Query gi|254780564|ref|YP_003064977.1| hypothetical protein CLIBASIA_02255 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 107 No_of_seqs 103 out of 848 Neff 5.0 Searched_HMMs 39220 Date Sun May 29 22:07:56 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780564.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 PRK11205 tbpA thiamine transpo 99.8 9.2E-19 2.4E-23 122.0 7.1 77 29-106 237-314 (326) 2 TIGR03261 phnS2 putative 2-ami 99.7 4.7E-17 1.2E-21 112.8 8.4 99 2-106 220-319 (334) 3 TIGR03227 PhnS 2-aminoethylpho 99.6 2.3E-15 5.9E-20 103.7 7.5 102 5-106 236-343 (367) 4 COG4143 TbpA ABC-type thiamine 99.6 2.5E-15 6.4E-20 103.5 5.3 77 29-105 246-323 (336) 5 COG1840 AfuA ABC-type Fe3+ tra 99.5 2.7E-14 6.8E-19 97.9 8.4 97 1-102 180-283 (299) 6 TIGR01254 sfuA ABC transporter 99.5 1.4E-14 3.5E-19 99.5 5.6 75 30-105 241-317 (324) 7 TIGR01276 thiB thiamin/thiamin 98.9 2.1E-10 5.5E-15 76.9 0.4 71 29-100 236-306 (326) 8 PRK09501 potD spermidine/putre 98.7 4.4E-08 1.1E-12 64.4 7.5 70 6-80 232-301 (348) 9 PRK10682 putrescine transporte 98.4 5.9E-07 1.5E-11 58.3 6.1 57 23-80 266-322 (370) 10 pfam01547 SBP_bac_1 Bacterial 98.3 6.5E-07 1.6E-11 58.1 4.6 37 28-64 224-260 (260) 11 COG0687 PotD Spermidine/putres 98.2 6E-06 1.5E-10 52.8 7.1 62 13-79 253-314 (363) 12 PRK04168 hypothetical protein; 98.0 8.3E-06 2.1E-10 52.1 4.3 46 34-80 278-323 (336) 13 COG1653 UgpB ABC-type sugar tr 97.9 3.4E-05 8.7E-10 48.8 6.8 83 6-88 277-366 (433) 14 PRK09474 malE maltose ABC tran 97.8 0.00011 2.8E-09 46.0 7.9 66 5-70 254-321 (394) 15 PRK10974 glycerol-3-phosphate 97.5 0.00017 4.4E-09 45.0 4.9 73 11-83 281-359 (439) 16 PRK11622 putative ABC transpor 97.4 0.00021 5.4E-09 44.5 4.2 60 22-82 291-352 (401) 17 COG0725 ModA ABC-type molybdat 97.4 0.00032 8.1E-09 43.5 5.0 42 33-74 216-257 (258) 18 COG2182 MalE Maltose-binding p 97.3 0.0006 1.5E-08 42.0 5.7 78 9-86 275-354 (420) 19 PRK03537 hypothetical protein; 97.2 0.00094 2.4E-08 41.0 5.8 43 31-75 144-186 (188) 20 PRK10677 modA molybdate transp 96.9 0.0014 3.6E-08 40.0 4.4 36 34-70 218-253 (257) 21 TIGR01256 modA molybdate ABC t 96.8 0.0012 3E-08 40.4 3.5 33 36-68 191-223 (225) 22 COG4134 ABC-type uncharacteriz 96.5 0.0032 8.1E-08 38.1 3.8 45 30-74 288-333 (384) 23 PRK10752 sulfate transporter s 96.4 0.0099 2.5E-07 35.5 5.8 76 12-93 222-302 (329) 24 PRK10852 thiosulfate transport 96.2 0.017 4.3E-07 34.2 6.2 78 11-94 227-309 (338) 25 COG1613 Sbp ABC-type sulfate t 95.7 0.03 7.6E-07 32.9 5.6 72 3-81 230-305 (348) 26 COG2998 TupB ABC-type tungstat 95.1 0.028 7E-07 33.1 3.9 43 26-69 215-261 (280) 27 TIGR00971 3a0106s03 sulfate AB 90.2 0.19 4.9E-06 28.5 2.2 77 12-94 216-297 (320) 28 COG4588 AcfC Accessory coloniz 89.8 0.59 1.5E-05 25.9 4.4 46 27-72 199-251 (252) 29 COG4150 CysP ABC-type sulfate 86.0 0.7 1.8E-05 25.5 2.8 29 44-72 263-291 (341) 30 pfam03202 Lipoprotein_10 Putat 72.7 2.2 5.5E-05 22.8 1.8 28 35-62 6-33 (134) 31 PRK13307 bifunctional formalde 58.2 4.6 0.00012 21.1 1.1 36 29-64 350-385 (392) 32 TIGR02137 HSK-PSP phosphoserin 43.5 4.4 0.00011 21.2 -0.9 46 40-86 63-111 (203) 33 COG0226 PstS ABC-type phosphat 40.7 15 0.00039 18.3 1.5 30 46-76 285-314 (318) 34 pfam12122 DUF3582 Protein of u 33.8 32 0.00081 16.5 2.2 26 42-67 42-68 (126) 35 pfam00123 Hormone_2 Peptide ho 30.8 29 0.00074 16.7 1.6 13 47-59 16-28 (28) 36 TIGR01326 OAH_OAS_sulfhy O-ace 28.0 55 0.0014 15.3 2.8 35 3-54 309-344 (434) 37 PRK10907 intramembrane serine 20.2 71 0.0018 14.6 2.0 31 41-72 39-70 (276) No 1 >PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Probab=99.77 E-value=9.2e-19 Score=122.03 Aligned_cols=77 Identities=27% Similarity=0.353 Sum_probs=64.4 Q ss_pred CCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCC-CCCCCCCHHHHHHCCC Q ss_conf 51068654121631699889999999998399999999740021001068767421012554-4725658657863078 Q gi|254780564|r 29 IGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTY-TNRESFELIKTAQNPP 106 (107) Q Consensus 29 ~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~-~~~d~~~l~~~a~n~p 106 (107) .|++++++|+||+|+|||+++|++|||||+|+++|+.|++.||||||++ +...+.|..... .+.-+++-..|++|+. T Consensus 237 eG~~~~iegagI~k~akn~e~A~kFidfllS~eaQ~~~~~~n~~yPV~~-~~lP~~~~~~~~p~~~~~~~~~~i~~~~~ 314 (326) T PRK11205 237 EGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWMYPVAK-VTLPAGFETLTKPATTLEFTPEEVAANRK 314 (326) T ss_pred CCCEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHHCEEEECCC-CCCCHHHHHCCCCCCCCCCCHHHHHHHHH T ss_conf 8727776678983799998999999999758999998644054452488-87976477457986454579999999999 No 2 >TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transport system, 1-aminoethylphosphonate-binding protein component. This ABC transporter extracellular solute-binding protein is found in a number of genomes in operon-like contexts strongly suggesting a substrate specificity for 2-aminoethylphosphonate (2-AEP). The characterized PhnSTUV system is absent in the genomes in which this system is found. These genomes encode systems for the catabolism of 2-AEP, making the need for a 2-AEP-specific transporter likely. Probab=99.70 E-value=4.7e-17 Score=112.81 Aligned_cols=99 Identities=15% Similarity=0.101 Sum_probs=85.5 Q ss_pred CCHHHHHHHHHCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCC Q ss_conf 44789999851487853550465899851068654121631699889999999998399999999740021001068767 Q gi|254780564|r 2 INASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIIT 81 (107) Q Consensus 2 ~n~yy~~~~k~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~ 81 (107) ...