+KA DI L +I S S V +I + +++ Sbjct: 76 SMATALATAANEVKAVDIKLFHVKPLI-YWARYFLIASAFSMPQVNAIVGRIEDIAQEQ 133 >gi|254585123|ref|XP_002498129.1| ZYRO0G02948p [Zygosaccharomyces rouxii] gi|322518456|sp|C5DZB2|ATP25_ZYGRC RecName: Full=ATPase synthesis protein 25, mitochondrial; Flags: Precursor gi|238941023|emb|CAR29196.1| ZYRO0G02948p [Zygosaccharomyces rouxii] Length = 583 Score = 43.5 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 17/77 (22%), Positives = 31/77 (40%), Gaps = 6/77 (7%) Query: 6 EKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSLR-----SLICDNMVIVSGRST 59 + Q + + + + + L + DI + + I D MVI + RS Sbjct: 70 KAQEINYPSNSPDSLRHISQYLCDELGLSDIIIFDLRKGEFETAAAKISDFMVIATARSP 129 Query: 60 KHVASIADNLISYLKKK 76 KH + D L S +K++ Sbjct: 130 KHCQTSFDKLNSLIKQE 146 >gi|326499918|dbj|BAJ90794.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326515900|dbj|BAJ87973.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 228 Score = 43.5 bits (102), Expect = 0.011, Method: Composition-based stats. Identities = 11/66 (16%), Positives = 26/66 (39%), Gaps = 4/66 (6%) Query: 9 ALQTADHLDSCIATVM---ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 AD C++ + + E+KA DI + + + +I++ S + +I Sbjct: 103 LASEADEDAECLSLAVSLAKVASEVKAADIRVLFVKPIV-YWTEFFIILTAFSNAQIEAI 161 Query: 66 ADNLIS 71 + + Sbjct: 162 SSKMRD 167 >gi|159039384|ref|YP_001538637.1| iojap-like protein [Salinispora arenicola CNS-205] gi|157918219|gb|ABV99646.1| iojap-like protein [Salinispora arenicola CNS-205] Length = 133 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +DI I+ I D ++ + + + V +I D + L Sbjct: 24 QDIVIIDVGDQL-AITDAFLLAAAPNERQVLAIVDAIEERL 63 >gi|257064010|ref|YP_003143682.1| iojap-related protein [Slackia heliotrinireducens DSM 20476] gi|256791663|gb|ACV22333.1| iojap-related protein [Slackia heliotrinireducens DSM 20476] Length = 128 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 6/39 (15%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 DI + L + D VI++ ++ + ++++ + + Sbjct: 27 DIVIQDVRDLIG-VTDYFVIITAQNNRQISAVINAIEDD 64 >gi|328472493|gb|EGF43356.1| hypothetical protein VP10329_11701 [Vibrio parahaemolyticus 10329] Length = 69 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 20/25 (80%) Query: 51 MVIVSGRSTKHVASIADNLISYLKK 75 M+I +G S +HV+SIAD++ S +KK Sbjct: 1 MIICTGTSKRHVSSIADHVASEVKK 25 >gi|187918637|ref|YP_001884202.1| iojap protein family [Borrelia hermsii DAH] gi|119861485|gb|AAX17280.1| iojap protein family [Borrelia hermsii DAH] Length = 119 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 13/69 (18%), Positives = 31/69 (44%), Gaps = 6/69 (8%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI-ADN 68 + D + + + D+ I+ +S D +IVS S K + ++ A+ Sbjct: 7 MLKIDDIKKLCKII----SDFGGIDVLSIDVSS-VCNWADFFIIVSCSSFKQMEALHAER 61 Query: 69 LISYLKKKN 77 L+++ K+++ Sbjct: 62 LVTFFKERD 70 >gi|317181096|dbj|BAJ58882.1| hypothetical protein HPF32_1300 [Helicobacter pylori F32] Length = 113 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Query: 16 LDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ I T+ L E KA DI HI + + ++++I + + KH S+ D L + LK Sbjct: 1 MNKRIETITALLDEKKAFDITHINLSKTP-YLVEDVIIATTLANKHALSLLDALKNTLK 58 >gi|145352453|ref|XP_001420559.1| predicted protein [Ostreococcus lucimarinus CCE9901] gi|144580794|gb|ABO98852.1| predicted protein [Ostreococcus lucimarinus CCE9901] Length = 336 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 10/60 (16%), Positives = 26/60 (43%), Gaps = 5/60 (8%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 D + ++ + D+ I + D+++I + RS H+ ++A ++ +K Sbjct: 203 EPDELVQLLVRA----RGIDVMSINVRD-QCTWTDHLIIATARSAHHLKALAGAVLHAVK 257 >gi|168334002|ref|ZP_02692226.1| iojap-like protein [Epulopiscium sp. 'N.t. morphotype B'] Length = 112 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 10/49 (20%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA 66 + L + K ED+ +E + + D VI +T+ +I+ Sbjct: 5 ELALKIAHILDKKKLEDLEIVEVKE-LTTLTDYFVIAICSNTRQSMAIS 52 >gi|88608845|ref|YP_506783.1| iojap-related protein [Neorickettsia sennetsu str. Miyayama] gi|88601014|gb|ABD46482.1| iojap-related protein [Neorickettsia sennetsu str. Miyayama] Length = 110 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ ++E L K DI I MV+ S S KHV ++AD ++ K+K Sbjct: 13 SQIVSLILESLSVHKGRDIKIY----GGRGITGCMVVASSDSHKHVKTLADFVVKLSKEK 68 >gi|312880198|ref|ZP_07739998.1| Iojap-related protein [Aminomonas paucivorans DSM 12260] gi|310783489|gb|EFQ23887.1| Iojap-related protein [Aminomonas paucivorans DSM 12260] Length = 136 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 13/82 (15%), Positives = 33/82 (40%), Gaps = 8/82 (9%) Query: 2 LANTEKQALQTADHLDSCIATVMEC-------LKELKAEDICHIENTSLRSLICDNMVIV 54 +A++E + + + + L + A+D+ I+ + D V+ Sbjct: 1 MAHSETPQGRDLEETQENARELFKKYRGLGLRLTDKHAKDVDFIDVRGTLG-VTDLFVLA 59 Query: 55 SGRSTKHVASIADNLISYLKKK 76 + RS H+ ++ + + YL+ Sbjct: 60 TARSDVHLKTLQEEALEYLEDH 81 >gi|147793065|emb|CAN70919.1| hypothetical protein VITISV_015598 [Vitis vinifera] Length = 127 Score = 42.8 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 24/65 (36%), Gaps = 3/65 (4%) Query: 14 DHLDSCIATVM--ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 D +S V + ++KA DI + L +I + S + +I + Sbjct: 28 DDAESLAFAVALAKVASDVKAADIRVLFVKPLV-YWTRFFIIATAFSRPQIDAIGSRIRD 86 Query: 72 YLKKK 76 +K+ Sbjct: 87 LAEKQ 91 >gi|302335656|ref|YP_003800863.1| iojap-like protein [Olsenella uli DSM 7084] gi|301319496|gb|ADK67983.1| iojap-like protein [Olsenella uli DSM 7084] Length = 116 Score = 42.4 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 7/40 (17%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D+ I+ S +CD +I + + + + D + + Sbjct: 23 DLVLIDLCE-ASDVCDYFLICTAANAPQMDATVDAICEKV 61 >gi|271968495|ref|YP_003342691.1| hypothetical protein Sros_7260 [Streptosporangium roseum DSM 43021] gi|270511670|gb|ACZ89948.1| conserved hypothetical protein [Streptosporangium roseum DSM 43021] Length = 135 Score = 42.4 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 12/65 (18%), Positives = 26/65 (40%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + D + E + A+DI + + +I D ++ S + + V +I D + Sbjct: 1 MTATDRSVQLVRLAAEAAADKLADDILAYDVSEQL-VITDAFLLCSATNDRQVRAIVDEI 59 Query: 70 ISYLK 74 L+ Sbjct: 60 EDRLR 64 >gi|162463776|ref|NP_001105495.1| protein Iojap [Zea mays] gi|75102660|sp|Q41822|IOJAP_MAIZE RecName: Full=Protein Iojap gi|22349|emb|CAA78772.1| putative iojap protein [Zea mays] gi|258062|gb|AAA11464.1| iojap [Zea mays] Length = 228 Score = 42.4 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + E+KA DI + L +I++ S + +I+ + Sbjct: 121 AKAASEIKATDIRVLCVRRLV-YWTRFFIILTAFSNAQIDAISSKMRD 167 >gi|297182794|gb|ADI18947.1| uncharacterized homolog of plant iojap protein [uncultured Rhodobacterales bacterium HF0010_10C01] Length = 100 Score = 42.4 bits (99), Expect = 0.020, Method: Composition-based stats. Identities = 13/48 (27%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + KA DI I+ S + ++I SG S + V ++A+ + +K Sbjct: 1 MNQNKAVDITEIKVDQSFSEF-EKILIASGSSNRQVIALAEKVQEGVK 47 >gi|198430262|ref|XP_002128067.1| PREDICTED: similar to Uncharacterized protein C7orf30 homolog [Ciona intestinalis] Length = 257 Score = 42.4 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 13/71 (18%), Positives = 29/71 (40%), Gaps = 1/71 (1%) Query: 4 NTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVA 63 +T +++ + + + E DI I+ + + D IV+ S++H+ Sbjct: 65 STTSKSIDNNRKGVLTMDEIYNLIVEENGRDITVIKLSKEANY-ADYFTIVTANSSRHLV 123 Query: 64 SIADNLISYLK 74 +A+ L K Sbjct: 124 HMAETLNRLYK 134 >gi|289743069|gb|ADD20282.1| uncharacterized conserved protein [Glossina morsitans morsitans] Length = 248 Score = 42.4 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I +++E L++ AEDI + + D +V+ SGRS +H+ +IA+ + K Sbjct: 114 IDSLVEVLRKEGAEDIFVCSVPTELKYV-DYLVVCSGRSHRHLTAIAEFVRYMYK 167 >gi|224005222|ref|XP_002296262.1| predicted protein [Thalassiosira pseudonana CCMP1335] gi|209586294|gb|ACI64979.1| predicted protein [Thalassiosira pseudonana CCMP1335] Length = 668 Score = 42.4 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 15/51 (29%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Query: 32 AEDICHIENTS-----LRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 DI I+ + + C+ M+IV+GR++ H+ +AD+++ LK +N Sbjct: 460 GSDIHIIDVSDHGDVYGVGIGCETMMIVTGRNSSHIRVLADSIVRNLKARN 510 >gi|269218636|ref|ZP_06162490.1| iojap-like protein [Actinomyces sp. oral taxon 848 str. F0332] gi|269211747|gb|EEZ78087.1| iojap-like protein [Actinomyces sp. oral taxon 