BLAST/PSIBLAST alignment of GI: 254780564 and GI: 297567102 at iteration 1
>gi|297567102|ref|YP_003686074.1| family 1 extracellular solute-binding protein [Meiothermus silvanus DSM 9946] Length = 353
>gi|296851551|gb|ADH64566.1| extracellular solute-binding protein family 1 [Meiothermus silvanus DSM 9946] Length = 353
 Score = 46.2 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 36/65 (55%)

Query: 15  SEVSVSYTPFLPKDIGNILCSTVGGIAESSKKKSVATQFLRFLLLPIVQQYIATALGEYP 74
           ++  V+   F P D+G +   T  GI  +SK ++ AT+FL +LL    Q Y    + EYP
Sbjct: 249 AKAGVATHYFAPGDVGGLALVTGAGILATSKHQTNATRFLNYLLSKKAQPYFVDEVREYP 308

Query: 75  IIKGI 79
           +I G+
Sbjct: 309 VIAGV 313