|...+.+.++.++.+++ |.+ |+.++++++||+|++||+++|++|||||+|+|+|+.+++ ++.+|++++|.. T Consensus 220 ~~~~~~~~~~~~g~pv~~v~----P~e-G~~~~~~~~~Ivk~a~n~~~Ak~FidfllS~e~Q~~~a~-~~~~p~~~~v~~ 293 (334) T TIGR03261 220 SMAYRALKEKKKGAPIDVVF----PKE-GLGWDIEATAIIKGSKNNDAAKKLVDWSISDEAMELYAK-NYAVVATPGVAK 293 (334) T ss_pred EECCHHHHHHHCCCCEEEEE----CCC-CCEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHH-CCEECCCCCCCC T ss_conf 73545788764389733894----589-847877358888799898999999999769999999996-490346898878 Q ss_pred C-CCCCCCCCCCCCCCCHHHHHHCCC Q ss_conf 4-210125544725658657863078 Q gi|254780564|r 82 N-RKFNDQTYTNRESFELIKTAQNPP 106 (107) Q Consensus 82 ~-~~~~~~~~~~~d~~~l~~~a~n~p 106 (107) . ..++..-..+.-.+|...+++|+. T Consensus 294 p~~~~p~~~~~~l~~~D~~~~a~nr~ 319 (334) T TIGR03261 294 PDAGFPKNVEDLLIKNDFVWAAANRD 319 (334) T ss_pred CCCCCCCCHHHHCCCCCHHHHHHHHH T ss_conf 76679842354171779999987599 No 3 >TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein. This ABC transporter periplasmic substrate binding protein component is found in a region of the salmonella typhimurium LT2 genome responsible for the catabolism of 2-aminoethylphosphonate via the phnWX pathway (GenProp0238). The protein contains a match to pfam01547 for the "Bacterial extracellular solute-binding protein" domain. Probab=99.60 E-value=2.3e-15 Score=103.67 Aligned_cols=102 Identities=9% Similarity=0.051 Sum_probs=80.8 Q ss_pred HHHHHHHHCCCCCCEEECCCCCCC-CCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCC Q ss_conf 899998514878535504658998-5106865412163169988999999999839999999974002100106876742 Q gi|254780564|r 5 SSVAIFKNHHSEVSVSYTPFLPKD-IGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNR 83 (107) Q Consensus 5 yy~~~~k~~~~~~~v~~~~f~~~D-~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~ 83 (107) +++......+.++.++++--..+. .|++..+.++||+|++||+++|++||+||+|+|+|+.+++.+|.||++++|.++. T Consensus 236 ~~~~~~~~~g~~v~~v~P~~~~g~~~g~~~i~~~i~ivKga~n~e~AkkfidflLS~e~Q~~~a~~~~~~Pv~~~v~l~~ 315 (367) T TIGR03227 236 MDLADAEHGGLNIKIFFPAADAGEPPSAFAIPYAIGLVKGAPNQDAGKKLIDFLLSADAQAKVPDLSFGIPGRSDVPLSD 315 (367) T ss_pred HHHHHHHHCCCCCEEEEECCCCCCCCCEEEEEEHHHHHCCCCCHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCH T ss_conf 43677762799702895467778887348752203464499998999999999729999999998601676778876983 Q ss_pred CCCC-----CCCCCCCCCCHHHHHHCCC Q ss_conf 1012-----5544725658657863078 Q gi|254780564|r 84 KFND-----QTYTNRESFELIKTAQNPP 106 (107) Q Consensus 84 ~~~~-----~~~~~~d~~~l~~~a~n~p 106 (107) .+.. ....+.-.+|-..++++++ T Consensus 316 ~~~~~~~~~~~~~kl~~~Dw~~i~~~r~ 343 (367) T TIGR03227 316 EHGEAAKAAIAGVKLIPPDWDAVAAKKP 343 (367) T ss_pred HHHHHCCCCCCCCEEECCCHHHHHHHHH T ss_conf 5554221332335111589999998789 No 4 >COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism] Probab=99.57 E-value=2.5e-15 Score=103.50 Aligned_cols=77 Identities=25% Similarity=0.313 Sum_probs=66.3 Q ss_pred CCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCC-CCCCCHHHHHHCC Q ss_conf 5106865412163169988999999999839999999974002100106876742101255447-2565865786307 Q gi|254780564|r 29 IGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTN-RESFELIKTAQNP 105 (107) Q Consensus 29 ~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~-~d~~~l~~~a~n~ 105 (107) -|++++++|+|++|++||+++|.+|++||+|+++|+.++++||+||+++++.+.+.|..+.... .-+++--.+++|+ T Consensus 246 eG~ylqiEgaa~~k~~knp~LA~~F~~FmlS~e~Q~~ip~~nwm~Pa~~~~~Lp~~f~~~~~p~~~~~~~~~~v~~~~ 323 (336) T COG4143 246 EGHYLQVEGAAVLKGAKNPELADKFLQFMLSPEFQDAIPTTNWMYPAVKNVPLPAVFDALVKPAKTVSLSPKEVAANR 323 (336) T ss_pred CCCEEEEEEEEECCCCCCHHHHHHHHHHHHCHHHHHHCCCCCEEEECCCCCCCCHHHHHHCCCCCCCCCCHHHHHHHH T ss_conf 885367766531127998799999999970987784078454332347898687778851789876568999999999 No 5 >COG1840 AfuA ABC-type Fe3+ transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=99.54 E-value=2.7e-14 Score=97.92 Aligned_cols=97 Identities=22% Similarity=0.167 Sum_probs=78.9 Q ss_pred CCCHHH--HHHHHHCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCC--CCHHC Q ss_conf 944789--99985148785355046589985106865412163169988999999999839999999974002--10010 Q gi|254780564|r 1 MINASS--VAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALG--EYPII 76 (107) Q Consensus 1 ~~n~yy--~~~~k~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~--eyPv~ 76 (107) +++.|| +...+..+.++.+++ |.+ |+.+++++++|+|+++|+++|++|||||+|+|+|+.++...+ ++|+. T Consensus 180 ~~~~~~~~~~~~~~~~~~v~iv~----P~~-G~~v~~~~vaiik~a~~~e~Ak~fid~llS~egQ~~~~~~~~~~~~~~~ 254 (299) T COG1840 180 LGNLYYGAYAKDKAKGAPVEVVY----PEE-GTGVNPSGVALLKKAKNPEAAKLFIDFLLSKEGQEILAKKGYSPEIPVN 254 (299) T ss_pred EEECCHHHHHHHHCCCCCEEEEE----CCC-CCEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHCCCCCCCCCC T ss_conf 87210799997514698569994----898-8689754355434899989999999998089889999841757667888 Q ss_pred CCCCCCCCCCCCC---CCCCCCCCHHHHH Q ss_conf 6876742101255---4472565865786 Q gi|254780564|r 77 KGIITNRKFNDQT---YTNRESFELIKTA 102 (107) Q Consensus 77 ~gV~~~~~~~~~~---~~~~d~~~l~~~a 102 (107) ..+..++...++. .++.+.+.....