848 str. F0332] Length = 123 Score = 42.4 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 ELKA I I+ + ++ + ++VSG S + V S+ D + L Sbjct: 20 ELKATTIAAIDVSERL-VLTEVFLVVSGSSDRQVRSLVDAMDEAL 63 >gi|293569273|ref|ZP_06680571.1| Iojap family protein [Enterococcus faecium E1071] gi|291587979|gb|EFF19829.1| Iojap family protein [Enterococcus faecium E1071] Length = 85 Score = 42.4 bits (99), Expect = 0.024, Method: Composition-based stats. Identities = 8/31 (25%), Positives = 17/31 (54%), Gaps = 2/31 (6%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + D +I S S + + +I + +I K++N Sbjct: 2 LADYFMICSANSERQINAITEEIID--KEEN 30 >gi|261328861|emb|CBH11839.1| hypothetical protein, conserved [Trypanosoma brucei gambiense DAL972] Length = 350 Score = 42.0 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++E L+ LK DIC I+ ++ ++ D M+ + +H+ A + Sbjct: 201 VKEILEVLRSLKVRDICAIDVSN-KTSNFDYMLFGTCEGPRHIHLAAWAVQEA 252 >gi|320093906|ref|ZP_08025745.1| Iojap family protein [Actinomyces sp. oral taxon 178 str. F0338] gi|319979175|gb|EFW10679.1| Iojap family protein [Actinomyces sp. oral taxon 178 str. F0338] Length = 142 Score = 42.0 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 9/45 (20%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 E D ++ S + D V+VS + + V+++A+ ++ + Sbjct: 20 ERGGADPVLVDVRSRM-DLADAFVVVSAPTPRQVSAVAEEVMDRV 63 >gi|238060585|ref|ZP_04605294.1| iojap protein [Micromonospora sp. ATCC 39149] gi|237882396|gb|EEP71224.1| iojap protein [Micromonospora sp. ATCC 39149] Length = 175 Score = 42.0 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I I+ I D ++ + + + V +I D + L + Sbjct: 64 IVIIDVGEQL-AITDAFLLAAAPNERQVLAIVDAIEERLLE 103 >gi|322785584|gb|EFZ12239.1| hypothetical protein SINV_01807 [Solenopsis invicta] Length = 260 Score = 42.0 bits (98), Expect = 0.030, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++E L+ KA++I + + D +V+V+G S KH+ ++A + K Sbjct: 120 IEDLVELLEREKAKNIFVASVPKEYTYV-DYIVVVNGSSQKHMNALATFVRKVYK 173 >gi|72390331|ref|XP_845460.1| hypothetical protein [Trypanosoma brucei TREU927] gi|62359504|gb|AAX79940.1| hypothetical protein, conserved [Trypanosoma brucei] gi|70801995|gb|AAZ11901.1| hypothetical protein, conserved [Trypanosoma brucei brucei strain 927/4 GUTat10.1] Length = 349 Score = 42.0 bits (98), Expect = 0.030, Method: Composition-based stats. Identities = 12/53 (22%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + ++E L+ LK DIC I+ ++ ++ D M+ + +H+ A + Sbjct: 200 VKEILEVLRSLKVRDICAIDVSN-KTSNFDYMLFGTCEGPRHIHLAAWAVQEA 251 >gi|296447687|ref|ZP_06889605.1| iojap-like protein [Methylosinus trichosporium OB3b] gi|296254828|gb|EFH01937.1| iojap-like protein [Methylosinus trichosporium OB3b] Length = 79 Score = 41.6 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 19/25 (76%) Query: 51 MVIVSGRSTKHVASIADNLISYLKK 75 M+I +GRST HV++IAD ++ K+ Sbjct: 1 MIIATGRSTVHVSAIADKVLKACKE 25 >gi|242049700|ref|XP_002462594.1| hypothetical protein SORBIDRAFT_02g028720 [Sorghum bicolor] gi|241925971|gb|EER99115.1| hypothetical protein SORBIDRAFT_02g028720 [Sorghum bicolor] Length = 226 Score = 41.6 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + E+KA DI + L +I++ S + +I+ + Sbjct: 119 AKAASEIKATDIRVLCVKRLV-YWTRFFIILTAFSNAQIDAISSKMRD 165 >gi|329947002|ref|ZP_08294414.1| iojap-like protein [Actinomyces sp. oral taxon 170 str. F0386] gi|328526813|gb|EGF53826.1| iojap-like protein [Actinomyces sp. oral taxon 170 str. F0386] Length = 139 Score = 41.6 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 8/39 (20%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 37 HIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I+ + + D ++ SG + +HV +I D + + + Sbjct: 28 AIDVSERLG-LTDVFLLASGTNERHVHAIVDAVDEAMHR 65 >gi|291459074|ref|ZP_06598464.1| iojap-like protein [Oribacterium sp. oral taxon 078 str. F0262] gi|291418328|gb|EFE92047.1| iojap-like protein [Oribacterium sp. oral taxon 078 str. F0262] Length = 119 Score = 41.6 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 16/64 (25%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Query: 13 ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 A+ + E +E K + I + S S+I D VIV+ +++ V +++D+L Sbjct: 3 AETSRAMAKAAAEICEEKKGRE-ISIIDISEISVIADYFVIVTAENSRQVEALSDSLQDG 61 Query: 73 LKKK 76 + K+ Sbjct: 62 MAKR 65 >gi|307181463|gb|EFN69055.1| Uncharacterized protein C7orf30 [Camponotus floridanus] Length = 251 Score = 41.2 bits (96), Expect = 0.044, Method: Composition-based stats. Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++ L+ KA +I + + + D +V+V+G+S KH+ ++A + K+K Sbjct: 116 IEDLVALLEGDKANNIFVAKVPKEYAYV-DYIVVVTGKSQKHMNALATFVRKVYKQK 171 >gi|119953559|ref|YP_945769.1| iojap protein family [Borrelia turicatae 91E135] gi|119862330|gb|AAX18098.1| iojap protein family [Borrelia turicatae 91E135] Length = 119 Score = 41.2 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 14/71 (19%), Positives = 32/71 (45%), Gaps = 4/71 (5%) Query: 10 LQTADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI-A 66 + + + + + + + + D+ I S D +IVS S K + ++ A Sbjct: 1 MILMEDMLKIDDVKKLCKIISDFGGIDVLGINVGS-VCNWADFFIIVSCSSFKQMEALYA 59 Query: 67 DNLISYLKKKN 77 + LI++ K+K+ Sbjct: 60 ERLITFFKEKD 70 >gi|256371586|ref|YP_003109410.1| Iojap-related protein [Acidimicrobium ferrooxidans DSM 10331] gi|256008170|gb|ACU53737.1| Iojap-related protein [Acidimicrobium ferrooxidans DSM 10331] Length = 172 Score = 41.2 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 8/54 (14%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Query: 22 TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + ++ A+D+ +E + I + ++ + R+ + AS+ +L+ +++ Sbjct: 51 AIARMAEDKHADDVVVLEVAE-LTAIATHFILATARNPRLGASLVTDLVRQIRR 103 >gi|325294148|ref|YP_004280012.1| hypothetical protein AGROH133_09226 [Agrobacterium sp. H13-3] gi|325062001|gb|ADY65692.1| hypothetical protein AGROH133_09226 [Agrobacterium sp. H13-3] Length = 79 Score = 40.8 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 12/26 (46%), Positives = 21/26 (80%) Query: 51 MVIVSGRSTKHVASIADNLISYLKKK 76 MV+VSGRS +HV++I ++L+ +K + Sbjct: 1 MVVVSGRSNRHVSAICEHLLKDMKDE 26 >gi|157364743|ref|YP_001471510.1| Iojap-related protein [Thermotoga lettingae TMO] gi|157315347|gb|ABV34446.1| Iojap-related protein [Thermotoga lettingae TMO] Length = 102 Score = 40.8 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 8/48 (16%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 ++ + E +A + ++ ++ + VIV+ S H+ ++ D ++ Sbjct: 2 LQLMNEKEAIEPVVLDMSNTPLP-TEYFVIVTANSQTHMGTLRDAVVE 48 >gi|153820318|ref|ZP_01972985.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] gi|126509138|gb|EAZ71732.1| conserved hypothetical protein [Vibrio cholerae NCTC 8457] Length = 69 Score = 40.8 bits (95), Expect = 0.060, Method: Composition-based stats. Identities = 10/24 (41%), Positives = 18/24 (75%) Query: 51 MVIVSGRSTKHVASIADNLISYLK 74 M++ +G S +HVASIA+++ + K Sbjct: 1 MIVCTGTSKRHVASIAEHVANEAK 24 >gi|293571012|ref|ZP_06682055.1| Iojap family protein [Enterococcus faecium E980] gi|291608938|gb|EFF38217.1| Iojap family protein [Enterococcus faecium E980] Length = 86 Score = 40.8 bits (95), Expect = 0.062, Method: Composition-based stats. Identities = 7/31 (22%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + D +I S S + + +I + +I +++N Sbjct: 2 LADYFMICSANSERQINAITEEIIDK-EEEN 31 >gi|293378711|ref|ZP_06624869.1| iojap-like protein [Enterococcus faecium PC4.1] gi|292642639|gb|EFF60791.1| iojap-like protein [Enterococcus faecium PC4.1] Length = 86 Score = 40.8 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 7/31 (22%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + D +I S S + + +I + +I +++N Sbjct: 2 LADYFMICSANSERQINAITEEIIDK-EEEN 31 >gi|261208976|ref|ZP_05923381.1| conserved hypothetical protein [Enterococcus faecium TC 6] gi|289565212|ref|ZP_06445664.1| iojap protein 155 [Enterococcus faecium D344SRF] gi|294615010|ref|ZP_06694899.1| iojap family protein [Enterococcus faecium E1636] gi|294619100|ref|ZP_06698595.1| iojap family protein [Enterococcus faecium E1679] gi|260077015|gb|EEW64737.1| conserved hypothetical protein [Enterococcus faecium TC 6] gi|289163033|gb|EFD10881.1| iojap protein 155 [Enterococcus faecium D344SRF] gi|291592141|gb|EFF23761.1| iojap family protein [Enterococcus faecium E1636] gi|291594761|gb|EFF26143.1| iojap family protein [Enterococcus faecium E1679] Length = 86 Score = 40.8 bits (95), Expect = 0.064, Method: Composition-based stats. Identities = 7/31 (22%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + D +I S S + + +I + +I +++N Sbjct: 2 LADYFMICSANSERQINAITEEIIDK-EEEN 31 >gi|257880243|ref|ZP_05659896.1| conserved hypothetical protein [Enterococcus faecium 1,230,933] gi|257883044|ref|ZP_05662697.1| conserved hypothetical protein [Enterococcus faecium 1,231,502] gi|257893630|ref|ZP_05673283.1| conserved hypothetical protein [Enterococcus faecium 1,231,408] gi|260560459|ref|ZP_05832633.1| conserved hypothetical protein [Enterococcus faecium C68] gi|293563277|ref|ZP_06677727.1| iojap-related protein [Enterococcus faecium E1162] gi|294621395|ref|ZP_06700567.1| Iojap-related protein [Enterococcus faecium U0317] gi|257814471|gb|EEV43229.1| conserved hypothetical protein [Enterococcus faecium 1,230,933] gi|257818702|gb|EEV46030.1| conserved hypothetical protein [Enterococcus faecium 1,231,502] gi|257830009|gb|EEV56616.1| conserved hypothetical protein [Enterococcus faecium 1,231,408] gi|260073461|gb|EEW61789.1| conserved hypothetical protein [Enterococcus faecium C68] gi|291599042|gb|EFF30087.1| Iojap-related protein [Enterococcus faecium U0317] gi|291604729|gb|EFF34213.1| iojap-related protein [Enterococcus faecium E1162] Length = 86 Score = 40.8 bits (95), Expect = 0.064, Method: Composition-based stats. Identities = 7/31 (22%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + D +I S S + + +I + +I +++N Sbjct: 2 LADYFMICSANSERQINAITEEIIDK-EEEN 31 >gi|71988563|ref|NP_498757.2| hypothetical protein K12H4.2 [Caenorhabditis elegans] gi|81175203|sp|P34523|YM62_CAEEL RecName: Full=Uncharacterized protein K12H4.2 gi|62630041|gb|AAA28098.2| Hypothetical protein K12H4.2 [Caenorhabditis elegans] Length = 190 Score = 40.8 bits (95), Expect = 0.067, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNM--VIVSGRSTKHVASIADNLISYLK 74 + V+ L + +A+D+ S + + +I S +++ ++I++NL S LK Sbjct: 64 VENVVGALTDQRAKDVFV--VKSEETEMTPYTHKIICSAFNSRQASAISENLRSLLK 118 >gi|325068528|ref|ZP_08127201.1| iojap-like protein [Actinomyces oris K20] Length = 138 Score = 40.8 bits (95), Expect = 0.069, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 E + I+ + + D ++ SG + +HV +I D + + Sbjct: 24 EHLTAIDVSERLG-LTDVFLLASGANDRHVHAIVDAVDEAM 63 >gi|229845380|ref|ZP_04465511.1| hypothetical protein CGSHi6P18H1_00492 [Haemophilus influenzae 6P18H1] gi|229846953|ref|ZP_04467059.1| hypothetical protein CGSHi7P49H1_05876 [Haemophilus influenzae 7P49H1] gi|229810037|gb|EEP45757.1| hypothetical protein CGSHi7P49H1_05876 [Haemophilus influenzae 7P49H1] gi|229811688|gb|EEP47386.1| hypothetical protein CGSHi6P18H1_00492 [Haemophilus influenzae 6P18H1] Length = 69 Score = 40.8 bits (95), Expect = 0.069, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 20/25 (80%) Query: 51 MVIVSGRSTKHVASIADNLISYLKK 75 M+I +G S++ V+++ADNLI+ KK Sbjct: 1 MIICTGTSSRQVSAMADNLITECKK 25 >gi|38234345|ref|NP_940112.1| hypothetical protein DIP1774 [Corynebacterium diphtheriae NCTC 13129] gi|38200608|emb|CAE50304.1| Conserved hypothetical protein [Corynebacterium diphtheriae] Length = 155 Score = 40.8 bits (95), Expect = 0.070, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 +I I+ + + I + V+ S + + V SI + + L Sbjct: 25 NIAVIDVSDVM-AISEVFVLASADNERQVRSIVEEIEDML 63 >gi|326773608|ref|ZP_08232891.1| iojap-like protein [Actinomyces viscosus C505] gi|326636838|gb|EGE37741.1| iojap-like protein [Actinomyces viscosus C505] Length = 139 Score = 40.8 bits (95), Expect = 0.070, Method: Composition-based stats. Identities = 9/43 (20%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 E + I+ + + D ++ SG + +HV +I D + + + Sbjct: 24 EHLAAIDVSERLG-LTDVFLLASGANDRHVHAIVDAVDEAMHR 65 >gi|330469620|ref|YP_004407363.1| iojap-like protein [Verrucosispora maris AB-18-032] gi|328812591|gb|AEB46763.1| iojap-like protein [Verrucosispora maris AB-18-032] Length = 134 Score = 40.5 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 9/39 (23%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 I I+ I D V+ + + + V +I D + L Sbjct: 26 IVIIDVGDQL-AITDAFVLAAASNERQVLAIVDAIEEAL 63 >gi|149173498|ref|ZP_01852128.1| hypothetical protein PM8797T_22178 [Planctomyces maris DSM 8797] gi|148847680|gb|EDL62013.1| hypothetical protein PM8797T_22178 [Planctomyces maris DSM 8797] Length = 87 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 5/30 (16%), Positives = 16/30 (53%) Query: 47 ICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + D +I + + + +IA+ + +K++ Sbjct: 1 MFDYFIIATATNQRQSNAIAEEIRVLMKRE 30 >gi|309775708|ref|ZP_07670706.1| iojap-related protein [Erysipelotrichaceae bacterium 3_1_53] gi|308916547|gb|EFP62289.1| iojap-related protein [Erysipelotrichaceae bacterium 3_1_53] Length = 78 Score = 40.5 bits (94), Expect = 0.084, Method: Composition-based stats. Identities = 11/26 (42%), Positives = 17/26 (65%) Query: 51 MVIVSGRSTKHVASIADNLISYLKKK 76 MVI S +S + V +IADN+ +K+ Sbjct: 1 MVICSAQSVRQVHAIADNIKDRVKEH 26 >gi|322493601|emb|CBZ28890.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103] Length = 534 Score = 40.5 bits (94), Expect = 0.086, Method: Composition-based stats. Identities = 11/63 (17%), Positives = 25/63 (39%), Gaps = 1/63 (1%) Query: 12 TADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + + + L LK D+C I+ + ++ D M+ + ++H+ A + Sbjct: 377 AKKARREDVKEIADILSSLKVRDLCCIDVSE-KTSNFDYMMFGTCEGSRHIHLAAWAVQD 435 Query: 72 YLK 74 K Sbjct: 436 ADK 438 >gi|256073482|ref|XP_002573059.1| hypothetical protein [Schistosoma mansoni] gi|238658230|emb|CAZ29291.1| expressed protein [Schistosoma mansoni] Length = 232 Score = 40.5 bits (94), Expect = 0.089, Method: Composition-based stats. Identities = 13/50 (26%), Positives = 23/50 (46%), Gaps = 2/50 (4%) Query: 25 ECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + L+ DI + + + MVI SG S +H+ + A ++ LK Sbjct: 97 KALERENIRDIVCLNV--NCNFLAPYMVIGSGLSKRHIQNTAVHIHKLLK 144 >gi|15800351|ref|NP_286363.1| hypothetical protein Z0783 [Escherichia coli O157:H7 EDL933] gi|24112063|ref|NP_706573.1| hypothetical protein SF0644 [Shigella flexneri 2a str. 301] gi|30062174|ref|NP_836345.1| hypothetical protein S0666 [Shigella flexneri 2a str. 2457T] gi|82543083|ref|YP_407030.1| hypothetical protein SBO_0501 [Shigella boydii Sb227] gi|82775906|ref|YP_402253.1| hypothetical protein SDY_0559 [Shigella dysenteriae Sd197] gi|12513538|gb|AAG54971.1|AE005242_15 hypothetical protein Z0783 [Escherichia coli O157:H7 str. EDL933] gi|42314|emb|CAA28199.1| unnamed protein product [Escherichia coli K-12] gi|13360133|dbj|BAB34098.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gi|24050889|gb|AAN42280.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|30040419|gb|AAP16151.1| hypothetical protein S0666 [Shigella flexneri 2a str. 2457T] gi|81240054|gb|ABB60764.1| conserved hypothetical protein [Shigella dysenteriae Sd197] gi|81244494|gb|ABB65202.1| conserved hypothetical protein [Shigella boydii Sb227] gi|209777098|gb|ACI86861.1| hypothetical protein ECs0675 [Escherichia coli] gi|209777100|gb|ACI86862.1| hypothetical protein ECs0675 [Escherichia coli] gi|209777102|gb|ACI86863.1| hypothetical protein ECs0675 [Escherichia coli] gi|209777104|gb|ACI86864.1| hypothetical protein ECs0675 [Escherichia coli] gi|209777106|gb|ACI86865.1| hypothetical protein ECs0675 [Escherichia coli] Length = 69 Score = 40.1 bits (93), Expect = 0.099, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 17/22 (77%) Query: 51 MVIVSGRSTKHVASIADNLISY 72 M+I +G S++HV SIAD+++ Sbjct: 1 MIICTGTSSRHVMSIADHVVQE 22 >gi|332025294|gb|EGI65465.1| Uncharacterized protein C7orf30 [Acromyrmex echinatior] Length = 258 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++E L+ KA++I + + D +++V+ S KH+ ++A + K Sbjct: 123 IDQLVELLERDKAKNIFVASVPKEYAYV-DYIIVVTANSQKHMNALATFIRKVYK 176 >gi|303282795|ref|XP_003060689.1| predicted protein [Micromonas pusilla CCMP1545] gi|226458160|gb|EEH55458.1| predicted protein [Micromonas pusilla CCMP1545] Length = 1624 Score = 40.1 bits (93), Expect = 0.12, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 ++ L + D+ HI R ++ +I + +S +H+ +A + +K Sbjct: 339 VDILLRARGVDVVHIPLGE-RCKWTEHFIIATAKSPRHIRMLAGAALHAVK 388 >gi|297243434|ref|ZP_06927367.1| Iojap-like protein [Gardnerella vaginalis AMD] gi|296888681|gb|EFH27420.1| Iojap-like protein [Gardnerella vaginalis AMD] Length = 134 Score = 39.7 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + S I LKA + + + L I D M++VS + + V ++A+ + Sbjct: 1 MTALESSISAIRIAAAAADRLKATNEQAFDVSDLLG-ITDAMLVVSASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|298252546|ref|ZP_06976340.1| Iojap-like