BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780565|ref|YP_003064978.1| hypothetical protein CLIBASIA_02260 [Candidatus Liberibacter asiaticus str. psy62] (69 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780565|ref|YP_003064978.1| hypothetical protein CLIBASIA_02260 [Candidatus Liberibacter asiaticus str. psy62] Length = 69 Score = 139 bits (349), Expect = 1e-35, Method: Compositional matrix adjust. Identities = 69/69 (100%), Positives = 69/69 (100%) Query: 1 MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAG 60 MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAG Sbjct: 1 MSQTRLSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSFFAG 60 Query: 61 VLVSFFGLI 69 VLVSFFGLI Sbjct: 61 VLVSFFGLI 69 >gi|254780787|ref|YP_003065200.1| translation initiation factor IF-2 [Candidatus Liberibacter asiaticus str. psy62] Length = 884 Score = 23.9 bits (50), Expect = 0.50, Method: Composition-based stats. Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Query: 21 ETRLYRRYWEGEYKTSGRVSSFKKSS 46 ETR R Y +GE K VS F+KSS Sbjct: 48 ETRKRRSYVQGEEK----VSVFRKSS 69 >gi|254780605|ref|YP_003065018.1| putative aminopeptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 609 Score = 21.2 bits (43), Expect = 3.4, Method: Compositional matrix adjust. Identities = 10/38 (26%), Positives = 20/38 (52%) Query: 6 LSIPKSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFK 43 + +P + ++ +D+ RLYR+ + +GR S K Sbjct: 145 VDVPYNPIDSLWKDRPQRLYRKVAMQDMAYAGRESQEK 182 >gi|254780485|ref|YP_003064898.1| biotin synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 328 Score = 21.2 bits (43), Expect = 3.9, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 1 MSQTRLSIPKSRMNLA 16 +S R+ +PKSR+ LA Sbjct: 259 ISVARILMPKSRLRLA 274 >gi|254780420|ref|YP_003064833.1| carbamoyl phosphate synthase small subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 396 Score = 20.4 bits (41), Expect = 5.6, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 16/32 (50%) Query: 26 RRYWEGEYKTSGRVSSFKKSSFGFYIVMLLSF 57 RR W + G +SF KSS Y V+ + + Sbjct: 182 RRDWSEKIWKWGEETSFLKSSDAKYHVVCIDY 213 >gi|254780740|ref|YP_003065153.1| peptidase S16 lon domain protein [Candidatus Liberibacter asiaticus str. psy62] Length = 221 Score = 20.4 bits (41), Expect = 6.5, Method: Composition-based stats. Identities = 7/19 (36%), Positives = 14/19 (73%) Query: 37 GRVSSFKKSSFGFYIVMLL 55 GR++SF ++ G YI+ ++ Sbjct: 82 GRITSFVETDDGHYIMTVI 100 >gi|254780922|ref|YP_003065335.1| glucose-1-phosphate thymidylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 292 Score = 20.0 bits (40), Expect = 7.8, Method: Compositional matrix adjust. Identities = 11/42 (26%), Positives = 19/42 (45%) Query: 10 KSRMNLAVEDKETRLYRRYWEGEYKTSGRVSSFKKSSFGFYI 51 ++R+ L V E YR + E + + F S +G Y+ Sbjct: 241 ENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYL 282 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.326 0.138 0.399 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,548 Number of Sequences: 1233 Number of extensions: 1186 Number of successful extensions: 10 Number of sequences better than 100.0: 10 Number of HSP's better than 100.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of query: 69 length of database: 328,796 effective HSP length: 40 effective length of query: 29 effective length of database: 279,476 effective search space: 8104804 effective search space used: 8104804 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.2 bits) S2: 31 (16.5 bits)