+ T Consensus 255 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 283 (299) T COG1840 255 PKAEDSPAALDFADLIALDFETLGKLLEA 283 (299) T ss_pred CCCCCCCCCCCCHHCCCCCHHHHHHHHHH T ss_conf 87666742015022024584430035788 No 6 >TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily; InterPro: IPR005948 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. In Gram-positive bacteria, which are surrounded by a single membrane and therefore have no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute through the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. Thiamine pyrophosphate 1 is a required cofactor synthesized de novo in Salmonella typhimurium. The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism. The thiamine ABC transporter, periplasmic binding protein in bacteria is believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane. The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate TPP. ; GO: 0005215 transporter activity, 0006810 transport, 0030288 outer membrane-bounded periplasmic space. Probab=99.52 E-value=1.4e-14 Score=99.51 Aligned_cols=75 Identities=27% Similarity=0.391 Sum_probs=60.8 Q ss_pred CCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCC--CCCHHHHHHCC Q ss_conf 10686541216316998899999999983999999997400210010687674210125544725--65865786307 Q gi|254780564|r 30 GNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRE--SFELIKTAQNP 105 (107) Q Consensus 30 G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~~d--~~~l~~~a~n~ 105 (107) |++.++++||.+|++||+++|.|||+||+|+++|+.+++.||+|||++|=.+.. |..+...... ++.-..+++++ T Consensus 241 G~~~QvE~aA~~k~~KqP~LA~kf~~Fl~S~~~Q~~iPT~~w~YPv~~~t~~~~-~~~l~~~~~~~~~~~~~~v~~~~ 317 (324) T TIGR01254 241 GHYLQVEVAARLKGAKQPELADKFVQFLLSPEVQKAIPTGNWMYPVVKGTLLPG-FDKLAQQPTTDTAPAPAEVTANR 317 (324) T ss_pred CEEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHCCCCCEEECEECCCCCCC-HHHHCCCCCCCCCCCHHHHHHHH T ss_conf 706865433112479986789999998307687752354545402011565621-35536886567561157887665 No 7 >TIGR01276 thiB thiamin/thiamin pyrophosphate ABC transporter, thiamin/thiamin pyrophospate-binding protein; InterPro: IPR005967 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. In Gram-positive bacteria, which are surrounded by a single membrane and therefore have no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute through the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. Thiamine pyrophosphate (TPP) is a required cofactor synthesized de novo in Salmonella typhimurium . The primary role for TPP is in central metabolism as an electron carrier and nucleophile for such enzymes as pyruvate dehydrogenase (1.2.4.1 from EC), acetolactate synthase (4.1.3.18 from EC), and alpha-ketoglutarate dehydrogenase (1.2.4.2 from EC). Despite its importance in cellular physiology, neither the de novo biosynthetic pathway nor the salvage systems for thiamine are fully understood in any organism. The thiamine ABC transporter, periplasmic binding protein in proteobacteria is believed to be involved in the specific translocation of thiamine and its phosphoesters across the inner membrane The protein belongs to the larger ABC transport system which consists of at least three components: the inner membrane permease; thiamine binding protein and an ATP-binding subunit. It has been experimentally demonstrated that mutants in the various steps in the de novo synthesis of thiamine and its biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate or thiamine pyrophosphate.; GO: 0005524 ATP binding, 0042626 ATPase activity coupled to transmembrane movement of substances, 0006810 transport, 0030288 outer membrane-bounded periplasmic space. Probab=98.91 E-value=2.1e-10 Score=76.85 Aligned_cols=71 Identities=27% Similarity=0.353 Sum_probs=59.6 Q ss_pred CCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCCCCCCCCCCCCCHHH Q ss_conf 510686541216316998899999999983999999997400210010687674210125544725658657 Q gi|254780564|r 29 IGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFNDQTYTNRESFELIK 100 (107) Q Consensus 29 ~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~~~~~~~~d~~~l~~ 100 (107) -||+++|+.|+=++++++++.|.+||.||+||.+|+.+++.|+||||+.+ +..+.|..+.-...-.++++. T Consensus 236 EGH~~QVE~AAR~A~~~~P~~A~~Fl~Fl~SP~~Q~~I~T~N~M~PV~~~-~~~~~F~~L~~~~~Tq~~~~P 306 (326) T TIGR01276 236 EGHILQVELAARVAASKNPELADDFLAFLVSPAAQKAIVTANIMLPVINV-ELEAGFDKLKKQAKTQLEITP 306 (326) T ss_pred CCCHHHHHHHHHHHCCCCCHHHHHHHHHHCCHHHHHCCCCCCEECCEEEE-EECCCHHHHCCCCCCCEEECH T ss_conf 66235566677752588804589999973183563013323212033532-115013541665222102051 No 8 >PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Probab=98.74 E-value=4.4e-08 Score=64.37 Aligned_cols=70 Identities=24% Similarity=0.332 Sum_probs=57.6 Q ss_pred HHHHHHHCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCC Q ss_conf 999985148785355046589985106865412163169988999999999839999999974002100106876 Q gi|254780564|r 6 SVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII 80 (107) Q Consensus 6 y~~~~k~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~ 80 (107) .+.+.+.++.++..++ |++ |+++-+...+|.|+|+|+++|.+||+|+++||+|..+++..+--+.+++.. T Consensus 232 da~~~~~~~~~i~~v~----PkE-G~~~w~D~~~Ipk~A~n~e~A~~FInf~l~Pevaa~~a~~~~y~t~n~~A~ 301 (348) T PRK09501 232 SAFVARQAGTPIDVVW----PKE-GGIFWMDSLAIPANAKNKEGALKLINFLLRPDVAKQVAETIGYPTPNLAAR 301 (348) T ss_pred HHHHHHHCCCCCCEEE----CCC-CCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHHCCCCHHHHHH T ss_conf 8999997089971897----578-866998998898999898999999998619799999999748898308888 No 9 >PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Probab=98.42 E-value=5.9e-07 Score=58.26 Aligned_cols=57 Identities=28% Similarity=0.263 Sum_probs=48.3 Q ss_pred CCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCC Q ss_conf 6589985106865412163169988999999999839999999974002100106876 Q gi|254780564|r 23 PFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII 80 (107) Q Consensus 23 ~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~ 80 (107) +..