protein [Gardnerella vaginalis 5-1] gi|297532910|gb|EFH71794.1| Iojap-like protein [Gardnerella vaginalis 5-1] Length = 134 Score = 39.7 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + S I LKA + + + L I D M++VS + + V ++A+ + Sbjct: 1 MTALESSISAIRIAAAAADRLKATNEQAFDVSDLLG-ITDAMLVVSASNERQVLAVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|326791205|ref|YP_004309026.1| iojap-like protein [Clostridium lentocellum DSM 5427] gi|326541969|gb|ADZ83828.1| iojap-like protein [Clostridium lentocellum DSM 5427] Length = 114 Score = 39.7 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 6/53 (11%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Query: 21 ATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 + + K + ++ + + + +I + K ++AD + L Sbjct: 10 KQIATAINNKKVVKLDVLDVAQ-LTPLAELFIIAIAANVKQTKAMADEVEECL 61 >gi|302869321|ref|YP_003837958.1| iojap-like protein [Micromonospora aurantiaca ATCC 27029] gi|315504204|ref|YP_004083091.1| iojap-like protein [Micromonospora sp. L5] gi|302572180|gb|ADL48382.1| iojap-like protein [Micromonospora aurantiaca ATCC 27029] gi|315410823|gb|ADU08940.1| iojap-like protein [Micromonospora sp. L5] Length = 134 Score = 39.7 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 I I+ I D ++ + + + V +I D + L + Sbjct: 26 IVIIDVGDQL-AITDAFLLAAAPNERQVLAIVDAIEERLLE 65 >gi|227495886|ref|ZP_03926197.1| iojap family protein [Actinomyces urogenitalis DSM 15434] gi|226834563|gb|EEH66946.1| iojap family protein [Actinomyces urogenitalis DSM 15434] Length = 136 Score = 39.7 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 8/41 (19%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 E+I I+ + + D ++VS + + V ++ D + + Sbjct: 24 EEIIAIDVSERL-ALTDVFLVVSAANDRQVRAVVDAVDEAM 63 >gi|149919305|ref|ZP_01907787.1| iojap protein family [Plesiocystis pacifica SIR-1] gi|149819805|gb|EDM79229.1| iojap protein family [Plesiocystis pacifica SIR-1] Length = 243 Score = 39.3 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 11/61 (18%), Positives = 24/61 (39%), Gaps = 1/61 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 L + + +E E A + T + D +++S RS + V + + + L Sbjct: 11 ELPAALNVAIEAAIERGARAPVVLRLTEVAGY-TDWALLMSARSDRQVRGVVEGVREALA 69 Query: 75 K 75 + Sbjct: 70 Q 70 >gi|218202385|gb|EEC84812.1| hypothetical protein OsI_31882 [Oryza sativa Indica Group] Length = 225 Score = 39.3 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + E+KA DI + L +I++ S + +I+ + Sbjct: 118 AKVASEVKAADIRVLFVKPLV-YWTRFFIILTAFSNAQIDAISSKMRD 164 >gi|320532238|ref|ZP_08033101.1| ribosome-associated protein, iojap family [Actinomyces sp. oral taxon 171 str. F0337] gi|320135540|gb|EFW27625.1| ribosome-associated protein, iojap family [Actinomyces sp. oral taxon 171 str. F0337] Length = 139 Score = 39.3 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 E + I+ + + D ++ SG + +HV +I D + + Sbjct: 24 EHLAAIDVSERLG-LTDVFLLASGANDRHVHAIVDAVDEAM 63 >gi|308233548|ref|ZP_07664285.1| iojap homolog [Atopobium vaginae DSM 15829] Length = 138 Score = 39.3 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L KAE I R +C MV+ + R+ H+ ++ ++ + K+ Sbjct: 6 KTLALCVAQILHSKKAEHTALITLPPERG-LCPYMVVATARNRIHLHALLQDVEDGVHKQ 64 >gi|212550943|ref|YP_002309260.1| hypothetical protein CFPG_586 [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] gi|212549181|dbj|BAG83849.1| conserved hypothetical protein [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2] Length = 122 Score = 39.3 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 19/35 (54%) Query: 35 ICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 I ++ T L + IC+ ++I G V ++ D++ Sbjct: 26 ITVLDLTKLENSICEYLIIAQGNIPNQVLALCDSV 60 >gi|255713328|ref|XP_002552946.1| KLTH0D05170p [Lachancea thermotolerans] gi|322518416|sp|C5DGG6|ATP25_LACTC RecName: Full=ATPase synthesis protein 25, mitochondrial; Flags: Precursor gi|238934326|emb|CAR22508.1| KLTH0D05170p [Lachancea thermotolerans] Length = 620 Score = 39.3 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 14/79 (17%), Positives = 31/79 (39%), Gaps = 8/79 (10%) Query: 6 EKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSLR-------SLICDNMVIVSGR 57 +Q + + + T+ L++ D+ + + S I D MV+ + + Sbjct: 110 HQQEIVFPANSPKSLETIATFLRDKLGLSDVLIFDLRDSQDEQVTAASKISDFMVMATAK 169 Query: 58 STKHVASIADNLISYLKKK 76 S +H L + LK++ Sbjct: 170 SGRHGHKSFIELNTLLKQE 188 >gi|50310387|ref|XP_455213.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140] gi|74605425|sp|Q6CLH6|ATP25_KLULA RecName: Full=ATPase synthesis protein 25, mitochondrial; Flags: Precursor gi|49644349|emb|CAG97921.1| KLLA0F02948p [Kluyveromyces lactis] Length = 562 Score = 39.3 bits (91), Expect = 0.20, Method: Composition-based stats. Identities = 13/67 (19%), Positives = 31/67 (46%), Gaps = 6/67 (8%) Query: 15 HLDSCIATVMECLKELKA-EDICHIENTSLRS-----LICDNMVIVSGRSTKHVASIADN 68 + + + T+ + L + A DI + S + ++I + +S +H+ + D Sbjct: 67 EIPASLETISKYLNDKLAVTDIVVFDTAHSSSATSIQSMASYVLIGTVKSFRHLQNCNDE 126 Query: 69 LISYLKK 75 LI ++K+ Sbjct: 127 LIKFIKE 133 >gi|156543658|ref|XP_001605049.1| PREDICTED: similar to ENSANGP00000011454 [Nasonia vitripennis] Length = 223 Score = 38.9 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++E LK+ A I S + D +V+ SG+ST+H+ ++A + K Sbjct: 89 IEDLVELLKKDNARQIFVATVPKEYSYV-DYIVVASGKSTRHLHALATFVRKIYK 142 >gi|115479905|ref|NP_001063546.1| Os09g0493600 [Oryza sativa Japonica Group] gi|113631779|dbj|BAF25460.1| Os09g0493600 [Oryza sativa Japonica Group] gi|215686802|dbj|BAG89652.1| unnamed protein product [Oryza sativa Japonica Group] gi|222641842|gb|EEE69974.1| hypothetical protein OsJ_29867 [Oryza sativa Japonica Group] Length = 225 Score = 38.9 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 9/48 (18%), Positives = 19/48 (39%), Gaps = 1/48 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + E+KA DI + L +I++ S + +I+ + Sbjct: 118 AKVASEVKAADIRVLFVKPLV-YWTRFFIILTAFSNAQIDAISSKMRD 164 >gi|328944341|ref|ZP_08241805.1| hypothetical protein HMPREF0091_11030 [Atopobium vaginae DSM 15829] gi|327491260|gb|EGF23035.1| hypothetical protein HMPREF0091_11030 [Atopobium vaginae DSM 15829] Length = 144 Score = 38.9 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/60 (21%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Query: 17 DSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + V + L KAE I R +C MV+ + R+ H+ ++ ++ + K+ Sbjct: 12 KTLALCVAQILHSKKAEHTALITLPPERG-LCPYMVVATARNRIHLHALLQDVEDGVHKQ 70 >gi|146093898|ref|XP_001467060.1| hypothetical protein [Leishmania infantum JPCM5] gi|134071424|emb|CAM70111.1| conserved hypothetical protein [Leishmania infantum JPCM5] Length = 479 Score = 38.9 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 11/69 (15%), Positives = 26/69 (37%), Gaps = 5/69 (7%) Query: 6 EKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 + + + + + L LK D+C I+ + ++ D M+ + +H+ Sbjct: 320 QDAKKARMEDVKE----IADILSSLKVRDLCCIDVSE-KTSNFDYMMFGTCEGARHIHLA 374 Query: 66 ADNLISYLK 74 A + K Sbjct: 375 AWAVQDADK 383 >gi|324525704|gb|ADY48583.1| Unknown [Ascaris suum] Length = 259 Score = 38.9 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +++ L+ +A DI I + +VI S ++ +H ++ + LK Sbjct: 138 LPELVDVLRAERAADIVCISVPPSEGPYHN-IVICSPQNRRHGEALLQTIRKCLK 191 >gi|302854418|ref|XP_002958717.1| hypothetical protein VOLCADRAFT_108272 [Volvox carteri f. nagariensis] gi|300255957|gb|EFJ40237.1| hypothetical protein VOLCADRAFT_108272 [Volvox carteri f. nagariensis] Length = 774 Score = 38.9 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 10/92 (10%), Positives = 31/92 (33%), Gaps = 22/92 (23%) Query: 3 ANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTS------------------LR 44 A +Q + A + +++ +A+D+ I ++ Sbjct: 494 ARRRQQLMVAAARPEEIATWLVKA----RAQDVVVISDSDSDGEAGSGTTGSEIGFGVGS 549 Query: 45 SLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 V+ + S +H + A+ + ++++ Sbjct: 550 GSRVSYTVLATALSQRHAYACAEAVRFQVRER 581 >gi|114798826|ref|YP_759033.1| iojap-like protein [Hyphomonas neptunium ATCC 15444] gi|114739000|gb|ABI77125.1| iojap homolog [Hyphomonas neptunium ATCC 15444] Length = 80 Score = 38.9 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 19/25 (76%) Query: 51 MVIVSGRSTKHVASIADNLISYLKK 75 M+I SGRS +HVA++A ++ +KK Sbjct: 1 MIIASGRSGRHVAALASSVAQEVKK 25 >gi|255084435|ref|XP_002508792.1| predicted protein [Micromonas sp. RCC299] gi|226524069|gb|ACO70050.1| predicted protein [Micromonas sp. RCC299] Length = 148 Score = 38.9 bits (90), Expect = 0.26, Method: Composition-based stats. Identities = 7/53 (13%), Positives = 20/53 (37%), Gaps = 1/53 (1%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 E +A DI + T V+ + + + ++A+ + ++ + Sbjct: 6 ATLADETRAADIRVLGVTKSVH-WARYFVLATAFNRPQMQAVANKMRDHVNEN 57 >gi|289524526|ref|ZP_06441380.1| iojap-related protein [Anaerobaculum hydrogeniformans ATCC BAA-1850] gi|289502233|gb|EFD23397.1| iojap-related protein [Anaerobaculum hydrogeniformans ATCC BAA-1850] Length = 104 Score = 38.5 bits (89), Expect = 0.28, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Query: 33 EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 +DI I+ + S D I + S H+ ++ D + L ++ Sbjct: 1 QDIISIDISE-VSGFADIFFISNSNSESHMKALLDTITDALDER 43 >gi|312083831|ref|XP_003144026.1| hypothetical protein LOAG_08446 [Loa loa] gi|307760813|gb|EFO20047.1| hypothetical protein LOAG_08446 [Loa loa] Length = 175 Score = 38.5 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 12/62 (19%), Positives = 28/62 (45%), Gaps = 9/62 (14%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICD----NMVIVSGRSTKHVASIADNLISYLKK 75 + +++ L+ ++EDI I+ I D ++I + + +H ++ + K Sbjct: 53 VKEIVDILRAERSEDIVCIKV-----PINDKHERYIIICTPHNMRHGEAMVLAIRKCFKL 107 Query: 76 KN 77 KN Sbjct: 108 KN 109 >gi|300715829|ref|YP_003740632.1| conserved uncharacterized protein YbeB, fragment [Erwinia billingiae Eb661] gi|299061665|emb|CAX58781.1| conserved uncharacterized protein YbeB, probable fragment [Erwinia billingiae Eb661] Length = 69 Score = 38.5 bits (89), Expect = 0.34, Method: Composition-based stats. Identities = 12/22 (54%), Positives = 18/22 (81%) Query: 51 MVIVSGRSTKHVASIADNLISY 72 M+I +G ST+HVASIAD+++ Sbjct: 1 MIICTGTSTRHVASIADHVVQE 22 >gi|169333986|ref|ZP_02861179.1| hypothetical protein ANASTE_00378 [Anaerofustis stercorihominis DSM 17244] gi|169258703|gb|EDS72669.1| hypothetical protein ANASTE_00378 [Anaerofustis stercorihominis DSM 17244] Length = 112 Score = 38.1 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 8/42 (19%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 24 MECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI 65 ++ L+E K +I ++ T + + +I + S + S+ Sbjct: 11 IDLLEEKKLTNIYAVDVTD-LTAEANTFIIATAGSDRQAKSV 51 >gi|195169798|ref|XP_002025701.1| GL20701 [Drosophila persimilis] gi|194109194|gb|EDW31237.1| GL20701 [Drosophila persimilis] Length = 238 Score = 38.1 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++E L++ +DI + D++V+ SGRS +H+ S A+ + K Sbjct: 95 IEDLVELLRKENVDDIFVCYVPEDLKYV-DHLVVCSGRSYRHMISTAEFVRRMFK 148 >gi|195125730|ref|XP_002007330.1| GI12878 [Drosophila mojavensis] gi|193918939|gb|EDW17806.1| GI12878 [Drosophila mojavensis] Length = 233 Score = 38.1 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ + A+ + K Sbjct: 103 VEDLVELLRKENVDDIFVCYVPEELKYV-DHLVVCSGRSYRHMLATAEFVRRMFK 156 >gi|326409846|gb|ADZ66911.1| iojap-related protein [Brucella melitensis M28] Length = 83 Score = 38.1 bits (88), Expect = 0.44, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 19/25 (76%) Query: 51 MVIVSGRSTKHVASIADNLISYLKK 75 M++ SGRS +HV ++ D+L+ L++ Sbjct: 1 MIVASGRSHRHVTAVTDHLVQALRE 25 >gi|294654948|ref|XP_457031.2| DEHA2B01496p [Debaryomyces hansenii CBS767] gi|322518666|sp|Q6BXN8|ATP25_DEBHA RecName: Full=ATPase synthesis protein 25, mitochondrial; Flags: Precursor gi|199429577|emb|CAG85017.2| DEHA2B01496p [Debaryomyces hansenii] Length = 648 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Query: 33 EDICHIENTSLR--------SLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 EDI + T L + D M+I +G+S KH+ ++ L +Y+K Sbjct: 122 EDIELFDLTQLDPENEYHADNQPTDYMIICTGKSEKHIYKASNELRTYIKHN 173 >gi|328787235|ref|XP_003250905.1| PREDICTED: uncharacterized protein C7orf30-like [Apis mellifera] Length = 254 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS--YLKK 75 I ++ L++ ++I S S D +VIV+GRS KH+ ++A + LKK Sbjct: 112 IEDLVSLLQKDNVKNIFVASMASELSY-ADYIVIVTGRSNKHMKALASFVRKVYKLKK 168 >gi|198463395|ref|XP_001352808.2| GA21588 [Drosophila pseudoobscura pseudoobscura] gi|198151234|gb|EAL30308.2| GA21588 [Drosophila pseudoobscura pseudoobscura] Length = 245 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++E L++ +DI + D++V+ SGRS +H+ S A+ + K Sbjct: 106 IEDLVELLRKENVDDIFVCYVPEDLKYV-DHLVVCSGRSYRHMISTAEFVRRMFK 159 >gi|270007083|gb|EFA03531.1| hypothetical protein TcasGA2_TC013534 [Tribolium castaneum] Length = 190 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 1/57 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 I ++E L AEDI + + + +V+G+S KH+ +IA + KKK Sbjct: 56 IEDLIEVLHSENAEDIFVAAVPKEIQYV-EYICVVTGKSHKHMKAIAQFVRMIYKKK 111 >gi|6684113|gb|AAF23489.1|AF209778_1 312 protein [Drosophila melanogaster] Length = 241 Score = 37.8 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ S A+ + K Sbjct: 104 VEDLVELLRKENVDDIFVCYVPENLKYV-DHLVVCSGRSYRHMLSTAEFVRRMFK 157 >gi|183221168|ref|YP_001839164.1| hypothetical protein LEPBI_I1782 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] gi|189911259|ref|YP_001962814.1| hypothetical protein LBF_1729 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167775935|gb|ABZ94236.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'] gi|167779590|gb|ABZ97888.1| Conserved hypothetical protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'] Length = 121 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 11/60 (18%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Query: 15 HLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + + L E K + I ++ + S + VI + ++ S A ++ Y+K Sbjct: 7 ETLEHLKKIKQTLVEKKCDQIQFLDLKDVHSYLS-LFVIATVKTETQGRSCAKDIDKYMK 65 >gi|159898820|ref|YP_001545067.1| iojap-like protein [Herpetosiphon aurantiacus ATCC 23779] gi|159891859|gb|ABX04939.1| iojap-like protein [Herpetosiphon aurantiacus ATCC 23779] Length = 91 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 6/39 (15%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Query: 38 IENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 ++ L + D +VI + + + V ++ + L ++ Sbjct: 2 LDVRPLAT-FADFLVICTAGNERMVRAVVKEIDDQLVQE 39 >gi|195336563|ref|XP_002034905.1| GM14405 [Drosophila sechellia] gi|194127998|gb|EDW50041.1| GM14405 [Drosophila sechellia] Length = 241 Score = 37.8 bits (87), Expect = 0.56, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ S A+ + K Sbjct: 104 VEDLVELLRKENVDDIFVCYVPENLKYV-DHLVVCSGRSYRHMLSTAEFVRRMFK 157 >gi|195017778|ref|XP_001984662.1| GH14903 [Drosophila grimshawi] gi|193898144|gb|EDV97010.1| GH14903 [Drosophila grimshawi] Length = 230 Score = 37.8 bits (87), Expect = 0.56, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ S RS +H+ + A+ + K Sbjct: 103 VEDLVELLRKENVDDIFVCYVPEELKYV-DHLVVCSARSYRHMLATAEFVRRMFK 156 >gi|219684148|ref|ZP_03539092.1| domain of unknown function family protein [Borrelia garinii PBr] gi|219685605|ref|ZP_03540421.1| conserved hypothetical protein [Borrelia garinii Far04] gi|219672137|gb|EED29190.1| domain of unknown function family protein [Borrelia garinii PBr] gi|219672883|gb|EED29906.1| conserved hypothetical protein [Borrelia garinii Far04] Length = 116 Score = 37.8 bits (87), Expect = 0.58, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 30/67 (44%), Gaps = 4/67 (5%) Query: 13 ADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA-DNL 69 + + I T+ + + + D+ I +++ D +I + S K + ++ D + Sbjct: 1 MEDMLEVNDINTLCKIISDFNGIDVIGINVSNI-CNWTDFFIIATFVSFKQMEALYHDKI 59 Query: 70 ISYLKKK 76 + + K++ Sbjct: 60 VKFFKER 66 >gi|216263689|ref|ZP_03435684.1| domain of unknown function superfamily protein [Borrelia afzelii ACA-1] gi|215980533|gb|EEC21354.1| domain of unknown function superfamily protein [Borrelia afzelii ACA-1] Length = 116 Score = 37.8 bits (87), Expect = 0.59, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 29/67 (43%), Gaps = 4/67 (5%) Query: 13 ADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI-ADNL 69 + + I + + + + D+ I+ ++ D +I + S K + ++ D + Sbjct: 1 MEDMLKVSDINALCKIISDFNGIDVIGIDVGNI-CNWTDFFIIATFVSFKQMEALYIDKI 59 Query: 70 ISYLKKK 76 + + K+K Sbjct: 60 VKFFKEK 66 >gi|19923046|ref|NP_612105.1| 312 [Drosophila melanogaster] gi|7292076|gb|AAF47489.1| 312 [Drosophila melanogaster] gi|16648170|gb|AAL25350.1| GH16625p [Drosophila melanogaster] gi|220945456|gb|ACL85271.1| 312-PA [synthetic construct] gi|220955342|gb|ACL90214.1| 312-PA [synthetic construct] Length = 241 Score = 37.4 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ S A+ + K Sbjct: 104 VEDLVELLRKENVDDIFVCYVPENLKYV-DHLVVCSGRSYRHMLSTAEFVRRMFK 157 >gi|322823408|gb|EFZ29167.1| hypothetical protein TCSYLVIO_4589 [Trypanosoma cruzi] Length = 379 Score = 37.4 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 13/72 (18%), Positives = 31/72 (43%), Gaps = 6/72 (8%) Query: 2 LANTEKQALQT-ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 + T + A + + + + L+ LK DIC I+ ++ ++ D M++ + + Sbjct: 215 IDETWQDARKAHIEDVIELLEV----LRSLKVRDICAIDVSA-KTSNFDYMLVGTCEGPR 269 Query: 61 HVASIADNLISY 72 H+ A + Sbjct: 270 HIHLAAWAVQEA 281 >gi|195375815|ref|XP_002046695.1| GJ13019 [Drosophila virilis] gi|194153853|gb|EDW69037.1| GJ13019 [Drosophila virilis] Length = 235 Score = 37.4 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ S RS +H+ + A+ + K Sbjct: 105 VEDLVELLRKENVDDIFVCYVPEELKYV-DHLVVCSARSYRHMLATAEFVRRMFK 158 >gi|251772047|gb|EES52619.1| conserved protein of unknown function [Leptospirillum ferrodiazotrophum] Length = 156 Score = 37.4 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 10/74 (13%), Positives = 30/74 (40%), Gaps = 3/74 (4%) Query: 2 LANTEKQALQTADHLDSCIA--TVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRST 59 + +T + ++ + D+ + E L E K D+ ++ D +++ + Sbjct: 1 MGSTTDRKVRKEEMSDTLARAMRLAEVLLEKKIGDVWVVDVA-GLCGYADCLILGDAENE 59 Query: 60 KHVASIADNLISYL 73 +H+ + + L + Sbjct: 60 RHMQAALEGLDQAI 73 >gi|195428936|ref|XP_002062521.1| GK17581 [Drosophila willistoni] gi|194158606|gb|EDW73507.1| GK17581 [Drosophila willistoni] Length = 236 Score = 37.4 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L+ +DI + D++VI SGRS +H+ + A+ + K Sbjct: 109 VEDLVELLRRENMDDIFVCYVPEELKYV-DHLVICSGRSYRHMLASAEFVRRMFK 162 >gi|111115617|ref|YP_710235.1| hypothetical protein BAPKO_0834 [Borrelia afzelii PKo] gi|110890891|gb|ABH02059.1| hypothetical protein BAPKO_0834 [Borrelia afzelii PKo] Length = 116 Score = 37.4 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 11/67 (16%), Positives = 29/67 (43%), Gaps = 4/67 (5%) Query: 13 ADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI-ADNL 69 + + I + + + + D+ I+ S+ D +I + S K + ++ D + Sbjct: 1 MEDMLKVSDINALCKIISDFNGIDVIGIDVGSI-CNWTDFFIIATFVSFKQMEALYIDKI 59 Query: 70 ISYLKKK 76 + + K+K Sbjct: 60 VKFFKEK 66 >gi|329298820|ref|ZP_08256156.1| ribosome-associated protein [Plautia stali symbiont] Length = 67 Score = 37.4 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 17/22 (77%) Query: 51 MVIVSGRSTKHVASIADNLISY 72 M+I +G S +HV+SIAD+++ Sbjct: 1 MIICTGTSNRHVSSIADHVMQE 22 >gi|308804171|ref|XP_003079398.1| IojAP protein-like (ISS) [Ostreococcus tauri] gi|116057853|emb|CAL54056.1| IojAP protein-like (ISS) [Ostreococcus tauri] Length = 152 Score = 37.4 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 7/46 (15%), Positives = 17/46 (36%), Gaps = 1/46 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + +A +I +E + +VI + + + +I L Sbjct: 38 ADDTRAVEIEVLEVSKKV-YYARYVVIATAFNRPQMNAICAKLRDR 82 >gi|226479074|emb|CAX73032.1| hypothetical protein [Schistosoma japonicum] Length = 229 Score = 37.4 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 14/65 (21%), Positives = 30/65 (46%), Gaps = 6/65 (9%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 +++ + + + L+ ++ DI + S + MVI SG + +HV + A ++ Sbjct: 85 MKSLFDVPELMEVL--RLENIR--DIVCLSMNH--SFLAPYMVIGSGVTRRHVQNTAIHI 138 Query: 70 ISYLK 74 LK Sbjct: 139 HKLLK 143 >gi|283783465|ref|YP_003374219.1| iojap-like protein [Gardnerella vaginalis 409-05] gi|283441407|gb|ADB13873.1| iojap-like protein [Gardnerella vaginalis 409-05] Length = 140 Score = 37.4 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 26/64 (40%), Gaps = 1/64 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 + + S I LKA + + + L I D M++VS + + V +A+ + Sbjct: 1 MTALESSISAIRIAAAAADRLKATNEQAFDVSDLLG-ITDAMLVVSASNERQVLGVAEEI 59 Query: 70 ISYL 73 L Sbjct: 60 EKDL 63 >gi|218674084|ref|ZP_03523753.1| hypothetical protein RetlG_22407 [Rhizobium etli GR56] Length = 70 Score = 37.4 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Query: 2 LANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMV 52 LA K A + AD + V+ L++ KAEDI I+ +S + D M+ Sbjct: 21 LAVLPKSAERGADAAARALEAVLASLEDSKAEDIVTIDIA-GKSALGDYMI 70 >gi|114569758|ref|YP_756438.1| DNA repair protein RadA [Maricaulis maris MCS10] gi|114340220|gb|ABI65500.1| DNA replication and repair protein RadA [Maricaulis maris MCS10] Length = 458 Score = 37.4 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 5/55 (9%) Query: 25 ECLKELKAE--DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKKN 77 + L LKAE DI I+ S++++ D + G V + A L+ + KK N Sbjct: 158 DILDGLKAEKPDIVVID--SIQTVWSDQLAAAPGTVA-QVRACAQELVRFAKKSN 209 >gi|194748507|ref|XP_001956686.1| GF24458 [Drosophila ananassae] gi|190623968|gb|EDV39492.1| GF24458 [Drosophila ananassae] Length = 242 Score = 37.0 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ S A+ + K Sbjct: 106 VEDLVELLRKENVDDIFVCSVPEDLKYV-DHLVVCSGRSYRHMLSTAEFVRRMFK 159 >gi|71411372|ref|XP_807938.1| hypothetical protein [Trypanosoma cruzi strain CL Brener] gi|70872041|gb|EAN86087.1| hypothetical protein, conserved [Trypanosoma cruzi] Length = 379 Score = 37.0 bits (85), Expect = 0.91, Method: Composition-based stats. Identities = 13/72 (18%), Positives = 31/72 (43%), Gaps = 6/72 (8%) Query: 2 LANTEKQALQT-ADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 + T + A + + + + L+ LK DIC I+ ++ ++ D M++ + + Sbjct: 215 IDETWQDARKAHIEDVIELLEV----LRSLKVRDICAIDVSA-KTSNFDYMLLGTCEGPR 269 Query: 61 HVASIADNLISY 72 H+ A + Sbjct: 270 HIHLAAWAVQEA 281 >gi|268576168|ref|XP_002643064.1| Hypothetical protein CBG22981 [Caenorhabditis briggsae] Length = 210 Score = 37.0 bits (85), Expect = 1.0, Method: Composition-based stats. Identities = 17/96 (17%), Positives = 39/96 (40%), Gaps = 24/96 (25%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKAEDICHIE-NTSLRSLICDNM------------ 51 T++ +D +D + T++ L E KA D+ ++ + + + Sbjct: 44 TKRFRRPESDDVD-FVETIVGALGEQKARDVFVVKSDDKEMTPYSHRVGHRTWPRKIQLT 102 Query: 52 ----------VIVSGRSTKHVASIADNLISYLKKKN 77 ++ S +++ A+I++NL LK +N Sbjct: 103 GHHHRFPLLQIVCSVFNSRQAAAISENLREILKMEN 138 >gi|224534498|ref|ZP_03675074.1| conserved hypothetical protein [Borrelia spielmanii A14S] gi|224514175|gb|EEF84493.1| conserved hypothetical protein [Borrelia spielmanii A14S] Length = 101 Score = 36.6 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 27/67 (40%), Gaps = 4/67 (5%) Query: 13 ADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI-ADNL 69 + + I + + + + D+ I + D +I + S K + ++ D + Sbjct: 1 MEDMLKASDINALCKIISDFNGIDVIGINVSD-VCNWTDFFIIATFVSFKQMEALYLDKI 59 Query: 70 ISYLKKK 76 + + K+K Sbjct: 60 VKFFKEK 66 >gi|322518453|sp|B5VPM5|ATP25_YEAS6 RecName: Full=ATPase synthesis protein 25, mitochondrial; AltName: Full=OLI1 mRNA stabilization factor; Flags: Precursor gi|207342340|gb|EDZ70131.1| YMR098Cp-like protein [Saccharomyces cerevisiae AWRI1631] Length = 612 Score = 36.6 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSL-------RSLICDNMVIVSG 56 T + L+ + + + + L +D + + + D MVI + Sbjct: 89 TMNKELEIPKTSPNSLRKIADLLTGKLGLDDFLVFDLRKKSPNSVSAVNKLGDFMVICTA 148 Query: 57 RSTKHVASIADNLISYLKKK 76 RSTKH L +LK + Sbjct: 149 RSTKHCHKSFLELNKFLKHE 168 >gi|6323745|ref|NP_013816.1| Atp25p [Saccharomyces cerevisiae S288c] gi|2497148|sp|Q03153|ATP25_YEAST RecName: Full=ATPase synthesis protein 25, mitochondrial; AltName: Full=OLI1 mRNA stabilization factor; Flags: Precursor gi|322518452|sp|C7GL28|ATP25_YEAS2 RecName: Full=ATPase synthesis protein 25, mitochondrial; AltName: Full=OLI1 mRNA stabilization factor; Flags: Precursor gi|854435|emb|CAA89899.1| unknown [Saccharomyces cerevisiae] gi|256273548|gb|EEU08482.1| Atp25p [Saccharomyces cerevisiae JAY291] gi|285814100|tpg|DAA09995.1| TPA: Atp25p [Saccharomyces cerevisiae S288c] Length = 612 Score = 36.6 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSL-------RSLICDNMVIVSG 56 T + L+ + + + + L +D + + + D MVI + Sbjct: 89 TMNKELEIPKTSPNSLRKIADLLTGKLGLDDFLVFDLRKKSPNSVSAVNKLGDFMVICTA 148 Query: 57 RSTKHVASIADNLISYLKKK 76 RSTKH L +LK + Sbjct: 149 RSTKHCHKSFLELNKFLKHE 168 >gi|322518451|sp|B3LLY9|ATP25_YEAS1 RecName: Full=ATPase synthesis protein 25, mitochondrial; AltName: Full=OLI1 mRNA stabilization factor; Flags: Precursor gi|322518455|sp|C8ZEV0|ATP25_YEAS8 RecName: Full=ATPase synthesis protein 25, mitochondrial; AltName: Full=OLI1 mRNA stabilization factor; Flags: Precursor gi|190408327|gb|EDV11592.