>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily; InterPro: IPR005948 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. In Gram-positive bacteria, which are surrounded by a single membrane and therefore have no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute through the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. Thiamine pyrophosphate 1 is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism. The thiamine ABC transporter, periplasmic binding protein in bacteria is believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane. The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate TPP. ; GO: 0005215 transporter activity, 0006810 transport, 0030288 outer membrane-bounded periplasmic space.

Probab=99.52  E-value=1.4e-14  Score=99.51  Aligned_cols=75  Identities=27%  Similarity=0.391  Sum_probs=60.8

Q ss_pred             CCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCC--CCCHHHHHHCC
Q ss_conf             10686541216316998899999999983999999997400210010687674210125544725--65865786307
Q gi|254780564|r   30 GNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRE--SFELIKTAQNP  105 (107)
Q Consensus        30 G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~~d--~~~l~~~a~n~  105 (107)
T Consensus       241 G~~~QvE~aA~~k~~KqP~LA~kf~~Fl~S~~~Q~~iPT~~w~YPv~~~t~~~~-~~~l~~~~~~~~~~~~~~v~~~~  317 (324)
T TIGR01254       241 GHYLQVEVAARLKGAKQPELADKFVQFLLSPEVQKAIPTGNWMYPVVKGTLLPG-FDKLAQQPTTDTAPAPAEVTANR  317 (324)
T ss_pred             CEEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHCCCCCEEECEECCCCCCC-HHHHCCCCCCCCCCCHHHHHHHH
T ss_conf             706865433112479986789999998307687752354545402011565621-35536886567561157887665