|++ |+++-+...+|.|+|+|+++|.+||+||++||.+...++..+--+-+++.. T Consensus 266 yv~PkE-G~~~w~D~~~Ipk~A~n~~~A~~FInf~l~Pe~aa~~~~~~~y~~~n~~A~ 322 (370) T PRK10682 266 FSIPKE-GAMAFFDVFAMPADAKNKDEAYQFLNYLLRPDVIAHISDHVFYANANKAAT 322 (370) T ss_pred EEECCC-CCEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHH T ss_conf 981588-745888788886899996999999998509799999998647887538988 No 10 >pfam01547 SBP_bac_1 Bacterial extracellular solute-binding protein. This family also includes the bacterial extracellular solute-binding protein family POTD/POTF. Probab=98.33 E-value=6.5e-07 Score=58.07 Aligned_cols=37 Identities=32% Similarity=0.378 Sum_probs=33.8 Q ss_pred CCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHH Q ss_conf 8510686541216316998899999999983999999 Q gi|254780564|r 28 DIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQ 64 (107) Q Consensus 28 D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~ 64 (107) ..|..+...+.+|.++|+|+++|++||+||+|+|+|. T Consensus 224 ~~~~~~~~~~~~I~~~skn~eaA~~Fi~fl~s~e~Qa 260 (260) T pfam01547 224 GKATFVGGYGLAIPKGSKNKEAAKKFLDFLLSPEAQA 260 (260) T ss_pred CCCCEECCEEEEEECCCCCHHHHHHHHHHHCCHHHCC T ss_conf 9865055479999899999999999999977997569 No 11 >COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Probab=98.20 E-value=6e-06 Score=52.85 Aligned_cols=62 Identities=29% Similarity=0.385 Sum_probs=53.3 Q ss_pred CCCCCCEEECCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCC Q ss_conf 4878535504658998510686541216316998899999999983999999997400210010687 Q gi|254780564|r 13 HHSEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGI 79 (107) Q Consensus 13 ~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV 79 (107) .+.++.++. |++ |+++-.....|.|+++|+++|.+||+||+++++|..+++....-|.+++. T Consensus 253 ~~~~i~~~~----p~e-G~~~w~D~~~ipk~a~n~~~A~~fInf~~~pe~~a~~~~~~~y~~~n~~a 314 (363) T COG0687 253 NGAPIEFVI----PKE-GSILWFDNLAIPKGAKNVDAAYKFINFLLDPEVAAKLAEFVGYAPPNKAA 314 (363) T ss_pred CCCEEEEEC----CCC-CCEEEEEEEEEECCCCCHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCHHH T ss_conf 898057734----788-73478788998799999899999999851989999998732678888777 No 12 >PRK04168 hypothetical protein; Provisional Probab=97.98 E-value=8.3e-06 Score=52.08 Aligned_cols=46 Identities=20% Similarity=0.274 Sum_probs=38.0 Q ss_pred EEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCC Q ss_conf 65412163169988999999999839999999974002100106876 Q gi|254780564|r 34 CSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII 80 (107) Q Consensus 34 ~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~ 80 (107) .+.+++|+++|+|+++|++|++||+|+++|+++.+. ..-|+.+-+. T Consensus 278 IvY~iTV~~~A~n~e~A~~FV~flls~~Gq~il~~~-G~~p~~pp~~ 323 (336) T PRK04168 278 IVYGITVPKNAPNREAAIEFLKYLLDEGGPKIFENN-GQPPIVPPIA 323 (336) T ss_pred EEEEEECCCCCCCHHHHHHHHHHHHCCHHHHHHHHC-CCCCCCCCCC T ss_conf 689876468999989999999998480258999975-9998747502 No 13 >COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Probab=97.94 E-value=3.4e-05 Score=48.77 Aligned_cols=83 Identities=25% Similarity=0.328 Sum_probs=63.9 Q ss_pred HHHHHHHCCC---CCCEEECCCCCC--CCCCEEEEEEEEEECCCCC-HHHHHHHHHHHHCHHHHHH-HHHHCCCCHHCCC Q ss_conf 9999851487---853550465899--8510686541216316998-8999999999839999999-9740021001068 Q gi|254780564|r 6 SVAIFKNHHS---EVSVSYTPFLPK--DIGNILCSTVGGIAESSKK-KSVATQFLRFLLLPIVQQY-IATALGEYPIIKG 78 (107) Q Consensus 6 y~~~~k~~~~---~~~v~~~~f~~~--D~G~~v~vsgagI~k~a~n-~~~A~kfiefLlS~e~Q~~-~a~~~~eyPv~~g 78 (107) ..+.+.+... .+++...|..++ ..+..+-..+.+|.+++++ +++|.+||+||+|++.|.. +.....-.|+.++ T Consensus 277 ~~~~~~~~~~~~~~~~~~~~P~~~~~~~~~~~~~~~~~~i~~~~~~~~~aA~~fi~~l~s~e~q~~~~~~~~g~~P~~~~ 356 (433) T COG1653 277 AIGYFKKAAGPKFDIGVAPLPAGPGGGGAAGGVGGGGLGVSKKSKKHKEAAWKFLEFLTSPEAQAELLAKVTGGLPVRKS 356 (433) T ss_pred HHHHHHHCCCCCCCEEEEECCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCHH T ss_conf 76666513454566468826878887875221155379997489866999999999976908788887741487876255 Q ss_pred CCCCCCCCCC Q ss_conf 7674210125 Q gi|254780564|r 79 IITNRKFNDQ 88 (107) Q Consensus 79 V~~~~~~~~~ 88 (107) +..+...... T Consensus 357 ~~~~~~~~~~ 366 (433) T COG1653 357 AYDDPYDKEA 366 (433) T ss_pred HHCCCCCCCH T ss_conf 4306321210 No 14 >PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Probab=97.83 E-value=0.00011 Score=46.03 Aligned_cols=66 Identities=17% Similarity=0.179 Sum_probs=53.1 Q ss_pred HHHHHHHHCCCCCCEEECCCCCCCCC-CEEEEEEEEEECCCCCHHHHHHHHH-HHHCHHHHHHHHHHC Q ss_conf 89999851487853550465899851-0686541216316998899999999-983999999997400 Q gi|254780564|r 5 SSVAIFKNHHSEVSVSYTPFLPKDIG-NILCSTVGGIAESSKKKSVATQFLR-FLLLPIVQQYIATAL 70 (107) Q Consensus 5 yy~~~~k~~~~~~~v~~~~f~~~D~G-~~v~vsgagI~k~a~n~~~A~kfie-fLlS~e~Q~~~a~~~ 70 (107) +-.+.++..+-+++|+..|-..+..+ .++-+.+.+|.++|+|+++|.+||+ ||+|++.|+.+.... T Consensus 254 W~~~~~~~~~~~~gva~lP~~~g~~~~~~~G~~~~~v~~~s~nk~~A~~Fi~~~l~s~e~~~~~~~~~ 321 (394) T PRK09474 254 WAWSNIDKSGVNYGVTVLPTFNGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLKAVNKDK 321 (394) T ss_pred HHHHHHHHCCCCCEEEECCCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCCHHHHHHHHHCC T ss_conf 54545876498740885888899988752555689998999999999999999963999999986238 No 15 >PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Probab=97.51 E-value=0.00017 Score=44.98 Aligned_cols=73 Identities=16% Similarity=0.131 Sum_probs=49.5 Q ss_pred HHCCCCCCEEECCCCCCCCCCE--EEEEEE--EEEC--CCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCC Q ss_conf 5148785355046589985106--865412--1631--69988999999999839999999974002100106876742 Q gi|254780564|r 11 KNHHSEVSVSYTPFLPKDIGNI--LCSTVG--GIAE--SSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNR 83 (107) Q Consensus 11 k~~~~~~~v~~~~f~~~D~G~~--v~vsga--gI~k--~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~ 83 (107) ++..