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a] gi|259148671|emb|CAY81916.1| Atp25p [Saccharomyces cerevisiae EC1118] Length = 612 Score = 36.6 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSL-------RSLICDNMVIVSG 56 T + L+ + + + + L +D + + + D MVI + Sbjct: 89 TMNKELEIPKTSPNSLRKIADLLTGKLGLDDFLVFDLRKKSPNSVSAVNKLGDFMVICTA 148 Query: 57 RSTKHVASIADNLISYLKKK 76 RSTKH L +LK + Sbjct: 149 RSTKHCHKSFLELNKFLKHE 168 >gi|283768322|ref|ZP_06341234.1| iojap-like protein [Bulleidia extructa W1219] gi|283104714|gb|EFC06086.1| iojap-like protein [Bulleidia extructa W1219] Length = 91 Score = 36.6 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 7/32 (21%), Positives = 16/32 (50%) Query: 42 SLRSLICDNMVIVSGRSTKHVASIADNLISYL 73 D VIV+ ++ +H++S+ ++ L Sbjct: 2 REVCSYTDYFVIVTAKNLRHLSSLLNDCEKEL 33 >gi|323347181|gb|EGA81456.1| Atp25p [Saccharomyces cerevisiae Lalvin QA23] Length = 618 Score = 36.6 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSL-------RSLICDNMVIVSG 56 T + L+ + + + + L +D + + + D MVI + Sbjct: 89 TMNKELEIPKTSPNSLRKIADLLTGKLGLDDFLVFDLRKKSPNSVSAVNKLGDFMVICTA 148 Query: 57 RSTKHVASIADNLISYLKKK 76 RSTKH L +LK + Sbjct: 149 RSTKHCHKSFLELNKFLKHE 168 >gi|323303607|gb|EGA57398.1| Atp25p [Saccharomyces cerevisiae FostersB] Length = 612 Score = 36.6 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSL-------RSLICDNMVIVSG 56 T + L+ + + + + L +D + + + D MVI + Sbjct: 89 TMNKELEIPKTSPNSLRKIADLLTGKLGLDDFLVFDLRKKSPNSVSAVNKLGDFMVICTA 148 Query: 57 RSTKHVASIADNLISYLKKK 76 RSTKH L +LK + Sbjct: 149 RSTKHCHKSFLELNKFLKHE 168 >gi|284009236|emb|CBA76334.1| conserved hypothetical protein [Arsenophonus nasoniae] Length = 69 Score = 36.6 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 18/25 (72%) Query: 51 MVIVSGRSTKHVASIADNLISYLKK 75 M+I +G S +H+AS++D LI +K Sbjct: 1 MIICTGTSNRHLASVSDKLIEACRK 25 >gi|51599035|ref|YP_073223.1| hypothetical protein BG0808 [Borrelia garinii PBi] gi|51573606|gb|AAU07631.1| conserved hypothetical protein [Borrelia garinii PBi] Length = 116 Score = 36.6 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 10/67 (14%), Positives = 30/67 (44%), Gaps = 4/67 (5%) Query: 13 ADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIA-DNL 69 + + I T+ + + + D+ I +++ D +I + S K + ++ D + Sbjct: 1 MEDMLKVNDINTLCKIITDFNGIDVIGINVSNI-CNWTDFFIIATFVSFKQMEALYHDKI 59 Query: 70 ISYLKKK 76 + + K++ Sbjct: 60 VKFFKER 66 >gi|170050607|ref|XP_001861386.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167872187|gb|EDS35570.1| conserved hypothetical protein [Culex quinquefasciatus] Length = 267 Score = 36.6 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 12/55 (21%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L+ AE++ + + D + +V+G S +H+ IA+ + K Sbjct: 119 IDDLVTVLRLNNAENVFVCSVSQEIKYV-DYICVVTGMSFRHMRGIAEFVRKIFK 172 >gi|74311173|ref|YP_309592.1| hypothetical protein SSON_0591 [Shigella sonnei Ss046] gi|73854650|gb|AAZ87357.1| conserved hypothetical protein [Shigella sonnei Ss046] Length = 69 Score = 36.2 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 11/22 (50%), Positives = 16/22 (72%) Query: 51 MVIVSGRSTKHVASIADNLISY 72 M+I SG S++HV SIAD ++ Sbjct: 1 MIICSGTSSRHVMSIADLIVQE 22 >gi|322518454|sp|A6ZMF5|ATP25_YEAS7 RecName: Full=ATPase synthesis protein 25, mitochondrial; AltName: Full=OLI1 mRNA stabilization factor; Flags: Precursor gi|151946254|gb|EDN64485.1| conserved protein [Saccharomyces cerevisiae YJM789] Length = 612 Score = 36.2 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 16/80 (20%), Positives = 29/80 (36%), Gaps = 8/80 (10%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSL-------RSLICDNMVIVSG 56 T + L+ + + + + L +D + + + D MVI + Sbjct: 89 TMNKELEIPKTSPNSLRKIADLLTGKLGLDDFLVFDLRKKSPNSVSAVNKLGDFMVICTA 148 Query: 57 RSTKHVASIADNLISYLKKK 76 RSTKH L +LK + Sbjct: 149 RSTKHCHKSFLELNKFLKHE 168 >gi|241622416|ref|XP_002408958.1| conserved hypothetical protein [Ixodes scapularis] gi|215503100|gb|EEC12594.1| conserved hypothetical protein [Ixodes scapularis] Length = 230 Score = 36.2 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 11/48 (22%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Query: 29 ELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 + K DI I D +V+ + S +H + +L + K+K Sbjct: 93 DEKLTDIAVIAVPEEMVY-TDYLVLCTAVSPRHSRGMFVSLFTQYKRK 139 >gi|158293707|ref|XP_001688607.1| AGAP004955-PB [Anopheles gambiae str. PEST] gi|157016575|gb|EDO63987.1| AGAP004955-PB [Anopheles gambiae str. PEST] Length = 212 Score = 36.2 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L+ A +I + D M IV+GRS +H+ +A+ + K Sbjct: 111 IEDLVTVLRLNSAINIFVCTVPKDIKYV-DYMCIVTGRSVRHMRGMAEFVRKVFK 164 >gi|194864831|ref|XP_001971129.1| GG14786 [Drosophila erecta] gi|190652912|gb|EDV50155.1| GG14786 [Drosophila erecta] Length = 241 Score = 36.2 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ + A+ + K Sbjct: 104 VEDLVELLRKENVDDIFVCYVPENLKYV-DHLVVCSGRSYRHMLTTAEFVRRMFK 157 >gi|195490384|ref|XP_002093117.1| GE21149 [Drosophila yakuba] gi|194179218|gb|EDW92829.1| GE21149 [Drosophila yakuba] Length = 241 Score = 36.2 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 13/55 (23%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++E L++ +DI + D++V+ SGRS +H+ + A+ + K Sbjct: 104 VEDLVELLRKENVDDIFVCYVPENLKYV-DHLVVCSGRSYRHMLTTAEFVRRMFK 157 >gi|33240345|ref|NP_875287.1| hypothetical protein Pro0895 [Prochlorococcus marinus subsp. marinus str. CCMP1375] gi|33237872|gb|AAP99939.1| Uncharacterized similar to plant Iojap protein [Prochlorococcus marinus subsp. marinus str. CCMP1375] Length = 115 Score = 36.2 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 43 LRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 S I D ++I G S V SI +++ L KK Sbjct: 29 KVSSIADWILITEGLSDVQVRSIINSIEDRLNKK 62 >gi|162447754|ref|YP_001620886.1| hypothetical protein ACL_0897 [Acholeplasma laidlawii PG-8A] gi|161985861|gb|ABX81510.1| hypothetical protein ACL_0897 [Acholeplasma laidlawii PG-8A] Length = 104 Score = 36.2 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 12/57 (21%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Query: 18 SCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + +E L+++ A+DI E +S D V+ + + + S LK Sbjct: 2 QLLQQTIEILEKINAQDITVYEFLE-KSPFYDYFVVAT-VNERASQSAVGYFNETLK 56 >gi|224531789|ref|ZP_03672421.1| conserved hypothetical protein [Borrelia valaisiana VS116] gi|224511254|gb|EEF81660.1| conserved hypothetical protein [Borrelia valaisiana VS116] Length = 116 Score = 35.8 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 9/67 (13%), Positives = 28/67 (41%), Gaps = 4/67 (5%) Query: 13 ADHLDSC--IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASI-ADNL 69 + + + + + + + D+ I ++ D +I + S K + ++ D + Sbjct: 1 MEDMLKVSDVNALCKTISDFNGIDVIGINVGNI-CNWTDFFIIATFLSFKQMETLYVDKI 59 Query: 70 ISYLKKK 76 + + K+K Sbjct: 60 VKFFKEK 66 >gi|320584185|gb|EFW98396.1| hypothetical protein HPODL_0076 [Pichia angusta DL-1] Length = 416 Score = 35.8 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 12/52 (23%), Positives = 21/52 (40%), Gaps = 9/52 (17%) Query: 34 DICHIENT---------SLRSLICDNMVIVSGRSTKHVASIADNLISYLKKK 76 DI + + D M+I +G+S+KH+ L Y+K + Sbjct: 3 DIEVFDLRGADSEQTSNEGAQEVADFMIIATGKSSKHLQKATFELNFYVKHQ 54 >gi|118785995|ref|XP_315053.3| AGAP004955-PA [Anopheles gambiae str. PEST] gi|116127674|gb|EAA10357.3| AGAP004955-PA [Anopheles gambiae str. PEST] Length = 254 Score = 35.4 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 14/55 (25%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ L+ A +I + D M IV+GRS +H+ +A+ + K Sbjct: 111 IEDLVTVLRLNSAINIFVCTVPKDIKYV-DYMCIVTGRSVRHMRGMAEFVRKVFK 164 >gi|116624739|ref|YP_826895.1| iojap-like protein [Candidatus Solibacter usitatus Ellin6076] gi|116227901|gb|ABJ86610.1| iojap-like protein [Candidatus Solibacter usitatus Ellin6076] Length = 79 Score = 35.4 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 7/25 (28%), Positives = 15/25 (60%) Query: 52 VIVSGRSTKHVASIADNLISYLKKK 76 +I +G + + + +IA+ + LK K Sbjct: 1 MICTGANQRQIQAIAEEVGLQLKHK 25 >gi|50290661|ref|XP_447763.1| hypothetical protein [Candida glabrata CBS 138] gi|74609411|sp|Q6FPT1|ATP25_CANGA RecName: Full=ATPase synthesis protein 25, mitochondrial; Flags: Precursor gi|49527074|emb|CAG60710.1| unnamed protein product [Candida glabrata] Length = 623 Score = 35.4 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 15/81 (18%), Positives = 34/81 (41%), Gaps = 9/81 (11%) Query: 5 TEKQALQTADHLDSCIATVMECLKELKA-EDICHIENTSLRSL--------ICDNMVIVS 55 +++ ++ D + +++ L++ A DI + + R +CD ++I + Sbjct: 106 SKQHEVRLPDDCPDSLHILVKHLQKQLALRDILVFDLKNQRLADPENYRLKMCDYVIICT 165 Query: 56 GRSTKHVASIADNLISYLKKK 76 STKH + LK + Sbjct: 166 AMSTKHCERSYVEINKLLKNE 186 >gi|254567337|ref|XP_002490779.1| Mitochondrial