RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780565|ref|YP_003064978.1| hypothetical protein CLIBASIA_02260 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) >gnl|CDD|112611 pfam03806, ABG_transport, AbgT putative transporter family. Length = 502 Score = 26.6 bits (59), Expect = 1.7 Identities = 11/23 (47%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Query: 45 SSFGFYIVMLLSFFAGVLVSFFG 67 SS G YIV+ +FFA V+ F Sbjct: 336 SSMGTYIVI--AFFAAQFVAMFN 356 >gnl|CDD|35180 COG5621, COG5621, Predicted secreted hydrolase [General function prediction only]. Length = 354 Score = 25.7 bits (56), Expect = 2.8 Identities = 11/40 (27%), Positives = 16/40 (40%), Gaps = 4/40 (10%) Query: 5 RLSIPKSRMNLAV----EDKETRLYRRYWEGEYKTSGRVS 40 + IP +N+ E+ YWEG + SG S Sbjct: 305 EVKIPSRGLNVKTAALDENAWMATSIPYWEGPIELSGPTS 344 >gnl|CDD|34875 COG5278, COG5278, Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms]. Length = 207 Score = 25.7 bits (56), Expect = 3.2 Identities = 9/33 (27%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Query: 37 GRVSSFKKSSFGFYIVMLLSFFAGVLVSFFGLI 69 R+ KK F I +LL A S++ + Sbjct: 3 KRMPIRKKIILSFVIGVLLLLLASG-ASYWSIQ 34 >gnl|CDD|145511 pfam02405, DUF140, Domain of unknown function DUF140. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 150 amino acids long. Length = 215 Score = 23.9 bits (53), Expect = 9.2 Identities = 7/19 (36%), Positives = 11/19 (57%) Query: 51 IVMLLSFFAGVLVSFFGLI 69 IV L +FF G +++ G Sbjct: 17 IVALTAFFIGAVLALQGAY 35 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.326 0.138 0.399 Gapped Lambda K H 0.267 0.0742 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 802,778 Number of extensions: 32266 Number of successful extensions: 233 Number of sequences better than 10.0: 1 Number of HSP's gapped: 233 Number of HSP's successfully gapped: 22 Length of query: 69 Length of database: 6,263,737 Length adjustment: 40 Effective length of query: 29 Effective length of database: 5,399,377 Effective search space: 156581933 Effective search space used: 156581933 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (23.4 bits)