-+++|...|+.++-.|.- ..+.|. .|.+ +..+.++|.+||+||+|+|.|..+...+.-.|+++.+.... T Consensus 281 ~~~~~~~gva~~P~~~~~~~~~~~~~~gG~~l~v~~~~~~~~~~aA~~Fikflts~e~~~~~~~~tG~lP~~~~a~~~~ 359 (439) T PRK10974 281 KYAKFNYGVGMMPYDADAKGAPQNAIIGGASLWVMQGKDKETYKGVAKFLDFLAKPENAAEWHQKTGYLPITTAAYDLT 359 (439) T ss_pred HHCCCCCEEEECCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCCHHHHHHHHHHCCCCCCCHHHHHHH T ss_conf 6178760478678787767888655347713898668998999999999998459899999998539877756664200 No 16 >PRK11622 putative ABC transporter solute-binding protein; Provisional Probab=97.39 E-value=0.00021 Score=44.48 Aligned_cols=60 Identities=23% Similarity=0.203 Sum_probs=47.6 Q ss_pred CCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHC--CCCHHCCCCCCC Q ss_conf 4658998510686541216316998899999999983999999997400--210010687674 Q gi|254780564|r 22 TPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATAL--GEYPIIKGIITN 82 (107) Q Consensus 22 ~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~--~eyPv~~gV~~~ 82 (107) -.|...+ |++-|+.=.+|..+|+|++.|.-+++||+|+|+|..-.+.. ...||+.--..+ T Consensus 291 r~~~~~~-GtigN~hflAIP~NA~~kagA~VvaNfLLSPEAQ~~K~~p~~WGd~tVLd~~kL~ 352 (401) T PRK11622 291 RSFAFSD-GTIGNTHFVAIPFNANAKAGAKVVANFLLSPEAQLRKADPAVWGDPSVLDPQKLP 352 (401) T ss_pred EEEECCC-CCCCCCCCEEEECCCCCHHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCCHHHCC T ss_conf 2674269-8216765077207999877899999996399999975386424885411645389 No 17 >COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=97.38 E-value=0.00032 Score=43.53 Aligned_cols=42 Identities=21% Similarity=0.176 Sum_probs=37.0 Q ss_pred EEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCH Q ss_conf 865412163169988999999999839999999974002100 Q gi|254780564|r 33 LCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYP 74 (107) Q Consensus 33 v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyP 74 (107) -...+++|+++++|+++|+.|++||.|+++|++|..--|+-+ T Consensus 216 Pi~y~iav~~~~~~~~~A~~f~~fl~s~~a~~il~~~Gf~~~ 257 (258) T COG0725 216 PIVYPIAVLKNAKNPELAKEFVDFLLSPEAQEILEKYGFEPL 257 (258) T ss_pred CEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHCCCCCC T ss_conf 716789997388985999999999718777999998499889 No 18 >COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Probab=97.30 E-value=0.0006 Score=42.05 Aligned_cols=78 Identities=21% Similarity=0.248 Sum_probs=65.4 Q ss_pred HHHHCCCCCCEEECCCCC--CCCCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCCCCCCC Q ss_conf 985148785355046589--985106865412163169988999999999839999999974002100106876742101 Q gi|254780564|r 9 IFKNHHSEVSVSYTPFLP--KDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIITNRKFN 86 (107) Q Consensus 9 ~~k~~~~~~~v~~~~f~~--~D~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~~~~~~ 86 (107) -+++.+.+++|+..|..+ +.+-.++.+-+..|-..|||++.|.+|++|++.++.|+.+.+.+.|.|++.-+...+.++ T Consensus 275 ~~~~~g~n~GvaplP~~~~g~~~~pf~Gv~~~~Vsa~skn~~~A~~f~~~~t~~~~~~~~~~~~~~ipa~~~~~~~~~~~ 354 (420) T COG2182 275 AYKDAGINYGVAPLPTLNNGKKPKPFSGVKGYVVSAASKNKEAAAKFVKYFTNPKNQKLLYDEAGEIPANKAARNDPEVK 354 (420) T ss_pred HHHHCCCCCCEEECCCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHC T ss_conf 23531765345416877888886766552488964889768999999998664899998887558744467754303311 No 19 >PRK03537 hypothetical protein; Provisional Probab=97.21 E-value=0.00094 Score=40.99 Aligned_cols=43 Identities=16% Similarity=0.081 Sum_probs=34.6 Q ss_pred CEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHH Q ss_conf 068654121631699889999999998399999999740021001 Q gi|254780564|r 31 NILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPI 75 (107) Q Consensus 31 ~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv 75 (107) +.....+.+|+++++ +.|+.|++||+|+++|+++..--|.-|. T Consensus 144 ~~~~~Y~iav~~~a~--~~A~~f~~flls~~gQ~iL~~~GF~pp~ 186 (188) T PRK03537 144 AVGANYGLAVLKDAS--EAARPLAEFILSPKGQAILAQYGFSPPP 186 (188) T ss_pred CCCCCEEEEECCCCC--HHHHHHHHHHCCHHHHHHHHHCCCCCCC T ss_conf 666323578736880--9999999997399999999980899999 No 20 >PRK10677 modA molybdate transporter periplasmic protein; Provisional Probab=96.90 E-value=0.0014 Score=40.03 Aligned_cols=36 Identities=14% Similarity=0.129 Sum_probs=30.0 Q ss_pred EEEEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHHHC Q ss_conf 6541216316998899999999983999999997400 Q gi|254780564|r 34 CSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATAL 70 (107) Q Consensus 34 ~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~ 70 (107) ..-.++|+++++|+ .|++|++||+|+++|++|..-- T Consensus 218 i~y~~ai~~~~~~~-~a~~F~~fl~S~~a~~Il~~~G 253 (257) T PRK10677 218 VEYPMAIVEGHNNA-TVSAFYDYLKGPQAAEIFKRYG 253 (257) T ss_pred CEEEEEEECCCCCH-HHHHHHHHHCCHHHHHHHHHHC T ss_conf 14558997599999-9999999977999999999829 No 21 >TIGR01256 modA molybdate ABC transporter, periplasmic molybdate-binding protein; InterPro: IPR005950 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain . The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , . The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , . Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This entry describes the molybdate ABC transporter periplasmic binding protein in bacteria and archae. Several of the periplasmic receptors constitute a diverse class of binding proteins that differ widely in size, sequence and ligand specificity. It has been shown experimentally by radioactive labeling that ModA represents a hydrophylioc periplasmic-binding protein in Gram-negative organisms and its counterpart in Gram-positive organisms is a lipoprotein. The other components of the system include ModB, an integral membrane protein and ModC, the ATP-binding subunit. Almost all of them display a common beta/alpha folding motif and have similar tertiary structures consisting of two globular domains.; GO: 0015412 molybdate transmembrane-transporting ATPase activity, 0015689 molybdate ion transport, 0030288 outer membrane-bounded periplasmic space. Probab=96.82 E-value=0.0012 Score=40.43 Aligned_cols=33 Identities=18% Similarity=0.326 Sum_probs=30.0 Q ss_pred EEEEEECCCCCHHHHHHHHHHHHCHHHHHHHHH Q ss_conf 412163169988999999999839999999974 Q gi|254780564|r 36 TVGGIAESSKKKSVATQFLRFLLLPIVQQYIAT 68 (107) Q Consensus 36 sgagI~k~a~n~~~A~kfiefLlS~e~Q~~~a~ 68 (107) ..++|+++++|.+.|+.|++||-|++++++|-. T Consensus 191 yp~~i~~~g~n~~~a~~f~dyL~sp~A~~il~~ 223 (225) T TIGR01256 191 YPAVIVKGGKNNAAAKAFIDYLKSPEAKEILRK 223 (225) T ss_pred EEEEEEECCCCHHHHHHHHHHHCCHHHHHHHHC T ss_conf 117887168760899999987079647678630 No 22 >COG4134 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Probab=96.50 E-value=0.0032 Score=38.14 Aligned_cols=45 Identities=24% Similarity=0.276 Sum_probs=37.2 Q ss_pred CCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHH-HHHHHHCCCCH Q ss_conf 1068654121631699889999999998399999-99974002100 Q gi|254780564|r 30 GNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQ-QYIATALGEYP 74 (107) Q Consensus 30 G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q-~~~a~~~~eyP 74 (107) |.+=+.--++|.+++++++.|.-|++||+|+|+| +.+-...|--| T Consensus 288 G~vgn~~f~aIPaNa~~~A~alvl~n~lls~EaQlrk~d~~v~~~P 333 (384) T COG4134 288 GMVGNGHFMAIPANANAKAAALVLANFLLSPEAQLRKLDPAVWGDP 333 (384) T ss_pred CCCCCCCEEEECCCCCCCHHHHHHHHHHCCHHHHHHHHCCCCCCCC T ss_conf 6536751698227999706999999886398888765152014896 No 23 >PRK10752 sulfate transporter subunit; Provisional Probab=96.38 E-value=0.0099 Score=35.47 Aligned_cols=76 Identities=14% Similarity=0.124 Sum_probs=47.0 Q ss_pred HCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCC---CHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCC--CCCCC Q ss_conf 1487853550465899851068654121631699---889999999998399999999740021001068767--42101 Q gi|254780564|r 12 NHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSK---KKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIIT--NRKFN 86 (107) Q Consensus 12 ~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~---n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~--~~~~~ 86 (107) .....+.+++++. --+..+..+=|-+.++ ..+.|+.|++||.|+++|++++.. +-.|+.+.|.. ...|+ T Consensus 222 ~g~~~~eiV~P~~-----silae~pVAvVd~~vdk~GTr~~A~ayl~fLys~eaQ~i~Ak~-~yRP~~~~v~~~~~~~FP 295 (329) T PRK10752 222 LGKDKFEIVTPSE-----SILAEPTVSVVDKVVEKKGTREVAEAYLKYLYSPEGQEIAAKN-YYRPRDAEVAKKYENAFP 295 (329) T ss_pred CCCCCCEEECCCC-----CEECCCCEEEEECCCCCCCCHHHHHHHHHHHCCHHHHHHHHHH-CCCCCCHHHHHHHHCCCC T ss_conf 0899862878996-----3551597599834456668899999999986597999999980-889899789887654399 Q ss_pred CCCCCCC Q ss_conf 2554472 Q gi|254780564|r 87 DQTYTNR 93 (107) Q Consensus 87 ~~~~~~~ 93 (107) ....|.. T Consensus 296 ~i~l~ti 302 (329) T PRK10752 296 KLKLFTI 302 (329) T ss_pred CCCEEEE T ss_conf 8514763 No 24 >PRK10852 thiosulfate transporter subunit; Provisional Probab=96.21 E-value=0.017 Score=34.23 Aligned_cols=78 Identities=14% Similarity=0.102 Sum_probs=48.2 Q ss_pred HHCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCC---CHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCC--CCCCC Q ss_conf 51487853550465899851068654121631699---88999999999839999999974002100106876--74210 Q gi|254780564|r 11 KNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSK---KKSVATQFLRFLLLPIVQQYIATALGEYPIIKGII--TNRKF 85 (107) Q Consensus 11 k~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~---n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~--~~~~~ 85 (107) ......+.+++++. .-+.-+..|=|-++++ ..+.|+.|++||.|+++|++++.. +-.|+.+.|. ....| T Consensus 227 ~~g~~~~eiV~Ps~-----sIlae~pVAvVDk~vdk~GTr~vA~AyL~yLyS~eaQ~i~Ak~-~yRP~~~~v~~~~~~~F 300 (338) T PRK10852 227 QYEAQGFEVVIPKT-----NILAEFPVAWVDKNVQANGTEKAAKAYLNWLYSPQAQTIITDY-YYRVNNPEVMDKLKDKF 300 (338) T ss_pred HHCCCCCEEECCCC-----CEEECCCEEEEEECCCCCCCHHHHHHHHHHHCCHHHHHHHHHH-CCCCCCHHHHHHHHCCC T ss_conf 60899714988997-----5660697489860123458899999999986598999999980-89989978987764549 Q ss_pred CCCCCCCCC Q ss_conf 125544725 Q gi|254780564|r 86 NDQTYTNRE 94 (107) Q Consensus 86 ~~~~~~~~d 94 (107) +....|..+ T Consensus 301 P~~~lfti~ 309 (338) T PRK10852 301 PQTELFRVE 309 (338) T ss_pred CCCCEEEEE T ss_conf 985147653 No 25 >COG1613 Sbp ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=95.69 E-value=0.03 Score=32.89 Aligned_cols=72 Identities=17% Similarity=0.182 Sum_probs=49.6 Q ss_pred CHHHHHHHHHCCCCCCEEECCCCCCCCCCEEEEEEEEEECCCC----CHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCC Q ss_conf 4789999851487853550465899851068654121631699----889999999998399999999740021001068 Q gi|254780564|r 3 NASSVAIFKNHHSEVSVSYTPFLPKDIGNILCSTVGGIAESSK----KKSVATQFLRFLLLPIVQQYIATALGEYPIIKG 78 (107) Q Consensus 3 n~yy~~~~k~~~~~~~v~~~~f~~~D~G~~v~vsgagI~k~a~----n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~g 78 (107) |--+++.-.-...++.++++++. +..-...+++...- ..+.|+.|++||.|+++|++++. ++-.|+.