protein required for the stability of Oli1p mRNA and for the Oli1p ring formation [Pichia pastoris GS115] gi|322518445|sp|C4QZ25|ATP25_PICPG RecName: Full=ATPase synthesis protein 25, mitochondrial; Flags: Precursor gi|238030575|emb|CAY68499.1| Mitochondrial protein required for the stability of Oli1p mRNA and for the Oli1p ring formation [Pichia pastoris GS115] gi|328351163|emb|CCA37563.1| Uncharacterized protein YMR098C [Pichia pastoris CBS 7435] Length = 634 Score = 35.4 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 18/88 (20%), Positives = 33/88 (37%), Gaps = 12/88 (13%) Query: 1 MLANTEKQALQTADHL-----DSCIATVMECLKELKAEDICHIENT-------SLRSLIC 48 + T+ L V +K+L EDI + + + Sbjct: 53 LRTETKVAKPIEMPELPESSPQKLHELVKYFIKDLGIEDIKVFDLSMNEEEEVDGSKFLG 112 Query: 49 DNMVIVSGRSTKHVASIADNLISYLKKK 76 MVI +G+S KH+A ++++LK + Sbjct: 113 KYMVIGTGKSNKHLAKAGTEMMNFLKHE 140 >gi|290462185|gb|ADD24140.1| protein C7orf30 homolog [Lepeophtheirus salmonis] Length = 262 Score = 35.4 bits (81), Expect = 2.9, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I ++ LK+ K D+C ++ +S S ++++I++ +S + ++ ++ + K Sbjct: 127 IEELVNILKKEKCFDVCVLDVSSH-SPFFEHLIIITCKSKRVMSGVSKYIKKLYK 180 >gi|150864460|ref|XP_001383284.2| hypothetical protein PICST_2999 [Scheffersomyces stipitis CBS 6054] gi|149385716|gb|ABN65255.2| predicted protein [Scheffersomyces stipitis CBS 6054] Length = 542 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 14/75 (18%), Positives = 31/75 (41%), Gaps = 11/75 (14%) Query: 11 QTADHLDSCIATVMECLKELKAEDICHIENTSL--------RSLICDNMVIVSGRSTKHV 62 + ++ + V +E +DI + TSL ++ ++I +G+S KH+ Sbjct: 27 NAPETVEEFLKLV---AEEYGLQDIQLFDLTSLPESHPSSTKNQAASYIIICTGKSEKHI 83 Query: 63 ASIADNLISYLKKKN 77 + L +K + Sbjct: 84 YKASSELRLNIKHSH 98 >gi|225710124|gb|ACO10908.1| C7orf30 [Caligus rogercresseyi] Length = 250 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + ++ L++ K D+ ++ S S +++VIVS S + + ++ + K Sbjct: 122 VQELVTVLRKEKCRDVIVMDVKS-LSPFFEHLVIVSCVSKRSMPGVSKYIRKLYK 175 >gi|219110971|ref|XP_002177237.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] gi|217411772|gb|EEC51700.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] Length = 339 Score = 35.1 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 3/61 (4%) Query: 19 CIATVMECLKELKAEDICHIENTSLRSLICDN---MVIVSGRSTKHVASIADNLISYLKK 75 + CLK L DI + + + M+IV+G ST + +AD L+ L++ Sbjct: 160 TKDEIAACLKALGGRDIIVVLDDPKKKRFGGAVIGMIIVTGTSTVQLRKLADALVRQLRR 219 Query: 76 K 76 + Sbjct: 220 R 220 >gi|297738364|emb|CBI27565.3| unnamed protein product [Vitis vinifera] Length = 108 Score = 34.7 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 18/26 (69%) Query: 51 MVIVSGRSTKHVASIADNLISYLKKK 76 MVI +GRS+ HV +IA LI K+K Sbjct: 1 MVIATGRSSWHVKNIAQALIYKAKQK 26 >gi|269792503|ref|YP_003317407.1| Iojap-like protein [Thermanaerovibrio acidaminovorans DSM 6589] gi|269100138|gb|ACZ19125.1| Iojap-related protein [Thermanaerovibrio acidaminovorans DSM 6589] Length = 135 Score = 34.7 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 27 LKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHV 62 L + A+D+ I+ + + D VIV+ + H+ Sbjct: 33 LMDKHAKDVTFIDVRNTLG-VADLFVIVTALNDVHM 67 >gi|154341765|ref|XP_001566834.1| hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] gi|134064159|emb|CAM40356.1| conserved hypothetical protein [Leishmania braziliensis MHOM/BR/75/M2904] Length = 175 Score = 34.7 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 10/53 (18%), Positives = 23/53 (43%), Gaps = 1/53 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 + + + L LK D+C I+ + ++ D +V + +H+ A + Sbjct: 26 VKAIADILTSLKVRDLCCIDVSE-KTSNFDYIVFGTCEGARHIHLAAWAVQDA 77 >gi|225719618|gb|ACO15655.1| C7orf30 homolog [Caligus clemensi] Length = 265 Score = 34.7 bits (79), Expect = 5.0, Method: Composition-based stats. Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 I + LK+ K +DIC ++ + S +MVIVS +S + I+ L K Sbjct: 133 IQELASTLKKEKCKDICVMDVGA-YSPFYQHMVIVSCKSKTSMLGISRYLRKLYK 186 >gi|74317425|ref|YP_315165.1| sulfide-quinone reductase [Thiobacillus denitrificans ATCC 25259] gi|74056920|gb|AAZ97360.1| Sulfide:quinone oxidoreductase [Thiobacillus denitrificans ATCC 25259] Length = 532 Score = 34.3 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 17/36 (47%), Gaps = 5/36 (13%) Query: 34 DICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 DI I+ + L D ++I +G + +AD + Sbjct: 99 DIIQIDLENGDVLFYDYLLIATGTAP-----LADEV 129 >gi|303275055|ref|XP_003056827.1| predicted protein [Micromonas pusilla CCMP1545] gi|226461179|gb|EEH58472.1| predicted protein [Micromonas pusilla CCMP1545] Length = 204 Score = 34.3 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 11/75 (14%), Positives = 29/75 (38%), Gaps = 2/75 (2%) Query: 1 MLANTEKQALQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTK 60 M A+ E +A D I + E +A D+ + + ++ + + Sbjct: 62 MDADDENEAAAEKLARDVAIELAV-IADETRAADVRVLGVSKKVH-WARYFLLATAFNRP 119 Query: 61 HVASIADNLISYLKK 75 + ++A+ + +L + Sbjct: 120 QMRAVAEKIRDHLNE 134 >gi|320165415|gb|EFW42314.1| predicted protein [Capsaspora owczarzaki ATCC 30864] Length = 490 Score = 34.3 bits (78), Expect = 6.5, Method: Composition-based stats. Identities = 8/29 (27%), Positives = 19/29 (65%) Query: 46 LICDNMVIVSGRSTKHVASIADNLISYLK 74 + D M+I + +S++H+ ++A +L + K Sbjct: 309 TLFDTMLIATAKSSRHMEALARDLGAAFK 337 >gi|308485405|ref|XP_003104901.1| hypothetical protein CRE_24525 [Caenorhabditis remanei] gi|308257222|gb|EFP01175.1| hypothetical protein CRE_24525 [Caenorhabditis remanei] Length = 187 Score = 33.9 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Query: 10 LQTADHLDSCIATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNL 69 T+D +D + V+ L + +A+D+ + + + +I S +++ A+I++NL Sbjct: 49 FSTSDDVD-FVGNVVGALTKQRAKDLFVVRSEEKEMTPYSHRIICSVFNSRQAAAISENL 107 Query: 70 ISYLK 74 S LK Sbjct: 108 RSILK 112 >gi|307109382|gb|EFN57620.1| hypothetical protein CHLNCDRAFT_50851 [Chlorella variabilis] Length = 123 Score = 33.9 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Query: 24 MECLKELKA-EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLKK 75 + E KA +DI + + MV+ + S + ++ + + Sbjct: 2 AKIAWETKAGDDILVLNVAPIV-YWTRYMVLCTVFSRPQLNAVLGKMEKEATE 53 >gi|157872553|ref|XP_001684817.1| hypothetical protein [Leishmania major strain Friedlin] gi|7630150|emb|CAB88224.1| hypothetical protein L5213T.03 [Leishmania major] gi|68127887|emb|CAJ06421.1| conserved hypothetical protein [Leishmania major strain Friedlin] Length = 202 Score = 33.9 bits (77), Expect = 7.4, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 23/55 (41%), Gaps = 1/55 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISYLK 74 + + L LK D+C ++ + ++ D M+ + +H+ A + K Sbjct: 53 VKEIANILSSLKVRDLCCVDVSE-KTSNFDYMMFGTCEGARHIHLAAWAVQDADK 106 >gi|281211694|gb|EFA85856.1| hypothetical protein PPL_01088 [Polysphondylium pallidum PN500] Length = 605 Score = 33.5 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 20 IATVMECLKELKAEDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLISY 72 +A +ME L E K ED C I+ + + M++ S S + + + ++L+ Sbjct: 475 VAEIMEVLAETKLEDFCVIDVSD-KCKWTKYMIVASSDSNRVILNAEEDLLEK 526 >gi|242004241|ref|XP_002423016.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212505947|gb|EEB10278.1| conserved hypothetical protein [Pediculus humanus corporis] Length = 499 Score = 33.5 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 10/64 (15%), Positives = 26/64 (40%), Gaps = 5/64 (7%) Query: 14 DHLDSCIATVMECLKELKA--EDICHIENTSLRSLICDNMVIVSGRSTKHVASIADNLIS 71 + + + + L+E KA + I + + + ++ +S + ++A+ L Sbjct: 135 KKAEKDLKRISDLLEEEKARTKSIVLLLIAERKKALIKY-ILAEEKSR--IDAMAEGLEE 191 Query: 72 YLKK 75 KK Sbjct: 192 ESKK 195 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.315 0.172 0.484 Lambda K H 0.267 0.0524 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 953,851,346 Number of Sequences: 14124377 Number of extensions: 45364252 Number of successful extensions: 168311 Number of sequences better than 10.0: 1950 Number of HSP's better than 10.0 without gapping: 1830 Number of HSP's successfully gapped in prelim test: 120 Number of HSP's that attempted gapping in prelim test: 164859 Number of HSP's gapped (non-prelim): 1966 length of query: 77 length of database: 4,842,793,630 effective HSP length: 48 effective length of query: 29 effective length of database: 4,164,823,534 effective search space: 120779882486 effective search space used: 120779882486 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.2 bits) S2: 76 (33.5 bits)