HHsearch alignment for GI: 254780567 and conserved domain: PRK08770

>PRK08770 DNA polymerase III subunits gamma and tau; Validated.
Probab=98.92  E-value=1.3e-07  Score=66.73  Aligned_cols=186  Identities=19%  Similarity=0.227  Sum_probs=118.6

Q ss_pred             CCCCEEECCCHHHHHHHHHH-HHCCCC-CEEEEECCCCCCHHHHHHHHHHHHCCCCH----------HHHHHH-------
Q ss_conf             84541653618999999985-101678-84999878777868899999986276201----------356764-------
Q gi|254780567|r   39 SRDDLLVHSAIEQAVRLIDS-WPSWPS-RVVILVGPSGSGKSCLANIWSDKSRSTRF----------SNIAKS-------   99 (246)
Q Consensus        39 ~~dnFiv~~~N~~A~~~i~~-~~~~~~-~~l~i~G~~GsGKTHLl~a~~~~~~~~~~----------~~~~~~-------   99 (246)
T Consensus        14 ~f~~~-~gq--~~~~~~l~~~~~~~~~~~a~lf~g~rg~gkt~~ar~~a~~lnc~~~~~~~pc~~c~~c~~i~~~~~~d~   90 (663)
T PRK08770         14 RFAEL-VGQ--EHVVRALSNALDSGRVHHAFLFTGTRGVGKTTIARIFAKSLNCETGTSADPCGQCPACLDIDAGRYIDL   90 (663)
T ss_pred             CHHHH-CCC--HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCCCCE
T ss_conf             46452-285--999999999997099740476227998888899999999867899999997877877898854898865


Q ss_pred             ------------HHHH---------HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH----CCCC-CEEEEECCCCCCHHH
Q ss_conf             ------------4454---------6666665334332100376103354555431----1234-215640354320022
Q gi|254780567|r  100 ------------LDSI---------LIDTRKPVLLEDIDLLDFNDTQLFHIINSIH----QYDS-SLLMTARTFPVSWGV  153 (246)
Q Consensus       100 ------------~~~~---------~~~~~~~i~iddi~~~~~~ee~lf~l~n~~~----~~~~-~iilts~~~p~~~~~  153 (246)
T Consensus        91 ~e~daas~~~v~~~r~~~~~~~~~p~~~~~kvy~idevhmls~------~~fna~lktleepp~~v~f~~att~~~k~p~  164 (663)
T PRK08770         91 LEIDAASNTGVDDVREVIENAQYMPSRGKFKVYLIDEVHMLSK------AAFNALLKTLEEPPEHVKFLLATTDPQKLPV  164 (663)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCCCCCEEEEEEECHHHCCH------HHHHHHHHHHCCCCCCEEEEEECCCHHHCCH
T ss_conf             8864676588899999998443588777436999700433289------9999998740278644289985487333748


Q ss_pred             HHHHHHHHHHHCCEEEECCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCHH
Q ss_conf             34566788521222450788978999999998666289798899999994066798999999999999999847787889
Q gi|254780567|r  154 CLPDLCSRLKAATVVKISLPDDDFLEKVIVKMFADRQIFIDKKLAAYIVQRMERSLVFAEKLVDKMDNLALSRGMGITRS  233 (246)
Q Consensus       154 ~l~DL~SRl~~g~~~~I~~pdde~~~~il~k~~~~r~i~l~~~v~~yl~~r~~Rs~~~l~~~l~~Ld~~sl~~kr~ITi~  233 (246)
T Consensus       165 ---t~~sr---c~~f~~~~~~~~~~~~~l~~~~~~e~~~~~~~~~~~~~~~~~gs~rd~lsl~~q~--~~~-~~~~~~~~  235 (663)
T PRK08770        165 ---TVLSR---CLQFNLKRLDEDQIQGQMTRILAAEQIESDPSAIVQLSKAADGSLRDGLSLLDQA--IAY-AGGALRED  235 (663)
T ss_pred             ---HHHHH---HHHCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHH--HHH-CCCCCCHH
T ss_conf             ---99988---8763437799999999999999983997699999999997478567788899999--986-68976899


Q ss_pred             HHHHHHHHH
Q ss_conf             999999867
Q gi|254780567|r  234 LAAEVLKET  242 (246)
Q Consensus       234 lvk~vL~~~  242 (246)
T Consensus       236 ~v~~mlg~~  244 (663)
T PRK08770        236 VVRTMLGTV  244 (663)
T ss_pred             HHHHHHCCC
T ss_conf             999984888