+- T Consensus 230 NEA~la~~e~g~~~feiV~Ps~s------i~aEpPVAVVd~~vdkkgtr~vAeAyl~yLys~~gQ~i~Ak-~~yRP~~p~ 302 (348) T COG1613 230 NEALLALNELGGDKFEIVTPSVS------ILAEPPVAVVDKNVDKKGTRKVAEAYLKYLYSPEGQEIAAK-HYYRPRDPE 302 (348) T ss_pred HHHHHHHHHHCCCCCCEECCCEE------EEECCCEEEEECCCCCCCCHHHHHHHHHHHCCHHHHHHHHH-HCCCCCCHH T ss_conf 18888799746887668768602------66069747875112333568999999987558388899998-277889878 Q ss_pred CCC Q ss_conf 767 Q gi|254780564|r 79 IIT 81 (107) Q Consensus 79 V~~ 81 (107) |.. T Consensus 303 v~a 305 (348) T COG1613 303 VAA 305 (348) T ss_pred HHH T ss_conf 887 No 26 >COG2998 TupB ABC-type tungstate transport system, permease component [Coenzyme metabolism] Probab=95.15 E-value=0.028 Score=33.06 Aligned_cols=43 Identities=21% Similarity=0.190 Sum_probs=35.0 Q ss_pred CCCCCCEEEEEEEEEE--CCCC--CHHHHHHHHHHHHCHHHHHHHHHH Q ss_conf 9985106865412163--1699--889999999998399999999740 Q gi|254780564|r 26 PKDIGNILCSTVGGIA--ESSK--KKSVATQFLRFLLLPIVQQYIATA 69 (107) Q Consensus 26 ~~D~G~~v~vsgagI~--k~a~--n~~~A~kfiefLlS~e~Q~~~a~~ 69 (107) ++| -.++|+.++-++ +..| |-.+|.+|++|+.|+++|+.+++- T Consensus 215 ~gd-~~L~N~Ysvi~vNP~r~~~vny~~A~kfi~w~~s~~gq~~Ia~f 261 (280) T COG2998 215 EGD-PSLFNPYSVIAVNPKRVKGVNYTAATKFIEWLMSEKGQNLIAEF 261 (280) T ss_pred CCC-CCCCCCEEEEEECHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHC T ss_conf 178-11167125898761007885711899999999647778888650 No 27 >TIGR00971 3a0106s03 sulfate ABC transporter, sulfate-binding protein; InterPro: IPR005669 Thiosulphate-binding proteins (gene cysP) specifically binds thiosulphate and are involved in the transport systems for this nutrients , . There are two conserved regions in the protein, one located in the N-terminal region and the other in the central part of these proteins. The second pattern includes two adjacent amino acids (Ser-Gly) that, in sbp, are known to be essential for sulphate binding . ; GO: 0015419 sulfate transmembrane-transporting ATPase activity, 0008272 sulfate transport, 0030288 outer membrane-bounded periplasmic space. Probab=90.23 E-value=0.19 Score=28.51 Aligned_cols=77 Identities=19% Similarity=0.213 Sum_probs=42.3 Q ss_pred HCCCCCCEEECCCCCCCCCCEEEEEEEE---EECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCCCHHCCCCCC--CCCCC Q ss_conf 1487853550465899851068654121---631699889999999998399999999740021001068767--42101 Q gi|254780564|r 12 NHHSEVSVSYTPFLPKDIGNILCSTVGG---IAESSKKKSVATQFLRFLLLPIVQQYIATALGEYPIIKGIIT--NRKFN 86 (107) Q Consensus 12 ~~~~~~~v~~~~f~~~D~G~~v~vsgag---I~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~~gV~~--~~~~~ 86 (107) .+.+.|.|++ |.. .-+--++.+- ++..-.-++.|+.+|.||.||++|++++.. |=.|--..|+- ...|| T Consensus 216 ~~~~~FE~V~----P~~-~ILAE~~V~~VDK~V~~~~T~~~A~AYL~yLYSP~~Q~I~~~~-yYR~~~~~v~~K~~~~FP 289 (320) T TIGR00971 216 LEKDKFEIVI----PSE-SILAEPTVSVVDKVVEKKGTKKVAEAYLKYLYSPEGQEIIAKN-YYRVRDAEVAKKYEDKFP 289 (320) T ss_pred HCCCCCEEEC----CCC-CCCCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCHHHHHHHC-CCCCCCHHHHHHHHCCCC T ss_conf 3348726864----774-3213565035743303234589999999740494135676542-678888889867751688 Q ss_pred CCCCCCCC Q ss_conf 25544725 Q gi|254780564|r 87 DQTYTNRE 94 (107) Q Consensus 87 ~~~~~~~d 94 (107) .+.-|..| T Consensus 290 ~~~LF~~~ 297 (320) T TIGR00971 290 KLKLFTID 297 (320) T ss_pred CCEEEEEE T ss_conf 60234672 No 28 >COG4588 AcfC Accessory colonization factor AcfC, contains ABC-type periplasmic domain [General function prediction only] Probab=89.81 E-value=0.59 Score=25.88 Aligned_cols=46 Identities=17% Similarity=0.140 Sum_probs=29.9 Q ss_pred CCCCCEEEEEEE-------EEECCCCCHHHHHHHHHHHHCHHHHHHHHHHCCC Q ss_conf 985106865412-------1631699889999999998399999999740021 Q gi|254780564|r 27 KDIGNILCSTVG-------GIAESSKKKSVATQFLRFLLLPIVQQYIATALGE 72 (107) Q Consensus 27 ~D~G~~v~vsga-------gI~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~~e 72 (107) .|+|.+|-++-- -|+-.-.-...|+.|++||.|+|+|+.|-...|. T Consensus 199 pdig~~v~~~~d~vIyRd~nv~~~~~a~~ea~~F~dyl~S~EAq~ifkkygW~ 251 (252) T COG4588 199 PDIGDAVEIEKDYVIYRDFNVALAKDANKEARDFADYLQSDEAQKIFKKYGWT 251 (252) T ss_pred CCHHCEEECCCCEEEEEECCEEECCCCCHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 85010045166617754020343689997899999997217789999860767 No 29 >COG4150 CysP ABC-type sulfate transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=85.97 E-value=0.7 Score=25.47 Aligned_cols=29 Identities=24% Similarity=0.325 Sum_probs=24.1 Q ss_pred CCCHHHHHHHHHHHHCHHHHHHHHHHCCC Q ss_conf 99889999999998399999999740021 Q gi|254780564|r 44 SKKKSVATQFLRFLLLPIVQQYIATALGE 72 (107) Q Consensus 44 a~n~~~A~kfiefLlS~e~Q~~~a~~~~e 72 (107) ---.+.|+.+++||.|+++|+++++-++. T Consensus 263 ~Gt~~~AkaYl~~LYsp~~Q~i~a~~~~R 291 (341) T COG4150 263 NGTEKAAKAYLNYLYSPQAQTIIAEFYYR 291 (341) T ss_pred CCCHHHHHHHHHHHCCCHHHHHHHHHCCC T ss_conf 26299999999886093887999983530 No 30 >pfam03202 Lipoprotein_10 Putative mycoplasma lipoprotein, C-terminal region. Probab=72.70 E-value=2.2 Score=22.82 Aligned_cols=28 Identities=18% Similarity=0.320 Sum_probs=24.2 Q ss_pred EEEEEEECCCCCHHHHHHHHHHHHCHHH Q ss_conf 5412163169988999999999839999 Q gi|254780564|r 35 STVGGIAESSKKKSVATQFLRFLLLPIV 62 (107) Q Consensus 35 vsgagI~k~a~n~~~A~kfiefLlS~e~ 62 (107) |+-.||-.+.+--+++++||+|+++.+. T Consensus 6 PsLIGIhaNeked~aTk~FV~W~l~~~~ 33 (134) T pfam03202 6 PNLIGIHANEKENAETQKFVNWFLNTEE 33 (134) T ss_pred CCEEEEECCCCCCHHHHHHHHHHHCCCC T ss_conf 7455530576556899999999963740 No 31 >PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Probab=58.24 E-value=4.6 Score=21.07 Aligned_cols=36 Identities=28% Similarity=0.290 Sum_probs=32.2 Q ss_pred CCCEEEEEEEEEECCCCCHHHHHHHHHHHHCHHHHH Q ss_conf 510686541216316998899999999983999999 Q gi|254780564|r 29 IGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQ 64 (107) Q Consensus 29 ~G~~v~vsgagI~k~a~n~~~A~kfiefLlS~e~Q~ 64 (107) .|+-+.+-|.+|+++..-.+.|++|++-|-+++.-+ T Consensus 350 ~gadIvIVG~aIT~S~Dp~~AAreil~~~~~~e~d~ 385 (392) T PRK13307 350 AGADILVVGRAITKSKDVRRAAEQFLNKLNKPEIDQ 385 (392) T ss_pred CCCCEEEECCHHCCCCCHHHHHHHHHHHCCCCCCCC T ss_conf 699899989121378998999999998737777411 No 32 >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein; InterPro: IPR011863 This protein is has been characterised as both a phosphoserine phosphatase and a phosphoserine:homoserine phosphotransferase . In Pseudomonas aeruginosa, where the characterization was done, a second phosphoserine phosphatase (SerB) and a second homoserine kinase (thrB) are found, but in Fibrobacter succinogenes neither are present. . Probab=43.51 E-value=4.4 Score=21.18 Aligned_cols=46 Identities=20% Similarity=0.156 Sum_probs=33.9 Q ss_pred EECCCCCHHHHHHHHHHHHCHHHHHHHHHHC---CCCHHCCCCCCCCCCC Q ss_conf 6316998899999999983999999997400---2100106876742101 Q gi|254780564|r 40 IAESSKKKSVATQFLRFLLLPIVQQYIATAL---GEYPIIKGIITNRKFN 86 (107) Q Consensus 40 I~k~a~n~~~A~kfiefLlS~e~Q~~~a~~~---~eyPv~~gV~~~~~~~ 86 (107) |+++=+--+.|..|++|| ++++|=.+-..| |.||+.+..+-+..|- T Consensus 63 VIA~L~~L~GA~~F~D~L-R~~~QV~ILSDTF~EF~~P~M~~LGFPT~lC 111 (203) T TIGR02137 63 VIATLKLLDGAVDFVDTL-RDRAQVVILSDTFYEFAYPLMKNLGFPTLLC 111 (203) T ss_pred HHHHCCCCCHHHHHHHHH-HHHCCEEEEECCCHHHHHHHHHHCCCCEEEE T ss_conf 876156320268998866-5412067870330454358887458850331 No 33 >COG0226 PstS ABC-type phosphate transport system, periplasmic component [Inorganic ion transport and metabolism] Probab=40.71 E-value=15 Score=18.25 Aligned_cols=30 Identities=33% Similarity=0.444 Sum_probs=23.9 Q ss_pred CHHHHHHHHHHHHCHHHHHHHHHHCCCCHHC Q ss_conf 8899999999983999999997400210010 Q gi|254780564|r 46 KKSVATQFLRFLLLPIVQQYIATALGEYPII 76 (107) Q Consensus 46 n~~~A~kfiefLlS~e~Q~~~a~~~~eyPv~ 76 (107) .....++|++|.+++..|+ +.+...-.|+- T Consensus 285 ~~~~~~~Fi~~~~~~~~~~-~~~~~Gyvplp 314 (318) T COG0226 285 KAPAVKAFLDWALSPGGQQ-IVEEVGYVPLP 314 (318) T ss_pred CCHHHHHHHHHHHCCCCCE-EHHHCCEECCC T ss_conf 5889999999996787600-15208816187 No 34 >pfam12122 DUF3582 Protein of unknown function (DUF3582). This domain is found in bacteria, and is approximately 130 amino acids in length. It is found associated with pfam01694. There is a conserved ASW sequence motif. This domain has a single completely conserved residue F that may be functionally important. Probab=33.77 E-value=32 Score=16.53 Aligned_cols=26 Identities=23% Similarity=0.210 Sum_probs=10.6 Q ss_pred CCCCCHHHHHHH-HHHHHCHHHHHHHH Q ss_conf 169988999999-99983999999997 Q gi|254780564|r 42 ESSKKKSVATQF-LRFLLLPIVQQYIA 67 (107) Q Consensus 42 k~a~n~~~A~kf-iefLlS~e~Q~~~a 67 (107) .+..+.+.|+.. -+||.-|.-.++-+ T Consensus 42 ~de~~~~~a~~el~~Fl~nP~~~kYqa 68 (126) T pfam12122 42 ADEEQLAQAEAELAEFLQNPNDPKYQA 68 (126) T ss_pred ECHHHHHHHHHHHHHHHHCCCCHHHHH T ss_conf 586779999999999997889678998 No 35 >pfam00123 Hormone_2 Peptide hormone. This family contains glucagon, GIP, secretin and VIP. Probab=30.78 E-value=29 Score=16.73 Aligned_cols=13 Identities=31% Similarity=0.600 Sum_probs=10.2 Q ss_pred HHHHHHHHHHHHC Q ss_conf 8999999999839 Q gi|254780564|r 47 KSVATQFLRFLLL 59 (107) Q Consensus 47 ~~~A~kfiefLlS 59 (107) .-.|++||+||.+ T Consensus 16 ~~~ak~fl~~L~~ 28 (28) T pfam00123 16 QLAAKKFLQWLMN 28 (28) T ss_pred HHHHHHHHHHHHC T ss_conf 8889999999749 No 36 >TIGR01326 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase; InterPro: IPR006235 This family of sequences is a distinct clade of the Cys/Met metabolism pyridoxal phosphate-dependent enzyme superfamily. Members include examples of OAH/OAS sulfhydrylase, an enzyme with activity both as O-acetylhomoserine sulfhydrylase (OAH, 2.5.1.49 from EC) and O-acetylserine sulfhydrylase (OAS, 2.5.1.47 from EC). An alternate name for OAH sulfhydrylase is homocysteine synthase.; GO: 0016765 transferase activity transferring alkyl or aryl (other than methyl) groups, 0006520 amino acid metabolic process. Probab=27.99 E-value=55 Score=15.26 Aligned_cols=35 Identities=37% Similarity=0.576 Sum_probs=24.2 Q ss_pred CHHHHHHHHHCCCCCC-EEECCCCCCCCCCEEEEEEEEEECCCCCHHHHHHHH Q ss_conf 4789999851487853-550465899851068654121631699889999999 Q gi|254780564|r 3 NASSVAIFKNHHSEVS-VSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFL 54 (107) Q Consensus 3 n~yy~~~~k~~~~~~~-v~~~~f~~~D~G~~v~vsgagI~k~a~n~~~A~kfi 54 (107) |.--+|.|++.|+.|. |.| || |.+.++=++|+|++ T Consensus 309 NA~kVA~fL~~Hp~V~wV~Y----PG-------------L~s~~~h~lAkkYl 344 (434) T TIGR01326 309 NALKVAEFLEAHPKVAWVNY----PG-------------LASHPHHALAKKYL 344 (434) T ss_pred HHHHHHHHHHCCCCCCCCCC----CC-------------CCCCHHHHHHHHHH T ss_conf 99999999727884451348----88-------------78875378899874 No 37 >PRK10907 intramembrane serine protease GlpG; Provisional Probab=20.20 E-value=71 Score=14.64 Aligned_cols=31 Identities=23% Similarity=0.249 Sum_probs=16.3 Q ss_pred ECCCCCHHHHHHHH-HHHHCHHHHHHHHHHCCC Q ss_conf 31699889999999-998399999999740021 Q gi|254780564|r 41 AESSKKKSVATQFL-RFLLLPIVQQYIATALGE 72 (107) Q Consensus 41 ~k~a~n~~~A~kfi-efLlS~e~Q~~~a~~~~e 72 (107) +.+..+.+.|+.-+ +|+..|..+++-+. .|+ T Consensus 39 l~de~~~~~a~~~l~~Fl~~P~~~ry~~a-sw~ 70 (276) T PRK10907 39 LADESQAERVRAELARFLENPADPRYLAA-SWQ 70 (276) T ss_pred ECCHHHHHHHHHHHHHHHHCCCCHHHHHH-HHH T ss_conf 51836799999999999809897789998-764 Done!